Page 1

Gorny & Mosch • Giessener Münzhandlung Kunst der Antike Juni 2019

264

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20, D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de www.gmcoinart.de

Auktion Kunst der Antike 27. Juni 2019

264


Gorny & Mosch‘s representative in Russia

Terminvorschau

Mr. Andrey Pyatygin Arbat 38/1, Bld. 2 119002 Moscow, Russia

Auktion 265

14. Oktober 2019 Münzen der Antike Einlieferungsschluss 2. August 2019

Auktion 266

15./16. Oktober 2019 Mittelalter, Neuzeit und Russland Einlieferungsschluss 2. August 2019

E-Auktion 267

17./18. Oktober 2019 Münzen aus Antike und Neuzeit Einlieferungsschluss 2. August 2019

Auktion 268

Dezember 2019 Kunst der Antike Einlieferungsschluss September 2019

7.-8. März 2020, Numismata München

Auktion 269-270

9.-11. März 2020 Münzen Antike und Neuzeit

E-Auktion 271

12./13. März 2020 Münzen Antike und Neuzeit

Office Phone: 007 915 014 3539 Email: gornyandmosch@mail.ru

Representative in Russia Mr. Andrey Pyatygin BC „Berta Khaus“ Staropimenovskiy per. 18 125009 Moscow, Russia Office Phone: 007 916 723 9527 Email: gornyandmosch@mail.ru

Die Echtheit der Stücke wird gewährleistet. All objects are guaranteed genuine. Impressum

Die Echtheit der Stücke wird gewährleistet. All objects are guaranteed genuine. Gorny & Mosch ist Partner von Art Loss Register. Sämtliche Gegenstände in diesem sofern sie Gorny & Mosch ist Partner von Art Katalog, Loss Register. eindeutig identifizierbar sind und einen Schätzwert Sämtliche Gegenstände in diesem Katalog, sofern von mind. 1.000,– identifizierbar € haben, wurden vor der Versteigerung sie eindeutig sind, wurden vor der mit dem Datenbankbestand des Registers individuell Versteigerung mit dem Datenbankbestand des abgeglichen. Registers individuell abgeglichen. Gorny Gorny & & Mosch Mosch have have retained retained the the Art Art Loss Loss Register Register to to check all uniquely identifiable items offered for sale check all uniquely identifiable items offered for sale in Art LossatRegister‘s in this this catalogue catalogue against that arethe estimated more than the computerized database of objects stolen equivalent of 1,000.– € against thereported Art Loss as Register‘s or lost. computerized database of objects reported as stolen or lost.

Herausgeber GORNY & MOSCH Giessener Münzhandlung GmbH München Bearbeitung Dr. Georg Morawietz Dr. Martin Schulz Irene Rulka, M. A. Dr. Margret Nollé Gestaltung GORNY & MOSCH Digitale Fotografie Michael Girschick, Starnberg Layout, Satz & Montage Hartmut Baier Grafikdesign Druck Meister Print & Media GmbH, Kassel Alle Rechte vorbehalten, insbesondere die der Übersetzung und der fotomechanischen Wiedergabe. Nachdruck, auch auszugsweise, nur mit schriftlicher Genehmigung des Herausgebers. Printed in Germany

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20, D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de www.gmcoinart.de Amtsgericht München HRB Nr. 75528 Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch


Auktion Kunst der Antike 27. Juni 2019

264 in den eigenen Geschäftsräumen at our office

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20 · D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de · www.gmcoinart.de Amtsgericht München HRB Nr. 75528 · Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch


Ihre Ansprechpartner Mit Ihren Fragen und Anliegen können Sie sich direkt an die dafür zuständigen Mitarbeiter wenden. Geschäftsführung Dieter Gorny Dr. Hans-Christoph von Mosch Sekretariat Anna Pryazhennikova Tel.: +49-(0)89/2 42 26 43-0 Dace Tretjaka Tel.: +49-(0)89/2 42 26 43-13 Auktionsverwaltung Sybille Ostendorf Tel.: +49-(0)89/2 42 26 43-20 Chiara Spandri Tel.: +49-(0)89/2 42 26 43-36 Antike Münzen und Kunstobjekte Dr. Georg Morawietz Tel.: +49-(0)89/2 42 26 43-19 Dr. Martin Schulz Tel.: +49-(0)89/2 42 26 43-23 Dr. Margret Nollé Tel.: +49-(0)89/2 42 26 43-25 Münzen und Medaillen von Mittelalter bis Moderne Marc Raffler Tel.: +49-(0)89/2 42 26 43-14 Buchhaltung Anne Otter Tel.: +49-(0)89/2 42 26 43-21 Online-Kommunikation Irene Rulka, M.A. Tel.: +49-(0)89/2 42 26 43-22

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20 D-80333 München Tel.: +49-(0)89/2 42 26 43-0 Fax: +49-(0)89/2 28 5513 www.gmcoinart.de E-mail: info@gmcoinart.de Amtsgericht München HRB Nr. 75528 Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch Ust-IdNr. DE 129 359 049

Konten Bank Accounts Postbank BLZ 700 100 80 Kto.-Nr. 1503 84-802 BIC (SWIFT): PBNKDEFF IBAN: DE 28 700 100 80 01503 848 02 Commerzbank München BLZ 700 400 41 Kto.-Nr. 66 67 117 00 BIC (SWIFT): COBADEFF XXX IBAN: DE 73 700 400 41 06667 117 00 HypoVereinsbank München BLZ 700 202 70 Kto.-Nr. 002 860 120 BIC (SWIFT): HYVEDEMM XXX IBAN: DE 36 700 202 70 00028 601 20


Inhaltsübersicht Table of Contents

Besichtigung

in den eigenen Geschäftsräumen

Auction lot viewing at our office

Donnerstag, den 27. Juni 2019 10:00 Uhr Griechenland und Rom Vasen . . . . . . . . . . . . . . . . . . . . 001-082 Terrakottaskulptur . . . . . . . . . 083-103 Steinskulptur . . . . . . . . . . . . . 104-123 Bronzeskulptur . . . . . . . . . . . . 124-185 Wandmalerei . . . . . . . . . . . . . . . . .186 Geräte . . . . . . . . . . . . . . . . . . . 187-215 Lampen . . . . . . . . . . . . . . . . . . 216-239 Schmuck . . . . . . . . . . . . . . . . . 240-316 Kameen, Gemmen, Siegel . . 317-348

14.00 Uhr Griechenland und Rom Glas . . . . . . . . . . . . . . . . . . . . . 349-380 Nordafrika . . . . . . . . . . . . . . . . . . 381-422 Alter Orient . . . . . . . . . . . . . . . . . 423-481 Ur- und Frühgeschichte . . . . . . 482-510 Byzanz . . . . . . . . . . . . . . . . . . . . . 511-531 Islam. . . . . . . . . . . . . . . . . . . . . . . 532-533 Praekolumbische Kunst . . . . . . 534-601 Nordamerika. . . . . . . . . . . . . . . . . . . .602 Asien . . . . . . . . . . . . . . . . . . . . . . 603-630 Mittelalter . . . . . . . . . . . . . . . . . . 631-634 Neuzeit. . . . . . . . . . . . . . . . . . . . . 635-636 Antikisierendes . . . . . . . . . . . . . 637-649 Lots . . . . . . . . . . . . . . . . . . . . . . . . 650-921

Sonntag, den 23. Juni 2019 von 13.00 – 17.00 Uhr Dienstag, den 25. Juni 2019 und Mittwoch, den 26. Juni 2019 von 10.00 – 18.00 Uhr am Tag der Auktion ab 9.00 Uhr und nach vorheriger Vereinbarung. Sunday, June 23, 2019 from 1.00 p.m. – 5.00 p.m. Tuesday, June 25, 2019 and Wednesday, June 26, 2019 from 10.00 a.m. – 6.00 p.m. on the day of the auction from 9.00 a.m. and by appointment. Unsere Ergebnisliste steht drei Tage nach unserer Auktion im Internet für Sie bereit: Our list of prices realized is available three days after the sale: http://www.gmcoinart.de

3


LIVE BIDDING – EIN KOSTENLOSER SERVICE Nutzen Sie unsere komfortable Möglichkeit der Teilnahme an unseren Auktionen via Internet von überall auf der Welt. Alles was Sie dazu brauchen ist ein aktueller Webbrowser, wie zum Beispiel Mozilla Firefox, Google Chrome oder Internet Explorer. Sie können über ein Smartphone, Tablet, Notebook oder PC jederzeit mitbieten. Seien Sie »live« dabei, wenn der Hammer fällt. Hören Sie den Auktionator und sehen Sie das aktuelle Los inkl. aktuellem Gebotsstand sowie Beschreibung. Nutzen Sie die Gelegenheit, Ihre Lieblingsstücke zu ersteigern. Verpassen Sie keinen Ausruf Ihrer Lieblingsstücke und bieten Sie jederzeit – von zu Hause aus oder unterwegs – einfach und bequem per Mausklick mit.

In nur fünf Schritten zu Ihrem erfolgreichen Zuschlag: 1. 2. 3. 4. 5.

Registrieren Sie sich bitte unter www.gmcoinart.de (bis spätestens 24 Stunden vor Auktionsbeginn). Aktivieren Sie anschließend die Registrierung über den Link in Ihrer Bestätigungs-E-Mail. Der Anmeldeprozess ist nun abgeschlossen. Sie erhalten Ihre Zugangsdaten per E-Mail. Bereits jetzt haben Sie die Möglichkeit, Ihre Gebote abzugeben. Am Auktionstag reicht eine kurze Anmeldung auf www.gmcoinart.de und Sie können jederzeit »live« in die Auktion einsteigen.

www.gmcoinart.de – immer einen Besuch wert. 4


FREE LIVE INTERNET BIDDING Take advantage of this comfortable possibility to attend our current auction via Internet from all over the world at any given time. All you need is a current web browser, e.g. Mozilla Firefox, Google Chrome or Internet Explorer. At any time you can place your bid via smartphone, tablet computer, notebook or personal computer. Be live with us when the hammer falls. Listen to the auctioneer and watch the current lot as well as its latest price and description. Take the opportunity to buy your favorite piece. Don’t miss any starting price of a lot and bid at any time – wherever you are – simply and comfortably by a mouse click.

Only five steps to your successful hammer price: 1. 2. 3. 4. 5.

Please register on www.gmcoinart.de (at least 24 hours before the auction starts). Activate the registration with the link in your confirmation email. The registration process has finished now. You will receive your login data with an email. You already have the opportunity to place your bids now. On the day of the auction only a quick login on www.gmcoinart.de is necessary for being “live” any time at our auction.

www.gmcoinart.de – always worth a visit. 5


Hinweise für Käufer 1.

Der Ausruf erfolgt zu 80% des im Katalog angegebenen Schätzpreises. Gebote darunter werden nicht akzeptiert! 2. Differenzbesteuerte Ware: Der Zuschlagpreis bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld. Käufern aus Deutschland und EU-Ländern wird ein Aufgeld von 25% berechnet; die gesetzliche Umsatzsteuer ist in diesem Betrag bereits enthalten. Käufern aus Drittländern wird ein Aufgeld von 20% berechnet. Wird die Ware vom Käufer selbst oder durch Dritte in Drittländer ausgeführt, wird die gesetzliche Umsatzsteuer berechnet, nach Vorlage der gesetzlich geforderten Ausfuhrnachweise jedoch erstattet. Wird die Ware von uns selbst in Drittländer ausgeführt, wird die gesetzliche Umsatzsteuer nicht berechnet. Die Beachtung der Zollvorschriften des Bestimmungslandes liegt in der Verantwortung der Bieter. 3. Vollbesteuerte Ware bzw. Ware in Vorübergehender Verwendung: In Ausnahmefällen unterliegen die Stücke der Vollbesteuerung (gekennzeichnet mit +) bzw. befinden sich in der Vorübergehenden Verwendung (gekennzeichnet mit ); betroffene Losnummern werden als solche gekennzeichnet. Die Details bzgl. Aufgeld und Steuern entnehmen Sie bitte den Versteigerungsbedingungen am Ende des Kataloges. 4. Mit dem beiliegenden Formular können Sie schriftliche Gebote abgeben. Kaufen Sie erstmals bei uns ein, geben Sie bitte auf dem Formular den Namen eines Händlers an, dem Sie gut bekannt sind (Referenz). 5. Änderungen nach Drucklegung des Kataloges finden Sie im OnlineKatalog auf unserer Website unter www.gmcoinart.de/online-katalog. 6. Die Bezahlung kann in bar, mit Scheck, per Überweisung oder mit EC-Karte erfolgen. Bankspesen bei Auslandsschecks und -überweisungen betragen 15 € bzw. 50 € ab einem Betrag von 25.000 €. 7. Der ideale Weg, Objekte zu ersteigern, ist die persönliche Teilnahme an unseren Auktionen. Selbst kurz vor der Auktion und in den Pausen können die Objekte noch in aller Ruhe besichtigt werden. 8. Die Kosten für Verpackung, Versicherung und Versand werden gesondert ausgewiesen. 9. Das Abonnement von vier Katalogen kostet 45 €. Wenn Sie unsere Kataloge abonnieren wollen, überweisen Sie bitte den entsprechenden Betrag auf unser Postbank-Konto (siehe S.2). Der Preis für einen einzelnen Katalogband beträgt 15 €. 10. Im Streitfall gelten die Versteigerungsbedingungen am Ende des Kataloges.

Hinweise für Einlieferer Wenn Sie einzelne Objekte oder eine Sammlung versteigern lassen wollen, sind Sie bei uns an der richtigen Adresse! 1. 2.

3. 4. 5. 6. 7.

8. 9.

6

Wir garantieren Ihnen eine fachgerechte Bearbeitung und qualitative Publikation Ihrer Stücke in unseren Katalogen. Unsere Kataloge erreichen einen großen internationalen Kundenkreis, der durch unsere Präsenz auf den wichtigen internationalen Börsen stetig erweitert wird. Mit dieser Voraussetzung können wir Ihnen einen guten Verkauf Ihrer Stücke versprechen. Es werden nur Objekte einzeln in die Auktion aufgenommen, deren Schätzwert über 500 € liegt. Für nicht verkaufte Stücke werden keine Gebühren berechnet. Unsere Verkaufsprovision beträgt 20% des Zuschlagspreises. Die Firma Gorny & Mosch schätzt Ihre Stücke nach dem derzeitigen Marktwert. Zu hoch angesetzte Limite werden nicht akzeptiert. Drei Wochen vor der Auktion übersenden wir Ihnen eine Auflistung der Objekte, die in die Auktion aufgenommen wurden, mit den dazugehörigen Schätzpreisen. Auf diese Weise sind Sie über den Bestand Ihrer Objekte in unserem Hause bestens informiert. Die Auszahlung der Einlieferer erfolgt 54 Tage nach der Auktion. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Wir freuen uns auf Ihren Anruf. Telefon: +49-(0)89/24 22 643-0.

Deutsch


English

Guide for Bidders 1.

Lots will open at 80% of the estimates listed in the catalogue. No bids under this limit will be accepted. 2. Goods subject to sale in the margin: the hammer price is the basis for the calculation of the buyer´s premium. Buyers from Germany and EU-countries will be charged a premium of 25%; the relevant VAT is already included in this amount. Buyers from countries outside the EU will be charged a premium of 20%. As far as these buyers export the goods in person or by a third party the relevant VAT will be charged but refunded after receiving the legal proof of exportation. In case that we export the goods the relevant VAT will not be charged. Bidders are responsible for respecting customs laws of the countries of destination of the lots. 3. Goods subject to tax in full or to temporary admission: in exceptional cases the lots are subject to taxation in full (marked with +) or to temporary admission (marked with ); these lot numbers will be indicated as such. For details regarding buyer´s premium and taxes please see the conditions of sale at the end of the catalogue. 4. Bidders can submit written bids with the accompanying bid sheet. If you are bidding in our auction sale for the first time, please give us the name of another dealer that knows you well as a reference. 5. Changes made after the printing of the catalogue are reflected in our online-catalogue on our website at www.gmcoinart.de/online_ catalogue. 6. Payment may be made by cash, valid check or bank/post wire. Bank charges of 15 € (50 € for amounts of 25.000 € or more) will occur in case of payment by foreign check or bank wire. 7. The best way to take part in our auctions is to attend in person. Up to the time of sale and even between the sessions you will be able to view the lots at your leisure. 8. Packing, insurance and postage are charged separately. 9. A subscription of four catalogues costs 45 €. Would you like to subscribe our catalogues please credit the appropriate amount to our Postbank account (see page 2). The price for a single catalogue is 15 €. 10. The conditions of sale at the end of the catalogue will be used as guidelines in case of dispute.

Guide for Consigners Whether you are consigning single objects or a collection, we are the people to see! 1. 2.

3. 4. 5. 6. 7.

8. 9.

We guarantee a competent description of your objects and quality presentation in our catalogues. Our catalogues reach a vast international clientele which is constantly increased by our presence at the largest international shows. This promises favourable results when we auction your objects. Only objects with an estimated value of over 500 € will be sold as individual lots. You will not be charged any fees for your unsold lots. Our seller’s commission is 20% of the hammer price. The company Gorny & Mosch estimates your objects according to current market value. Artificially high reserves will not be accepted. Three weeks before auction we will send you a list of your objects which are in sale with their corresponding estimates. This way you are fully informed of the status of the objects you have entrusted to us. Payment to consigners is made 54 days after the sale. Would you like to receive copies of our contracts without making any commitment or do you have any other question? We will be pleased to help you. Please call on +49-(0)89/24 22 64 3-0.

7


Avvertenze per compratori 1.

Al principio dell´asta viene chiamato l´80% del prezzo di stima indicato nel catalogo. Offerte inferiori non saranno prese in considerazione! 2. Merce a regime di margine: il prezzo aggiudicato costituisce la base di calcolo per il soprapprezzo da pagare da parte dell’acquirente. Agli acquirenti residenti in Germania e nei paesi europei viene calcolato il 25 % di soprapprezzo; In questa somma é gia compresa l’IVA prevista dalla legge. Agli acquirenti residenti in paesi terzi viene calcolato il 20%. Se la merce sarà esportata tramite terzi o dall’acquirente stesso in paesi terzi, viene calcolata l’IVA prevista dalla legge, ma verrá rimborsata alla presentazione di un certificato di esportazione previsto dalla legge. Se la spedizione e quindi l’esportazione verso paesi terzi verrà effettuata da Gorny & Mosch, non viene calcolata l’IVA prevista dalla legge. L’offerente risponde all’osservanza del regolamento doganale del paese di destinazione. 3. Merce a tassazione piena ovvero merce a utilizzo provvisorio: in casi d’eccezione i lotti sono soggetti a tassazione piena (contrassegnati con +) ossia si trovano in uno stato di utilizzo provvisorio (contrassegnati con ). I lotti coinvolti saranno indicati come tali. Informazioni dettagliate su soprapprezzo e tassazione, sono indicate nelle condizioni dell’asta in fondo al catalogo. 4. Offerte in forma scritta possono essere rilasciate compilando il modulo in allegato. Se acquista per la prima volta da Gorny&Mosch, La preghiamo di indicare nel formulario il nome di un commerciante di Sua conoscenza come referenza. 5. Eventuali correzioni effettuate dopo la stampa del catalogo sono disponibili nel nostro sito ufficiale sotto il link www.gmcoinart.de/ online_catalogue. 6. Il pagamento può essere effettuato in contanti, tramite assegno valido o via bonifico bancario. Le spese bancarie per pagamento mediante assegno estero o bonifico bancario equivalgono a 15 € (ossia 50 € a partire da un ammontare di 25.000 €). 7. Partecipare di persona all’asta è un modo migliore per acquistare oggetti. Durante l’asta si ha l’occasione di ispezionare gli oggetti e valutarne personalmente la qualità. 8. Le spese di imballaggio, di assicurazione e di spedizione vengono addebitati a parte. 9. Il prezzo dell´abbonamento di quattro cataloghi è di 45 €. Se ha interesse ad un abbonamento, La preghiamo di versare la corrispondente somma sul nostro conto corrente postale (vedi pag. 2). Il prezzo per un singolo catalogo è di 15 €. 10. In caso di controversie, valgono le condizioni di vendita elencate in fondo al catalogo. Avvertenze per venditori Se vuole consegnare singoli oggetti o collezioni per la vendita all’asta – siamo le persone giuste a cui rivolgersi! 1. 2.

3. 4. 5. 6. 7. 8. 9.

8

Le garantiamo una schedatura e una pubblicazione professionale della merce a noi affidata. I nostri cataloghi raggiungono una vasta cerchia internazionale di collezionisti, che viene continuamente allargata per l´impegno promozionale che poniamo nel partecipare alle più importanti manifestazioni internazionali del settore. I clienti presenti alle nostre aste sono collezionisti seri e professionali. All´asta vengono accettati singolarmente solo oggetti il cui valore è superiore a 500 €. Non vengono addebitate spese per oggetti invenduti. La nostra commissione di vendita ammonta al 20% del prezzo d’aggiudicazione. Gli oggetti vengono valutati a seconda del valore di mercato attuale. Limiti troppo elevati non vengono accettati. Tre settimane prima dell´asta, Le verrà inviata la lista degli oggetti che saranno messi all´asta con il corrispettivo valore stimato. In tal modo teniamo al corrente il cliente sulla situazione della merce a noi affidata. Il pagamento del venditore verrà effettuato 54 giorni dopo la fine dell´asta. Può fare richiesta, non impegnativa, dei contratti per la consegna di oggetti. In caso di ulteriori domande, siamo a Sua completa disposizione. Ci può contattare al numero: Tel.: +49-(0)89/24 22 643-0.

Italiano


Français

Informations pour les enchérisseurs 1.

Les enchères débuteront à 80% du prix estimé dans le catalogue. Toute offre inférieure ne sera pas acceptée. 2. Objets sous le régime de la marge bénéficiaire: la commission à payer se calcule à partir du prix d’adjudication. Elle est de 25% pour les clients provenant d’Allemagne ou d’autres pays européens (la TVA applicable étant déjà prise en compte dans ce montant) et de 20% pour ceux provenant de pays hors de l’UE. Si la marchandise est exportée hors de l’UE par le client ou un tiers, la TVA réglementaire est tout d’abord facturée, avant d’être remboursée dès réception des preuves officielles d’exportation. Si la marchandise est envoyée hors de l’UE par nos soins, la TVA n’est pas calculée. Les enchérisseurs sont responsables du respect de la réglementation douanière en vigueur dans le pays de destination. 3. Objets sous le régime d´imposition intégrale ou d’admission temporaire: dans certains cas, les pièces sont soumises au régime d’imposition intégrale (marquées par +) ou d’admission temporaire (marquées par ); les numéros concernés seront indiqués comme tels. Pour toute information sur la commission et les taxes, veuillez consulter les conditions de vente à la fin du catalogue. 4. Le formulaire ci-joint vous permet de faire une offre d’achat écrite. Si vous achetez pour la première fois chez nous, merci de nous fournir le nom d’une maison de vente aux enchères où vous êtes bien connu(e) (référence). 5. Toute modification après édition du catalogue est affichée dans notre catalogue en ligne. Vous pouvez consulter celui-ci sur www. gmcoinart.de/online_catalogue. 6. Le règlement peut se faire en espèces, par chèque ou virement. Le paiement par chèque ou virement de l’étranger augmente de 15 € ou bien 50 € à partir d‘un montant de 25.000 €. 7. L’idéal est de participer personnellement aux enchères: vous pouvez juste avant la vente et pendant les pauses examiner les objets à volonté. 8. Les frais d’emballage, de port et d’assurance seront calculés/ indiqués séparément. 9. Le prix d’un catalogue s’élève à 15 €; l’abonnement à quatre catalogues à 45 €. Pour vous abonner, veuillez verser ce montant sur notre compte postal „Postbank“ (voir p.2). 10. En cas de litige, les conditions de vente exposées à la fin du catalogue font foi. Informations pour les vendeurs Vous souhaitez vendre aux enchères un objet unique ou votre collection? Vous êtes chez nous à la bonne adresse! 1. 2.

3. 4. 5. 6. 7. 8. 9.

Nous garantissons une description professionnelle de vos objets et une publication de haute qualité dans nos catalogues. Nos catalogues s’adressent à une vaste clientèle internationale, qui augmente continuellement grâce à notre participation aux grands salons professionnels mondiaux. De cette façon, vos pièces ont de grandes chances d’être vendues à de bons prix. Les objets, dont l’estimation est supérieure à 500 €, sont vendus séparément. Aucun frais ne vous sera facturé pour les pièces non vendues. Notre commission se chiffre à 20% du prix de l’adjudication. La société Gorny & Mosch GmbH évalue vos objets conformément aux prix du marché. Les prix de réserve trop élevés ne seront pas acceptés. Trois semaines avant la vente aux enchères, nous vous envoyons un inventaire des pièces proposées avec leur estimation. Ainsi, vous restez informé(e) du statut des objets que vous nous avez confiés. Le produit de la vente est versé 54 jours après celle-ci. Vous pouvez nous adresser, à titre indicatif, une demande de contrat de dépôt de pièces. Vous avez d’autres questions? Nous sommes heureux de pouvoir y répondre au +49-(0)89/24 22 64 3-0.

9


GRIECHENLAND UND ROM VASEN

1

11


1

1 $WWLVFKHU.RORQHWWHQNUDWHUGHV6FKZHLQH0DOHUVUm 470 v. Chr. H 41,9cm, B 39,8cm, Ă˜ MĂźndung 33,2cm, Ă˜ 33,7cm, Ă˜ FuĂ&#x; FP5RW}JXULJ'HWDLOVLQ5RW$XIGHU9RUGHUVHLWHHLQH8Q WHUULFKWVV]HQH/LQNVVWHKWGHUE”UWLJH/HKUHUPLW6FKXOWHUPDQ WHOGHUVHLQHPUHFKWVVWHKHQGHQMXJHQGOLFKHQ6FKŠOHUGHUJDQ] LQHLQ+LPDWLRQJHKŠOOWLVWHLQ%DUELWRQPLW5HVRQDQ]N¤USHUDXV 6FKLOGNU¤WHQSDQ]HUUHLFKW'HU/HKUHUWU”JWHLQHQ(IHXXQGGHU 6FKŠOHUHLQHQ/RUEHHUNUDQ]'DUŠEHUDXIGHP+DOVHLQ/RWXV NQRVSHQIULHV PLW HLQJHVWHOOWHQ 3XQNWHQ $XI GHU 5ŠFNVHLWH GLH VWDUNEHULHEHQH'DUVWHOOXQJHLQHV0DQWHOMŠQJOLQJVPLW*HKVWRFN XQG (IHXNUDQ] Â?EHU GHP )Xg HLQ 6WUDKOHQNUDQ] 8QWHU GHP )Xg]DKOUHLFKH3DDUHXQG*UXSSHQYRQ/¤FKHUQGLHDXIHLQH DQWLNH 5HSDUDWXU ]XUŠFNJHKHQ 0LW .RSLH GHU 5HFKQXQJ $XI GHU9RUGHUVHLWHXQGDQGHU0ŠQGXQJXQGGHP)XgDXVJURgHQ

12

)UDJPHQWHQ]XVDPPHQJHVHW]WGDEHLNOHLQHUH(UJ”Q]XQJHQXQG JU¤gHUH)DUEUHWXVFKHQ u Provenienz: Ex Sammlung James Stirt, Schweiz; fĂźr diese in den 1970er Jahren bei V. Rosenbaum, Galleria Serodine, Ascona erworben. Vgl. zum Beispiel den Krater Metropolitan Museum, New York 41.162.86 (ARV2&9$&DPEULGJH0$XD7DIDE%HD]OH\$UFKLYH 3RWWHU\'DWDEDVH  $WWLFUHG}JXUHGFROXPQNUDWHURIWKH3LJ3DLQWHU$ERXW%&2QWKH frontside a music lesson. To the left the teacher with barbiton, to the right WKH\RXWKIXOSXSLO2QWKHEDFNVLGHDGUDSHG\RXWK,QVLGHWKHIRRWVHYHUDO pairs and groups of holes from an ancient repair. Frontside, rim and foot are reassembled from fragments, little areas at the cracks are missing, few parts RIWKHULPDQGIRRWDUHUHSDLQWHGWKHJUHDWHUSDUWRIWKH}JXUHRIWKHEDFNVLGH is rubbed off. With copy of the invoice!


2

2 $WWLVFKHU.RORQHWWHQNUDWHUGHV0DOHUVYRQ/RXYUH& 510 v. Chr. H 30,8cm, B 34,2cm, Ø Mündung 28,9cm, Ø FuÃ&#x; FP6FKZDU]}JXULJ'HWDLOVLQ5RWXQG:HLg$XI6HLWH$ EHVWHLJW HLQ .ULHJHU PLW JHVFKXOWHUWHP 6FKLOG XQG ]ZHL 6SHH UHQ HLQH 4XDGULJD 9RU XQG KLQWHU GLHVHU VWHKHQ ]ZHL ZHLWHUH +RSOLWHQ XQG HLQ 0DQWHOM©QJOLQJ $XI 6HLWH % OLQNV HLQ -©QJ OLQJ PLW 6FKLOG (V IROJHQ QDFK UHFKWV HLQ 0DQWHOM©QJOLQJ HLQ 5HLWHUXQGHLQ+RSOLW*HUDKPWVLQGGLH%LOGIHOGHUVHLWOLFKYRQ GRSSHOWHQ (IHXUDQNHQ XQG REHQ YRQ HLQHP =XQJHQVWDE GHU DXI 6HLWH % DOWHUQLHUHQG URWH XQG VFKZDU]H =XQJHQ DXIZHLVW $XIGHP0©QGXQJVUDQGHLQ)ULHVLQ6LOKRXHWWHQWHFKQLNEHVWH KHQGDXV3DQWKHUQXQG=LHJHQE¤FNHQDXIGHQ+HQNHOSODWWHQMH HLQH3DOPHWWH0LWGHU5HFKQXQJYRQ .RSLH $XVJURgHQ )UDJPHQWHQ]XVDPPHQJHVHW]WNOHLQH5HWXVFKHQDQGHQ%UXFK NDQWHQXQGDXIGHP+DOV u

Provenienz: Aus der Sammlung George Krimitsas, erworben 1998 bei Jean 0LNDV*DOOHU\3DULVHUZRUEHQLQGHQHU-DKUHQ Vgl. den Krater Louvre CP 11267A: Paralipomena 154,2; CVA 12 Taf. %HD]OH\$UFKLYH3RWWHU\'DWDEDVH $WWLFEODFN}JXUHFROXPQNUDWHURIWKH3DLQWHURI/RXYUH& %&2QVLGH$DZDUULRUZLWKVKRXOGHUHGVKLHOGFOLPELQJDFKDULRW%HKLQG DQGLQIURQWRIWKHFKDULRWWZRKRSOLWHVDQGDGUDSHG\RXWK2QVLGH%RQWKH OHIWD\RXWKZLWKVKLHOGWRWKHULJKWDGUDSHG\RXWKDKRUVHPDQDQGDKRSOLWH 2QWKHPRXWKLQVLOKRXHWWHWHFKQLTXHDIULH]HZLWKSDQWKHUVDQGJRDWVRQ the handles palmettes. Reassembled from large fragments, small retouched areas at the cracks and on the neck. Accompanied by the invoice from 1998 (copy)!

13


2

2

14


3

3 $WWLVFKH+DOVDPSKRUDGHU*UXSSHYRQ0©QFKHQ v. Chr. H 37,4cm, Ø 24,6cm, Ø Mündung 18,1cm, Ø FuÃ&#x; FP 6FKZDU]}JXULJ 'HWDLOV LQ 5RW XQG :HLg %HLGVHLWLJ LVW GHU $EVFKLHG YRQ .ULHJHUQ GDUJHVWHOOW $XI 6HLWH $ UHLFKW GLH(KHIUDXLKUHPUHFKWVVWHKHQGHQDOV+RSOLWJHU©VWHWHQ(KH PDQQ 6FKLOG]HLFKHQ /¤ZHQSURWRPH  HLQ 6DOEJHI”g "  KLQWHU LKUVWHKWHLQZHLWHUHU.ULHJHU 6FKLOG]HLFKHQ6WLHUSURWRPH XQG DXIGHQ6HLWHQMHZHLOVHLQ6N\WKH$XIGHUDQGHUHQ6HLWHYHUDE VFKLHGHWOLQNVGHUZHLgKDDULJH9DWHUVHLQ6RKQ 6FKLOG]HLFKHQ

(EHUSURWRPH 1DFKUHFKWVIROJHQHLQ6N\WKHGLH(KHIUDXXQG HLQZHLWHUHU.ULHJHU 6FKLOG]HLFKHQ'UHLIXg ,QGHQ+HQNHO]R QHQ3DOPHWWHQ5DQNHQXQG/RWXVEO©WHQ8PODXIHQGXQWHUGHQ %LOGIHOGHUQHLQ7LHUIULHVPLW/¤ZHQXQGHLQHP(EHULQ6LOKRXHW WHQWHFKQLNGDUXQWHUHLQ6WUDKOHQNUDQ]$XIGHP+DOV3DOPHWWHQ XQG GDUXQWHU DXI GHU 6FKXOWHU HLQ URWVFKZDU]HU =XQJHQIULHV $XIGHU8QWHUVHLWHHLQ*UDI}WRLQ)RUPHLQHV3IHLOHVQDFKXQ WHQVRZLH,,,,.OHLQH$EVSOLWWHUXQJHQDQGHU0©QGXQJVRQVW LQWDNW u

15


3

Provenienz: Ex Sammlung P.C., Süddeutschland, erworben 1986 aus der 6DPPOXQJ:DOW]0©QFKHQEHL*RUQ\ 0RVFK$XNWLRQ/RV 'LH2UQDPHQWHXQWHUGHQ+HQNHOQHULQQHUQQRFKDQGLHGHU*UXSSHYRQ 7RURQWRGRFKHQWVSULFKWGLH0DOHUHLHKHUGHU*UXSSHYRQ0©QFKHQ 1512. 3XEOL]LHUWLQ%HD]OH\$UFKLYH3RWWHU\'DWDEDVH (LQ VHKU ”KQOLFKHV 2UQDPHQW GHU *UXSSH YRQ 7RURQWR  DXI GHU QDPHQVJHEHQGHQ+DOVDPSKRUD7RURQWR HKHP $%9 &9$7DI(.XQ]H*¤WWH'HU.OHRSKUDGHV0DOHUXQWHU 0DOHUQVFKZDU]}JXULJHU$PSKRUHQ  7DI%HD]OH\$UFKLYH3RWWHU\ 'DWDEDVH(LQPRWLYLVFK”KQOLFKHUVWLOLVWLVFKMHGRFKXQWHUVFKLHGOLFKHU .ULHJHUDEVFKLHG DXV GHU *UXSSH YRQ 7RURQWR  DXI GHU +DOVDPSKRUD

16

7DUTXLQLD&9$7DI%HD]OH\$UFKLYH3RWWHU\'DWDEDVH Sehr gut vergleichbar ist hingegen aus der Gruppe von München 1512 die +DOVDPSKRUD6W3HWHUVEXUJ%.XQ]H*¤WWHD261UPLW7DI %HD]OH\$UFKLYH3RWWHU\'DWDEDVH RKQH$EE  $WWLFEODFN}JXUHQHFNDPSKRUDRIWKH*URXS0XQLFK%& 2QERWKVLGHVDZDUULRUOHDYLQJKLVIDPLO\2QVLGH$D\RXQJZRPDQJLYLQJ KHUKXVEDQGDSUHVHQWERWKDUH~DQNHGE\DVHFRQGZDUULRUDQGWZRVF\WKLDQV 2QWKHRWKHUVLGHWKHZDUULRUVWDQGLQJQH[WWRKLVIDWKHURQWKHOHIWEHKLQG KLPDVF\WKLDQKLVZLIHDQGDQRWKHUZDUULRU%HORZWKHKDQGOHVSDOPHWWHV DQGORWXVEHORZWKHLPDJHVDIULH]HLQVLOKRXHWWHWHFKQLTXHZLWKOLRQVDQGD boar. Little splinters of the rim are missing, otherwise intact.


4

4 $WWLVFKH+\GULDGHU$WDODQWH*UXSSHY&KU+FP %PLW+HQNHOQFPk&RUSXVFPk0©QGXQJFP k)XgFP6FKZDU]}JXULJ'HWDLOVLQ5RW'DV+DXSWELOG DXIGHP%DXFK]HLJWZLHGHUDWWLVFKH+HOG7KHVHXVPLWGHP0L QRWDXURVN”PSIWVHLWOLFK]ZHLMXQJH)UDXHQ*HUDKPWZLUGGDV %LOGDQGHQ6HLWHQGXUFKMHZHLOV]ZHL5HLKHQYRQ(IHXEO”WWHUQ $XI GHU 6FKXOWHU GUHL 6LUHQHQ GDU©EHU 3XQNWUHLKH EHU GHP )Xg6WUDKOHQNUDQ](LQ+HQNHOZDUEHUHLWVDQWLNJHEURFKHQZR YRQPHKUHUH/¤FKHUI©U0HWDOOVWLIWH]HXJHQ0LW.RPPHQWDUYRQ &DULQD:HLg8QLYHUVLW”W:©U]EXUJ$XgHUGHPDQWLNJHEURFKH QHQXQGZLHGHUDQJHVHW]WHQ+HQNHOLQWDNW u

Provenienz: Ehemals Sammlung E.C., Franken, erworben in den 1920er XQGHU-DKUHQ3XEOL]LHUW%HD]OH\$UFKLYH3RWWHU\'DWDEDVH 9JOGLH+\GULD0DQFKHVWHU8QLYHUVLW\,,,+$%9%HD]OH\$UFKLYH 3RWWHU\'DWDEDVH $WWLFEODFN}JXUHK\GULDRIWKH$WDODQWH*URXS%&2QWKHPDLQ SLFWXUHWKH}JKWEHWZHHQ7KHVHXVDQG0LQRWDXURVRQWKHVLGHVWZR\RXQJ ZRPHQDQGWZRURZVRILY\2QWKHVKRXOGHUWKUHHVLUHQVEHORZRIDURZRI GRWV$ERYHWKHIRRWUD\V2QHKDQGOHUHDWWDFKHG6HYHUDOGULOOLQJVIRUPHWDOO SLQVVKRZWKDWWKLVKDQGOHZDVEURNHQRIILQDQWLTXLW\DOUHDG\2WKHUZLVH intact. With note from Carina Weiß!

17


5

5 $WWLVFKH +\GULD    Y &KU + FP % PLW +HQNHOQ FD FP k &RUSXV FP k 0©QGXQJ FP k )Xg FP .DOSLV PLW DEJHUXQGHWHU 6FKXOWHU 6FKZDU]}JXULJ 'H WDLOV LQ 5RW $XI GHP &RUSXV HLQ DXVJHVSDUWHV %LOGIHOG GDULQ 'LRQ\VRVPLW5K\WRQ]ZLVFKHQ]ZHLW”Q]HOQGHQ6DW\UQGDU©EHU ]ZHL3XQNWUHLKHQ5RWH/LQLHQXQWHUXQG©EHUGHP%LOGIHOGXQG LP0©QGXQJVLQQHUHQ)XgJHEURFKHQXQGZLHGHUDQJHVHW]WHLQ +HQNHOHUJ”Q]W u Provenienz: Ehemals Sammlung E.C., Franken, erworben in den 1920er und HU-DKUHQEHL*RUQ\ 0RVFK$XNWLRQ/RV 3XEOL]LHUW%HD]OH\$UFKLYH3RWWHU\'DWDEDVH $WWLFEODFN}JXUHNDOSLV%&2QWKHFRUSXVDSDQHOZLWK'LRQ\VRV ZLWKUK\WRQEHWZHHQPLQFLQJVDW\UV$ERYHWZRURZVRIGRWV5HGOLQHVEHORZDQG above the picture and inside of the mouth. The foot is broken and reattached, RQHKDQGOHLVPLVVLQJDQGUHSODFHGE\DPRGHUQKDQGOH

18


6

6 *ULHFKLVFKH %DXFKDPSKRUD    Y &KU + FP k FPk0©QGXQJFPk)XgFP6FKZDU]}JXULJ'H WDLOVLQ5RW$XIGHP&RUSXVEHLGVHLWLJHLQDXVJHVSDUWHV%LOG IHOG $ -©QJOLQJ PLW KXIHLVHQI¤UPLJHP *HJHQVWDQG VWHKW YRU HLQHPEÂ&#x201D;UWLJHQ0DQQ%-©QJOLQJPLWHUKREHQHP$UPVWHKWYRU HLQHP%Â&#x201D;UWLJHQ9LHU)UDJPHQWHGHU0©QGXQJJHEURFKHQXQG ZLHGHUDQJHVHW]WNOHLQH$EVSOLWWHUXQJDP)Xg u Provenienz: Ehemals Sammlung E.C., Franken, erworben in den 1920er und HU-DKUHQEHL*RUQ\ 0RVFK/RV 'HUPDWWH*ODQ]WRQGLH/LSSHQIRUPVRZLHGHU6WLOOHJHQQDKHGDVVHVVLFK hier um eine provinzielle Nachahmung attischer Vasen handelt, die man YLHOOHLFKWQDFK(XE¤DRGHU%¤RWLHQYHURUWHQNDQQ *UHHNEODFN}JXUHEHOO\DPSKRUD%&$%<RXWKDQGEHDUGHG draped man. Four fragments of the mouth are brocken and reattached, little splinter of the foot is missing.

19


7

7 $WWLVFKH+DOVDPSKRUDGHU'RW%DQG.ODVVHY&KU+ 15cm, B 10,4cm, Ã&#x2DC; 9,9cm, Ã&#x2DC; Mündung 8,7cm, Ã&#x2DC; FuÃ&#x; 5,9cm. 6FKZDU]}JXULJ'HWDLOVLQ5RWXQG:HLg%HLGVHLWLJHLQHVLW]HQ GH)UDXPLW*HJHQVWDQGLQOLQNHU+DQGYRUHLQHU:HLQUDQNH,Q GHQ+HQNHO]RQHQ9LHUSDOPHWWHQRUQDPHQWPLWGUHL%O©WHQ$XI GHP+DOV3DOPHWWHQDXIGHU6FKXOWHU6WDEIULHVXQWHUGHQ%LOG IHOGHUQGDVQDPHQVJHEHQGHGRSSHOWH3XQNWEDQGXQG©EHUGHP )Xg 6WUDKOHQNUDQ] 0LW %HVWLPPXQJV]HWWHO GHV 6DPPOHUV $XV )UDJPHQWHQ ]XVDPPHQJHVHW]W GDEHL NOHLQH UHWXVFKLHUWH )HKO VWHOOHQ u 20

Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er Jahre bis 2017. 9JO ]XP %HLVSLHO GLH $PSKRUD $VKPROHDQ 0XVHXP 2[IRUG  $%9 &9$7DI%HD]OH\$UFKLYH3RWWHU\'DWDEDVH  $WWLFEODFN}JXUHGQHFNDPSKRUDRIWKH'RW%DQG&ODVV%& 2QERWKVLGHVDVHDWHGZRPDQZLWKREMHFWLQWKHOHIWKDQGLQIURQWRIDYLQH WHQGULO%HORZWKHKDQGOHVIRXUSDOPHWWHVRUQDPHQWVZLWKWKUHHEORVVRPVDQG RYHUWKHIRRWUD\VDQGWKHHSRQ\PRXVGRXEOHOLQHRIGRWV5HDVVHPEOHGIURP fragments, few little areas are missing and retouched. With collectorâ&#x20AC;&#x2122;s note!


8

21


8

8 $WWLVFKH/HN\WKRVGHV2UHLWK\LD0DOHUVY&KU6DOE JHIÂ&#x201D;gPLW]\OLQGULVFKHP.¤USHU+FPkFPk)Xg FP5RW}JXULJ'HWDLOVLQ5RW$XIGHP&RUSXVVWHKW]ZL VFKHQ ]ZHL 0Â&#x201D;DQGHUQ 'HPHWHU PLW 'LDGHP YRU HLQHP $OWDU DXIGHQVLHDXVHLQHU2LQRFKRHHLQ2SIHUVSHQGHWLQLKUHU/LQ NHQKÂ&#x201D;OWVLH]XGHPHLQH)DFNHO$XIGHU6FKXOWHUHLQ)ULHVDXV DOWHUQLHUHQGHQ3DOPHWWHQXQGHLQJHVWHOOWHQ/RWXVEO©WHQ,PREH UHQ 9LHUWHO DXV )UDJPHQWHQ ]XVDPPHQJHVHW]W )Xg HEHQIDOOV JHEURFKHQ XQG ZLHGHU DQJHVHW]W DQ GHQ %UXFKNDQWHQ ZHQLJH NOHLQH5HWXVFKHQ u 3URYHQLHQ]([6DPPOXQJ3&6©GGHXWVFKODQGH[+ROJHU7HUPHU.XQVW GHU$QWLNH+DPEXUJ.DWDORJ  61UEHL*RUQ\ 0RVFK Auktion 252, 2017, Los 44. =XJHZLHVHQ YRQ +HUEHUW $ &DKQ 3XEOL]LHUW %HD]OH\ $UFKLYH 3RWWHU\ 'DWDEDVH 9JO ]XP %HLVSLHO GHQ .RSI GHU 'HPHWHU DXI GHP .UDWHU 3DOHUPR 9 (ARV2&9$7DI%HD]OH\$UFKLYH3RWWHU\ 'DWDEDVH (LQHJDQ]Â&#x201D;KQOLFKH/HN\WKRVLQ0DGLVRQ(OYHKMHP0X VHXPRI$UW %HD]OH\$UFKLYH3RWWHU\'DWDEDVH =XP2UHLWK\LD0DOHU

22

s. ARV2I05REHUWVRQ7KH$UWRI9DVH3DLQWLQJLQ&ODVVLFDO$WKHQV  6I $WWLFUHG}JXUHF\OLQGULFDOOHN\WKRVRIWKH2UHLWK\LD3DLQWHU%&2Q WKHFRUSXVEHWZHHQWZRPHDQGHUVWKHJRGGHVV'HPHWHUZLWKGLDGHPGRQDWLQJ DVDFUL}FHIURPDQRLQRFKRHRYHUDQDOWDULQKHUOHIWVKHLVKROGLQJDWRUFK 2QWKHVKRXOGHUDIULH]HRISDOPHWWHVDQGORWXV~RZHUV7KHXSSHUTXDUWHULV reassembled from fragments, the foot is broken and reattached, at the cracks few little retouched areas.


9

10

9 $WWLVFKH/HN\WKRVGHV6FKLOI0DOHUV/HW]WHV9LHUWHO-KY&KU 6DOEJHIÂ&#x201D;g PLW ]\OLQGULVFKHP .¤USHU + FP k FP k )Xg FP :HLgJUXQGLJ PLW SRO\FKURPHU 0DOHUHL $XI GHP &RUSXVVHLWOLFKHLQHU*UDEVWHOHPLWGUHL$NURWHUHQOLQNVHLQVLW ]HQGHULQHLQHQ0DQWHOJHK©OOWHU-©QJOLQJUHFKWVHLQHVWHKHQGH MXQJH)UDX$XIGHU6FKXOWHU]ZHLIDUELJH3DOPHWWHQ$XV)UDJ PHQWHQ]XVDPPHQJHVHW]WGDEHLHLQLJHUHWXVFKLHUWH)HKOVWHOOHQ DQGHQ%UXFKNDQWHQ u

10 $WWLVFKH/HN\WKRVY&KU6DOEJHIÂ&#x201D;gPLW]\OLQGULVFKHP .¤USHU+FPkFPk)XgFP:HLgJUXQGLJPLW SRO\FKURPHU0DOHUHL$XIGHP&RUSXVVHLWOLFKHLQHU*UDEVWH OHYRQGHUVLFKQRFKGLH7Â&#x201D;QLHQHUNHQQHQODVVHQVWHKHQOLQNV HLQ-©QJOLQJXQGUHFKWVHLQHMXQJH)UDX$XIGHU6FKXOWHUIHLQ JOLHGULJH 2UQDPHQWH LQ 6FKZDU] XQG 5RW $EVSOLWWHUXQJHQ DQ 0©QGXQJXQG)Xg%HPDOXQJWHLOZHLVHYHUJDQJHQGLHGXQNOHQ /LQLHQVLQGPRGHUQQDFKJH]HLFKQHW u

3URYHQLHQ]([6DPPOXQJ3&6©GGHXWVFKODQGHUZRUEHQEHL+HUEHUW $&DKQ%DVHOEHL*RUQ\ 0RVFK$XNWLRQ/RV 3XEOL]LHUW%HD]OH\$UFKLYH3RWWHU\'DWDEDVH 9JOGDV0Â&#x201D;GFKHQDXIGHU/HN\WKRV.LHZ0XVHXPRI:HVWHUQDQG(DVWHUQ Art (ARV2%HD]OH\$UFKLYH3RWWHU\'DWDEDVH RGHUGHQ VLW]HQGHQ -©QJOLQJ DXI GHU /HN\WKRV /\RQ 0XVÂ&#x2DC;H GHV %HDX[$UWV $592 %HD]OH\$UFKLYH3RWWHU\'DWDEDVH 

Provenienz: Ehemals Sammlung E.C., Franken, erworben in den 1920er und HU-DKUHQEHL*RUQ\ 0RVFK$XNWLRQ/RV 3XEOL]LHUW%HD]OH\$UFKLYH3RWWHU\'DWDEDVH

$WWLFZKLWHJURXQGSRO\FKURPHF\OLQGULFDOOHN\WKRVRIWKH5HHG3DLQWHU/DVW TXDUWHURIWKHWKFHQWXU\%&2QWKHFRUSXVDODUJHJUDYHVWHOHRQWKHOHIW VLGHDVHDWHG\RXWKDQGRQWKHULJKWVLGHDVWDQGLQJ\RXQJZRPDQ2QWKH shoulder two coloured palmettes. Reassembled from fragments, few missing parts at the cracks are retouched.

$WWLFZKLWHJURXQGF\OLQGULFDOOHN\WKRVZLWKSRO\FKURPHSDLQWLQJ %&2QWKHFRUSXVDJUDYHVWHOHSUHVHUYHGDUHWKHWDHQLDHRQWKHOHIWVLGHD \RXWKDQGRQWKHULJKWVLGHD\RXQJZRPDQ2QWKHVKRXOGHUDWZRFRORXUHG RUQDPHQW6SOLQWHUVRIWKHPRXWKDQGIRRWDUHPLVVLQJWKHFRORXULVSDUWLDOO\ PLVVLQJWKHGDUNOLQHVDUHPRGHUQO\UHWRXFKHG

23


11

11 $WWLVFKH/HN\WKRVGHV9RJHO0DOHUV8PY&KU6DOEJHI”g PLW]\OLQGULVFKHP.¤USHU+FPkFPk)XgFP :HLgJUXQGLJPLWSRO\FKURPHU0DOHUHL,QGHU0LWWHHLQH*UDE VWHOHDXI]ZHLVWX}JHU%DVLVGLHYRQHLQHUURWHQ%LQGHXPVFKOXQ JHQ ZLUG /LQNV GDYRQ VWHKW LQ HLQHQ URWHQ 0DQWHO JHK©OOW HLQ -©QJOLQJ UHFKWV HLQH MXQJH )UDX LQ G©QQHP &KLWRQ GLH HLQH JURgH 6FKDFKWHO K”OW 'DU©EHU HLQ 0”DQGHUIULHV XQG DXI GHU 6FKXOWHUGUHL3DOPHWWHQPLW5DQNHQ(LQHJU¤gHUHREHU~”FKLJH $ESODW]XQJLPXQWHUHP%HUHLFKZHQLJHNOHLQH$EVSOLWWHUXQJHQ VRQVWLQWDNWPLWJXWHUKDOWHQHQ)DUEHQ u

24

11

3URYHQLHQ]([1DFKODVV.DULQ.RUWH%D\HUQLP)DPLOLHQEHVLW]VHLWGHQ 1920er Jahren. 9JO ]XP %HLVSLHO GHQ OLQNHQ )UDXHQDUP DXI GHU /HN\WKRV 0HWURSROLWDQ 0XVHXPRI$UW $592%HD]OH\$UFKLYH3RWWHU\'DWDEDVH  RGHUGHQ-©QJOLQJVNRSIDXIGHU/HN\WKRV$OODUG3LHUVRQ0XVHXP  $592 0DQQHURIw&9$7DI%HD]OH\ $UFKLYH3RWWHU\'DWDEDVH  $WWLFZKLWHJURXQGOHN\WKRVZLWKF\OLQGULFDOFRUSXVDQGSRO\FKURPHSDLQWLQJ RIWKH%LUG3DLQWHU$ERXW%&,QWKHPLGGOHRIWKHFRUSXVDJUDYHVWHOH WRWKHOHIWD\RXWKLQUHGKLPDWLRQWRWKHULJKWD\RXQJZRPDQLQVKHHUFKLWRQ KROGLQJDODUJHER[2QHIUDJPHQWRIWKHVXUIDFHLVEURNHQRXWLQWKHORZHU SDUWIHZWLQ\VSOLQWHUVDUHPLVVLQJRWKHUZLVHLQWDFWZLWKJRRGSUHVHUYHGFRORUV


12 *URgHU DWWLVFKHU 6N\SKRV GHV /H ZLV0DOHUV    Y &KU + FP % PLW +HQNHOQ FP Ã&#x2DC; Mündung 18,2cm, Ã&#x2DC; FuÃ&#x; FP 5RW}JXULJ $XI 6HLWH % HLOWHLQH'LHQHULQPLWHLQHU2LQR FKRH]XGHUDXI6HLWH$VWHKHQGHQ )UDX GLH YRU HLQHP 6WXKO .OLV PRV  VWHKW XQG HLQHQ 7K\UVRV KÂ&#x201D;OW 0LW DXVI©KUOLFKHU %HVFKUHL EXQJ GHV 6DPPOHUV $XV )UDJ PHQWHQ ]XVDPPHQJHVHW]W NOHLQH UHWXVFKLHUWH6WHOOHQDQGHQ%UXFK NDQWHQ u Provenienz: Ex Sammlung P.C., Süd GHXWVFKODQGHUZRUEHQEHL+ROJHU 7HUPHU+DPEXUJH[3DOODGLRQ$QWLNH .XQVW.DWDORJ61U=X OHW]W*RUQ\ 0RVFK$XNWLRQ Los 15. Zur Klärung der Eigentumsfrage zurückgezogen. Eine Rückforderung sei WHQVGHULWDOLHQLVFKHQ%HK¤UGHQLVWQLFKW erfolgt. 3XEOL]LHUW 6 (VWLHQQH XD +UVJ  ,PDJHHWUHOLJLRQGDQVOyDQWLTXLWÂ&#x2DC;JUÂ&#x2DC;FR URPDLQH.ROORTXLXP5RP   6$EE%HD]OH\$UFKLYH3RWWHU\ 'DWDEDVH 6DERXURII0DOHU  9JO]XP%HLVSLHOGLH)UDXDXIGHP6N\ SKRV :LHQ  $592 972,2; CVA  7DI  %HD]OH\ $UFKLYH 3RWWHU\ 'DWDEDVH=XP/HZLV0DOHUV ARV2  II - %RDUGPDQ 5RW}JXUL JH9DVHQDXV$WKHQ'LHNODVVLVFKH=HLW  $EE05REHUWVRQ7KH $UWRI9DVH3DLQWLQJLQ&ODVVLFDO$WKHQV  6II

12

/DUJH$WWLFUHG}JXUHVN\SKRVRIWKH/HZ LV3DLQWHU%&2QRQHVLGHD maidservant bringing an oinochoe to the woman on the other side who is standing LQIURQWRIDFKDLU NOLVPRV DQGKROGLQJ DWK\UVRV5HDVVHPEOHGIURPIUDJPHQWV little retouched areas at the cracks. With description of the collector!

12

25


13

13 *URgHDWWLVFKH%DQGVFKDOHY&KU+FP%PLW +HQNHOQ FP k FP k )Xg FP 6FKZDU]}JXULJ 'HWDLOVLQ5RW,7RQGRPLW]ZHLIDUELJHP=XQJHQEDQGDOV5DK PXQJ GDULQ HLQ +RSOLW XQG ]ZHL VLFK ©EHUVFKQHLGHQGH 5HLWHU PLW6SHHUHQ$6FKODFKWV]HQHPLW]ZHL%LJHQXQG]DKOUHLFKHQ .DPSIJUXSSHQ ]X )Xg % 6FKODFKWV]HQH PLW HLQHU ]HQWUDOHQ %LJDXQG]DKOUHLFKHQ.DPSIJUXSSHQ]X)XgVHLWOLFKGHU+HQ NHO MH HLQH 6SKLQ[ ,Q GHQ =ZLVFKHQUÂ&#x201D;XPHQ 3XQNWUHLKHQ GLH ,QVFKULIWHQLPLWLHUHQ$XV)UDJPHQWHQ]XVDPPHQJHVHW]WGDEHL PHKUHUHHUJÂ&#x201D;Q]WH)HKOVWHOOHQ u

13

26

3URYHQLHQ]([6DPPOXQJ3&6©GGHXWVFKODQGHUZRUEHQEHL+HUEHUW $&DKQ%DVHOEHL*RUQ\ 0RVFK$XNWLRQ/RV Zu den sog. Kleinmeistern, benannt nach den kleinen Figuren ihrer Malerei, V3+HHVHQ$WKHQLDQ/LWWOH0DVWHU&XSV   /DUJH$WWLFEODFN}JXUHEDQGFXS%&,QVLGHDWRQGRIUDPHG E\DWZRFRORXUHGIULH]HRIWRQJXHVVKRZLQJDZDUULRUDQGWZRRYHUODSSLQJ KRUVHPHQ 2XWVLGH VFHQHV RI EDWWOHV ZLWK ELJDH QXPHURXV }JKWLQJ JURXSV of hoplites, on one side next to the handles sphinges. Reassembled from IUDJPHQWVVHYHUDOPLVVLQJSDUWVDUH}OOHGXS


14

14 $WWLVFKH6LDQDVFKDOHY&KU+FP%PLW+HQNHOQ FP k FP k )Xg FP 6FKZDU]}JXULJ 'HWDLOV LQ 5RW , 7RQGR PLW ]ZHLIDUELJHQ =XQJHQEDQG XQG PHKUHUHQ /LQLHQDOV5DKPXQJGDULQHLQQDFKOLQNVHLOHQGHU+RSOLW$XgHQ DXIEHLGHQ6HLWHQMH]ZHLMXJHQGOLFKH5HLWHUDXIGHUHLQHQ6HLWH ]ZLVFKHQGUHL)UDXHQDXIGHUDQGHUHQ]ZLVFKHQ]ZHL)UDXHQXQG HLQHP0DQQ'DUXQWHU]ZLVFKHQPHKUIDFKHQ/LQLHQZLHGHUHLQ ]ZHLIDUELJHV =XQJHQEDQG XQG DEVFKOLHgHQG HLQ 6WUDKOHQNUDQ] $XV)UDJPHQWHQ]XVDPPHQJHVHW]WHLQLJHJU¤gHUHUHWXVFKLHUWH )HKOVWHOOHQ u Provenienz: Ex Sammlung P.C., Süddeutschland, erworben 1990 bei Galleria 6HURGLQH$VFRQDEHL*RUQ\ 0RVFK$XNWLRQ/RV $WWLFEODFN}JXUHVLDQDFXS%&,QVLGHDWRQGRVKRZLQJDUXQQLQJ ZDUULRUIUDPHGZLWKOLQHVDQGDWZRFRORXUHGIULH]HRIWRQJXHV2XWVLGHRQ HDFKVLGHWZR\RXWKIXOKRUVHPHQRQRQHVLGHEHWZHHQWKUHHZRPHQRQWKH other side between two women and a bearded man. Below lines, again a two FRORXUHG IULH]H RI WRQJXHV DQG }QDOO\ UD\V 5HDVVHPEOHG IURP IUDJPHQWV VHYHUDOPLVVLQJDUHDVDUH}OOHGXSDQGSDUWLDOO\UHWRXFKHG

27


14

28


15 $WWLVFKH6FKDOHY&KU H 6,5cm, B 20,9cm, Ø 15cm, Ø )Xg FP 6FKZDU]}JXULJ 'H WDLOVLQ:HLg XQGRGHU5RW ,P ,QQHUHQNOHLQHU7RQGRPLWHLQHP W”Q]HOQGHQ 6DW\U $XI GHQ $X gHQVHLWHQMHZHLOVGLHJOHLFKH6]H QH GLH PDQ ZRKO DOV )DKUW GHV 'LRQ\VRV LQ GHQ 2O\PS YHUVWH KHQPXVV'HU*RWWEHVWHLJWHLQH 4XDGULJD QHEHQ LKP VSLHOW $UL DGQH GD]X HLQ 6DLWHQLQVWUXPHQW OLQNV DOV *HIROJH HLQ W”Q]HOQGHU 6DW\U UHFKWV DOV +HUROG +HUPHV ,QWDNWPLWYLHOHQ6LQWHUUHVWHQ u

15

3URYHQLHQ] ([ 1DFKODVV (' VWHU reich, 1950er Jahre. $WWLFEODFN}JXUHGFXS%& ,QVLGHDPLQFLQJVDW\U2XWVLGHRQHDFK VLGH WKH HQWUDQFH RI 'LRQ\VRV DW WKH 2O\PSRV 7KH JRG PRXQWLQJ D TXDGUL JDQH[WWRKLP$ULDGQHSOD\LQJDO\UD EHKLQGDPLQFLQJVDW\UDQGRQWKHULJKW VLGHDVKHUDOG+HUPHV,QWDFWZLWKVLQ ter.

16 %¤RWLVFKH /HNDQH /HW]WHV 9LHU WHO-KY&KU+FP%PLW +HQNHOQFPkFPk)Xg FP )ODFKH 6FKDOH PLW DEJH VHW]WHP 5DQG 2PHJD+HQNHOQ XQG QLHGULJHP )Xg 6LOKRXHWWHQ WHFKQLN ,P ,QQHUHQ HLQ YRQ HL QHP 0”DQGHU JHUDKPWHU 7RQGR GDULQ HLQH QDFK UHFKWV VFKUHLWHQ GH )UDX PLW .UDQ] LQ GHU +DQG ]ZLVFKHQ =ZHLJHQ $XI GHU 8Q WHUVHLWH HLQ 3DOPHWWHQIULHV XQG DP 5DQG 6WUDKOHQ (LQ 5DQG IUDJPHQW JHEURFKHQ XQG ZLHGHU DQJHVHW]W GDEHL NOHLQH )HKOVWHO OH0DOHUHLWHLOZHLVHYHUULHEHQ u Provenienz: Ehemals Sammlung E.C., Franken, erworben in den 1920er und HU-DKUHQ 9JO]XP%HLVSLHOGLH/HNDQH+HLGHOEHUJ  &9$  7DI  %HD]OH\ $UFKLYH3RWWHU\'DWDEDVH  %RHRWLDQOHNDQHLQVLOKRXHWWHWHFKQLTXH /DVW TXDUWHU WK FHQWXU\ %& ,QVLGH D tondo with meander and a woman with ZUHDWK EHWZHHQ EUDQFKHV 8QGHUQHDWK a frieze with palmettes and at the rim D FLUFOH RI UD\V 2QH ULPIUDJPHQW LV broken and reattached, a little splinter at the crack is missing, the painting is SDUWLDOO\UXEEHG

16

29


17

17

30


17

17 $WWLVFKH6FKDOHGHV+HJHVLERXORV0DOHUV8PY&KU6FKDOH GHU )RUP % + FP % PLW +HQNHOQ FP k FP k )Xg FP 5RW}JXULJ 'HWDLOV LQ 5RW ,P ,QQHUHQ HLQ JURgHU 7RQGR PLW ]ZHL .RPDVWHQ 'HU Â&#x201D;OWHUH (UDVWHV LQVFKULIWOLFK EHQDQQW DOV LACARES  LVW DP 7DQ]HQ ZÂ&#x201D;KUHQG GHU M©QJHUH (URPHQRV LQVFKULIWOLFKEHQDQQWDOVKUDIAS DXVHLQHU6FKDOH WULQNW$XgHQLQGHQ+HQNHO]RQHQJURgH3DOPHWWHQRUQDPHQWH GD]ZLVFKHQ 'UHL}JXUHQELOGHU $XI 6HLWH $ WDQ]W HLQH +HWÂ&#x201D;UH GLHJOHLFK]HLWLJGLH.URWDOHQVFKOÂ&#x201D;JW]XGHU0XVLNGLHOLQNVHLQ MXJHQGOLFKHU6\PSRVLDVW LQVFKULIWOLFKEHQDQQWDOVMELES DXI GHP%DUELWRQVSLHOWZÂ&#x201D;KUHQGUHFKWVHLQ-©QJOLQJPLW*HKVWRFN .RUEXQG6FKDOHQDFKUHFKWVVFKUHLWHW=ZLVFKHQGHU+HWÂ&#x201D;UHXQG GHPUHFKWHQ-©QJOLQJVWHKWLIMEMRGHULISES$XI6HLWH%KDW HLQWÂ&#x201D;Q]HOQGHULWK\SKDOOLVFKHU6DW\UHLQH$PSKRUDJHVFKXOWHUW OLQNVYRQLKPHLQH0Â&#x201D;QDGHPLW.URWDOHQUHFKWVHLQH0Â&#x201D;QDGH PLW 7K\UVRV ,Q GHQ =ZLVFKHQUÂ&#x201D;XPHQ HLQH .DORVLQVFKULIW VHLWOLFKGHV.RSIHVGHUUHFKWHQ0Â&#x201D;QDGHAIGIL-OS]ZLVFKHQGHU OLQNHQ 0Â&#x201D;QDGH XQG GHP 6DW\U KALOS. 0LW .DWDORJDXVVFKQLWW YRQ 6RWKHE\yV $XV )UDJPHQWHQ ]XVDPPHQJHVHW]W QXU NOHLQH 5HWXVFKHQDQGHQ%UXFKNDQWHQ u 3URYHQLHQ]([6DPPOXQJ3&6©GGHXWVFKODQGH[6RWKHE\hV/RQGRQ 'H]HPEHU/RV%HL/RUG0F$OSLQH/RQGRQ=XOHW]W*RUQ\ 0RVFK$XNWLRQ/RV9HUPXWOLFKJHOLVWHWLP0HGLFL$UFKLY Zur Klärung der Eigentumsfrage zurückgezogen. Eine Rückforderung seitens GHULWDOLHQLVFKHQ%HK¤UGHQLVWQLFKWHUIROJW

3XEOL]LHUW %HD]OH\ $UFKLYH 3RWWHU\ 'DWDEDVH  (LQ ZHLWHUHV 0DO EHL 6RWKHE\hV/RQGRQ-XOL/RV Vgl. die Schale New York 07.286.47 (ARV2  $ )XUWZÂ&#x201D;QJOHU  . 5HLFKKROG *ULHFKLVFKH 9DVHQPDOHUHL ,,   7DI  - %RDUGPDQ 5RW}JXULJH 9DVHQ DXV $WKHQ 'LH DUFKDLVFKH =HLW   $EE  % &RKHQ7KH&RORUVRI&OD\$XVVWHOOXQJ0DOLEX  6$EE=XP +HJHVLERXORV0DOHUV$59205REHUWVRQ7KHDUWRIYDVHSDLQWLQJLQ FODVVLFDO$WKHQV  6II:Â&#x201D;KUHQGGLHPHLVWHQDXIGHU6FKDOH YHUZHQGHWHQ1DPHQKLHU]XPHUVWHQ0DODXIWDXFKHQ}QGHWVLFKGHU1DPHV .\GLDVDXFKDXIGHU6FKDOHGHV$PEURVLRV0DOHUV0©QFKHQ$592 &9$7DI%HD]OH\$UFKLYH3RWWHU\ 'DWDEDVH $WWLFUHG}JXUHFXSRIWKHW\SH%RIWKH+HJHVLERXORV3DLQWHU$ERXW %&,QVLGHDODUJHWRQGRZLWKWZRNRPDVWV7KHHOGHUO\ wHUDVWHVxQDPHGE\ inscription LAXARES LVGDQFLQJZKLOHWK\\RXQJHU wHURPHQRVxQDPHGE\ inscription KUDIAS LVGULQNLQJRXWRIDFXS2XWVLGHDURXQGWKHKDQGOHV ODUJHSDOPHWWHRUQDPHQWVEHWZHHQSLFWXUHVZLWKWKUHH}JXUHV2QVLGH$D GDQFLQJKHWDLUDZLWKNURWDOHVEHWZHHQD\RXWKSOD\LQJWKHEDUELWRQ QDPHG E\LQVFULSWLRQMELES RQWKHOHIWDQGD\RXWKZLWKVWLFNEDVNHWDQGFXS on the right. Between the last and the hetaira the inscription LIMEM or LISES2QVLGH%DGDQFLQJLWK\SKDOOLFVDW\UZLWKDPSKRUDRQKLVVKRXOGHU EHWZHHQDPDHQDGZLWKNURWDOHVRQWKHOHIWDQGDPDHQDGZLWKWK\UVRVRQWKH ULJKW,QWKH}HOGVWKHLQVFULSWLRQAIGILOS KALOS. Reassembled from IUDJPHQWVRQO\OLWWOHUHWRXFKHGDUHDVDWWKHFUDFNVWith matching page of Sothebyâ&#x20AC;&#x2DC;s catalogue (copy)!

31


18

18

32


18

18 $WWLVFKH6FKDOHGHV&XUWLXV0DOHUVUm 440 v. Chr. Schale der Form B. H 13,3cm, B mit Henkeln 41,8cm, Ã&#x2DC; 32,6cm, Ã&#x2DC; FuÃ&#x; FP5RW}JXULJ,P,QQHUHQHLQYRQHLQHP0Â&#x201D;DQGHUJHUDKP WHU7RQGRGDULQEHGUÂ&#x201D;QJWHLQ6DW\UHLQH0Â&#x201D;QDGHPLW7K\UVRV $XgHQLQGHQ+HQNHO]RQHQJURgH3DOPHWWHQRUQDPHQWHGD]ZL VFKHQDXIEHLGHQ6HLWHQMHI©QI0DQWHOM©QJOLQJH8QWHUGHU/LS SHXPODXIHQGHLQ(LHUVWDE$XV)UDJPHQWHQ]XVDPPHQJHVHW]W HLQLJH HUJÂ&#x201D;Q]WH )HKOVWHOOHQ EHL GHQ $XgHQELOGHUQ 2EHU~Â&#x201D;FKH VWHOOHQZHLVHOHLFKWEHULHEHQ u Provenienz: Ex Sammlung P.C., Süddeutschland, ex Münzen und Medaillen $*%DVHO.XQVWZHUNHGHU$QWLNH$XNWLRQ6HSWHPEHU/RV %HL*RUQ\ 0RVFK$XNWLRQ/RV

3XEOL]LHUW%HD]OH\$UFKLYH3RWWHU\'DWDEDVH =XP&XUWLXV0DOHUV$59II9JO]XP%HLVSLHOGLH-©QJOLQJHDXIGHU 6FKDOH:LHQ8QLYHUVLWÂ&#x201D;W $59&9$7DI%HD]OH\ $UFKLYH3RWWHU\'DWDEDVH RGHUGLH6DW\UQDXIGHU6FKDOH9LOOD*LXOLD  $59%HD]OH\$UFKLYH3RWWHU\'DWDEDVH  $WWLF UHG}JXUH FXS RI WKH W\SH % RI WKH &XUWLXV 3DLQWHU $ERXW  %& ,QVLGHDWRQGRIUDPHGE\DPHDQGHUZLWKDVDW\USXUVXHLQJDPDHQDGZLWK WK\UVRV2XWVLGHLQWKHDUHDRIWKHKDQGOHVODUJHSDOPHWWHRUQDPHQWVEHWZHHQ RQHDFKVLGH}YHGUDSHG\RXWKV%HORZWKHULPHJJDQGGDUW5HDVVHPEOHG IURPIUDJPHQWVIHZPLVVLQJSDUWVDUHPRGHUQ}OOHGXSWKHVXUIDFHLVSDUWLDOO\ VOLJKWO\UXEEHG

33


19 Apulischer Glockenkrater, nahe GHP0DOHUYRQ/RXYUH01%    Y &KU + FP k 0©QGXQJFPk)XgFP 5RW}JXULJ 'HWDLOV LQ *HOE XQG :HLg $XI GHU 9RUGHUVHLWH VLW]W HLQ(URVPLW.”VWFKHQLQGHU/LQ NHQDXIHLQHP)HOVHQQDFKUHFKWV $XI GHU 5©FNVHLWH VLW]W HLQH MXQ JH)UDXPLW7\PSDQRQXQG/RU EHHU]HLJ DXI HLQHP )HOVHQ QDFK OLQNV EHU GHQ %LOGIHOGHUQ HLQ Winkelornament, darunter ein :HOOHQEDQG ,Q GHQ +HQNHO]R QHQ MH HLQH 3DOPHWWH ]ZLVFKHQ 5DQNHQ ,QWDNW PLW 5HVWHQ YRQ 6LQWHU u

19

3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ +: HUZRUEHQ LP 'H]HPEHUDXVGHU6DPPOXQJGH Münter, Brüssel. =XP 0DOHU YRQ /RXYUH 01%  V 59$S ,, 6  II PLW 7DI  .RQUDG 6FKDXHQEXUJ KDW KLQJHJHQ LQ HLQHP6FKUHLEHQYRQGDV6W©FNPLW GHU:LQNHO*UXSSHYHUEXQGHQ $SXOLDQUHG}JXUHEHOONUDWHUQHDUWKH 3DLQWHU RI /RXYUH 01%    %&2QWKHIURQWVLGHDVHDWHG(URV ZLWKER[RQWKHEDFNVLGHDVHDWHG\RXQJ ZRPDQZLWKW\PSDQRQDQGODXUHOEUDQFK $ERYH D EDQG RI WKH HSRQ\PRXV FKHY URQV%HORZWKHKDQGOHVHDFKDSDOPHWWH EHWZHHQWHQGULOV,QWDFWZLWKWUDFHVRIVLQ ter.

19

34


20

20 .DPSDQLVFKH .DOSLV GHV /LEDWLRQ0DOHUV &DSXD ,, XP  Y &KU+\GULDPLWDEJHUXQGHWHU6FKXOWHU+FPkFPk 0©QGXQJFPk)XgFP5RW}JXULJ'HWDLOVLQ*HOEXQG :HLg$XIGHU9RUGHUVHLWHVHLWOLFKHLQHULRQLVFKHQ6Â&#x201D;XOHUHFKWV HLQVLW]HQGHU.ULHJHUPLWDWWLVFKHP+HOPXQG%UXVWSDQ]HUGHU HLQHQ.DQWKDURVXQGVHLQH/DQ]HKÂ&#x201D;OWVHLWOLFKOLHJWVHLQ6FKLOG /LQNVVWHKWHLQHMXQJH)UDXPLWHLQHPJURgHQ.Â&#x201D;VWFKHQ6HLWOLFK XQWHU GHQ +HQNHOQ JURgH )UDXHQN¤SIH PLW 6DNNRV DXI GHU 5©FNVHLWHJURgH3DOPHWWHQ]ZLVFKHQ5DQNHQ8QWHQXPODXIHQG :HOOHQEDQGREHQDXIGHU6FKXOWHU2OLYHQ]ZHLJHXQG]HQWUDOH 5RVHWWH :LQ]LJH $EVSOLWWHUXQJ DQ GHU 0©QGXQJ 0DOHUHL DXI GHUOLQNHQ6HLWHHWZDVYHUULHEHQVRQVWLQWDNW u

20

3URYHQLHQ]([6DPPOXQJ(+6©GGHXWVFKODQGYRU 9JOGLHIDVWJOHLFKH'DUVWHOOXQJDXIGHU.DOSLV/RXYUH.LQ/&66 1UPLW7DI &DPSDQLDQUHG}JXUHNDOSLVRIWKH/LEDWLRQ3DLQWHU&DSXD,,DERXW%& 2QWKHIURQWVLGHDLRQLDQFROXPQULJKWRILWDVHDWHGZDUULRUZLWKDWWLFKHOPHW FXLUDVVVSHDUVKLHOGDQGNDQWKDURV2QWKHOHIWVLGHD\RXQJZRPDQZLWK ODUJHER[/HIWDQGULJKWEHORZWKHKDQGOHVDODUJHZRPDQKHDGZLWKVDNNRV $QGRQWKHEDFNVLGHDODUJHSDOPHWWHEHWZHHQWHQGULOV2QWKHVKRXOGHUROLYH EUDQFKHVDQGLQWKHPLGGOHDURVHWWH7LQ\VSOLQWHURIWKHPRXWKLVPLVVLQJ SDLQWLQJLVRQWKHOHIWVLGHSDUWLDOO\UXEEHGRIIRWKHUZLVHLQWDFW

35


21

21 .DPSDQLVFKH+DOVDPSKRUDQDKHGHP0DOHUYRQ%0)&DSXD ,Y&KU+FPkFPk)XgFP5RW} JXULJ'HWDLOVLQ*HOEXQG:HLg$XIGHU9RUGHUVHLWHHLQ6DW\U PLW7K\UVRVGHUVHLQUHFKWHV%HLQDXIHLQHQ)HOVHQJHVHW]WKDW $XI GHU 5©FNVHLWH HLQH MXQJH )UDX PLW ]ZHL NOHLQHQ .U”Q]HQ XQGHLQHUNOHLQHQ6FKDOH,QGHQ+HQNHO]RQHQMHHLQH3DOPHWWH ]ZLVFKHQ5DQNHQPLW%O©WHQ8QWHQXPODXIHQGHLQ:HOOHQEDQG $XIGHU6FKXOWHU6WDEIULHVHXQGDXIGHP+DOVEHLGVHLWLJMHHLQH 3DOPHWWH0LW.RSLHGHU3XEOLNDWLRQ,QWDNWPLW6LQWHUUHVWHQ u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP0”U] DXVHLQHU3ULYDWVDPPOXQJLQ'RUWPXQG 3XEOL]LHUW.6FKDXHQEXUJ6WXGLHQ]XUXQWHULWDOLVFKHQ9DVHQPDOHUHL,; ;  6VRZLH6$EEDE QDKHGHP0DOHU%0)w  'LHVH=XZHLVXQJZLUGYHUVW”QGOLFKZHQQPDQ]XP%HLVSLHOGHQ)UDXHQNRSI PLWGHPDXIHLQHU/HNDQLVLQ6DOHUQR /&661UPLW7DI  vergleicht.

36

21

&DPSDQLDQUHG}JXUHQHFNDPSKRUDQHDUWKH3DLQWHURI%0)&DSXD ,%&2QWKHIURQWVLGHDVDW\UZLWKWK\UVRVOD\LQJKLVULJKWOHJRQ DURFN2QWKHEDFNVLGHD\RXQJZRPDQZLWKWZRVPDOOZUHDWKVDQGDOLWWOH ERZO,QWDFWZLWKUHVWRIVLQWHUWith copies of the corresponding pages of the publication by Konrad Schauenburg!

22 .DPSDQLVFKH %©JHOKHQNHODPSKRUD GHV .DVVDQGUD0DOHUV &DS XD,XPY&KU+DOVDPSKRUDPLWWRUGLHUWHP%©JHOKHQNHO +FPkFPk)XgFP5RW}JXULJ'HWDLOVLQ*HOE XQG:HLg$XIGHU9RUGHUVHLWHOHJWVLFKHLQMXQJHU.ULHJHUGHU EHUHLWVHLQHQDWWLVFKHQ+HOPXQG%UXVWSDQ]HUWU”JWLP6LW]HQGLH %HLQVFKLHQHQDQ9RULKPVHLQ6FKLOGPLWHLQHP6WHUQDOV(P EOHPXQGKLQWHULKPVHLQH/DQ]H$XIGHU5©FNVHLWHHLQ0DQWHO M©QJOLQJ=ZLVFKHQGHQ)LJXUHQJURgH3DOPHWWHQDXIGHU6FKXOWHU =XQJHQVWDE XQG DXI GHP +DOV HLQ 3DOPHWWHQIULHV VHLWOLFK HLQHU Ranke. .OHLQHV0HLVWHUZHUNGHUXQWHULWDOLVFKHQ9DVHQPDOHUHL(LQ ODQJHU6SUXQJLPXQWHUHP%HUHLFKGHV.¤USHUVDQVRQVWHQLQWDNW XQGLQXQJHZ¤KQOLFKHU)ULVFKHHUKDOWHQ u


22

22

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP0DL DXVGHU6DPPOXQJGH0©QWHU%U©VVHO 9JO]XGHQ*HVLFKWHUQGLHQDPHQVJHEHQGH$PSKRUD&DSXD /&66 1UPLW7DIEHVVHUH$EELOGXQJLQ$'7UHQGDOO5RW}JXULJH 9DVHQDXV8QWHULWDOLHQXQG6L]LOLHQ(LQ+DQGEXFK>@$EE ]X GHP0DQWHOM©QJOLQJGLH$PSKRUD&DSXD06,QY /&661U PLW7DI XQG]XGHPJHSXQNWHWHQ)HOVHQGLH+\GULD%HUOLQ,QY /&661UPLW7DI (LQH(LJHQDUWGLHVHV0DOHUVLVWHVGLH ZHLgHQ3XQNWHVWHWVDQXQGWHLOZHLVHDXIGLHYRUKHUDXIJHWUDJHQHQVFKZDU]HQ 3XQNWH]XVHW]HQ 'HU.ULHJHUG©UIWHHLQHQMXQJHQIU©K]HLWLJYHUVWRUEHQHQ0DQQGDUVWHOOHQ]X GHVVHQ%HHUGLJXQJGLHVH9DVHDQJHIHUWLJWZXUGH*OHLFK]HLWLJDEHUKHURLVLHUW VLHGLHVHQLQGHPVLHI©UGHQGDPDOLJHQ%HWUDFKWHUHLQGHXWLJHUNHQQEDUDXI $FKLOOYHUZHLVWGHUVLFKYRUGHP}QDOHQ:DIIHQJDQJJHJHQ+HNWRUVHLQHQHXH YRQ+HSKDLVWRVKHUJHVWHOOWH5©VWXQJDQOHJW +RPHU,OLDV 6R KHIWLJHUJULPPWDXIGLH7URHUQDKPHUGDV*¤WWHUJHVFKHQNGDV+HSKDLVWRV .XQVWLKPJHVFKPLHGHW(LOHQGI©JWHU]XHUVWXPGLH%HLQHVLFKEHUJHQGH 6FKLHQHQEODQNXQGVFK¤QDQVFKOLHgHQGPLWVLOEHUQHU.Q¤FKHOEHGHFNXQJ Weiter umschirmt er die Brust ringsher mit dem ehernen Harnisch. Hängte VRGDQQXPGLH6FKXOWHUGDV6FKZHUWYROOVLOEHUQHU%XFNHOQHKHUQHU.OLQJ 8QGGDUDXIGHQ6FKLOGDXFKJURgXQGJHGLHJHQQDKPHUGHUIHUQHGHQ*ODQ] KLQVHQGHWH”KQOLFKGHP9ROOPRQGw

22

&DPSDQLDQUHG}JXUHEDLODPSKRUDRIWKH.DVVDQGUD3DLQWHU&DSXD,DERXW %&1HFNDPSKRUDZLWKRQHWZLVWHGKDQGOHDERYH2QWKHIURQWVLGHD \RXQJZDUULRUVLWWLQJRQDURFNDQGSXWWLQJRQKLVJUHDYHV,WPD\VKRZD GHFHDVHG\RXQJPDQZKLOHLWFRQQHFWHGKLPZLWK$FKLOOZKRDUPHGKLPVHOI MXVWEHIRUHKLV}QDO}JKWZLWK+HNWRU2QWKHEDFNVLGHDGUDSHG\RXWK2QH ODUJHFUDFNLQWKHORZHUSDUWRWKHUZLVHLQWDFWDQGLQSDUWLFXODUJRRGFRQGLWLRQ /LWWOHPDVWHUSLHFHRI6RXWK,WDOLDQYDVHSDLQWLQJ

37


23

38


23 3DHVWDQLVFKHU /HEHV *DPLNRV GHV $VWHDV    Y &KU %© JHOKHQNHOJHIÂ&#x201D;g PLW YLHU .Q¤S IHQ XQG ]ZHLJHWHLOWHP 'HFNHO LQ Form von kleinen Schalen und 0LQLDWXUOHEHV+JHVDPWFP +/HEHVFPkFP5RW }JXULJ'HWDLOVLQ*HOEXQG:HLg $XIGHP/HEHVDXIGHUHLQHQ6HLWH HLQHVLW]HQGH)UDXGLHHLQH6FKD OH KÂ&#x201D;OW DXV GHU HLQ 9RJHO WULQNW 9RU LKU HLQ (URV PLW %Â&#x201D;OOHQ XQG 6SLHJHO$XIGHUDQGHUHQ6HLWHHLQ VLW]HQGHU(URVPLW%Â&#x201D;OOHQ,QGHQ +HQNHO]RQHQ 3DOPHWWHQ 8QWHQ XPODXIHQG:HOOHQEDQGREHQ(L HUVWÂ&#x201D;EH$XIGHU6FKXOWHUHLQVHLWLJ 5RVHWWH ]ZLVFKHQ =ZHLJHQ $XI GHP 'HFNHO :HOOHQEÂ&#x201D;QGHU XQG 6WDEIULHVH DXI GHP 0LQLDWXUOH EHV6FKZDQXQG.RSI,QWDNW u 3URYHQLHQ] ([ 3ULYDWVDPPOXQJ $'0 'HXWVFKODQGVHLWGHQHU-DKUHQ([ *RUQ\ 0RVFK 9JO ]XP VLW]HQGHQ (URV GHQ /HEHV 3DHVWXP  593 6  1U  PLW 7DI D  ]XP 6FKZDQ GHQ /HEHV &ROOHFWLRQ *HGGHV 0HOERXUQH 3 593 6  1U  PLW 7DI F  XQG ]XP 0RWLY GHU 9RJHOWUÂ&#x201D;QNH GHQ 5LQJDVNRV3DHVWXP 5936 1UPLW7DIE  3DHVWDQ UHG}JXUH OHEHV JDPLNRV RI $VWHDV%&/HEHVZLWKIRXU NQREVDQGWZRSDUWHGOLGLQIRUPRIFXSV DQG PLQLDWXUHOHEHV 2Q WKH OHEHV RQ RQH VLGH D VHDWHG ZRPDQ ZLWK ELUG RQ ERZO LQ IURQW RI KHU D (URV ZLWK EDOOV and mirror. On the other side a seated (URVZLWKEDOOV2QWKHPLQLDWXUHOHEHV DVZDQDQGDKHDG,QWDFW

23

39


24

24 $SXOLVFKH3HOLNHGHV/XFHUD0DOHUVUm 320 v. Chr. H 22,2cm, k0©QGXQJFPk)XgFP5RW}JXULJ'HWDLOVLQ:HLg $XIGHU9RUGHUVHLWHVWHKWHLQ(URVPLW6FKDOHXQG:HLQWUDXEHQ $XI GHU 5©FNVHLWH VFKUHLWHW HLQH MXQJH )UDX PLW 6SLHJHO XQG .UDQ]QDFKUHFKWV'DU©EHU(LHUVWÂ&#x201D;EHGDUXQWHUHLQ:HOOHQEDQG ,QGHQ+HQNHO]RQHQMHHLQH3DOPHWWH]ZLVFKHQ5DQNHQ$QGHU 0©QGXQJ HWZDV YHUULHEHQ VRQVW LQWDNW PLW 6LQWHUUHVW DXI GHU 8QWHUVHLWH u

40

24

3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ +: HUZRUEHQ LP 6HSWHPEHUDXVGHU6DPPOXQJGH0©QWHU%U©VVHO =XP0DOHUV59$S,,6IIPLW7DIVRZLH$'7UHQGDOO 5RW}JXULJH9DVHQDXV8QWHULWDOLHQXQG6L]LOLHQ(LQ+DQGEXFK  $EE  $SXOLDQ UHG}JXUH SHOLNH RI WKH /XFHUD 3DLQWHU $ERXW  %& 2Q WKH IURQWVLGH D VWDQGLQJ (URV ZLWK ERZO DQG JUDSH RQ WKH EDFNVLGH D \RXQJ ZRPDQZLWKPLUURUDQGZUHDWKLVZDONLQJWRWKHULJKW7LQ\VSOLQWHUVRIWKH EODFNJOD]HDUHPLVVLQJDWWKHDUHDRIWKHPRXWKRWKHUZLVHLQWDFWZLWKWUDFHV RIVLQWHUEHORZWKHIRRW




 $SXOLVFKH 2LQRFKRH GHV %DOWLPRUH0DOHUV Um 320 v. Chr. .DQQHGHU)RUPYRP7\SXVPLW.OHHEODWWP©QGXQJXQGJH ULSSWHP +HQNHO VRZLH ]ZHL SODVWLVFKHQ .ULHJHUN¤SIHQ DQ GHQ +HQNHODQV”W]HQ + FP k FP k )Xg FP 5RW} JXULJ 'HWDLOV LQ *HOE XQG :HLg $XI GHP .¤USHU VLW]W HLQH MXQJH )UDX PLW %DOO XQG .UDQ] QDFK OLQNV DXI HLQHP %O©WHQ NHOFK 9RU LKU VFKZHEW HLQ (URV PLW 6SLHJHO XQG %OXPH 9RQ OLQNVQ”KHUWVLFKHLQHZHLWHUH)UDXPLW)”FKHUXQG.LVWH5©FN Z”UWLJ 3DOPHWWH ]ZLVFKHQ 5DQNHQ GDUXQWHU XPODXIHQG 0”DQ GHU$XIGHU6FKXOWHU5RVHWWHQIULHVXQGDXIGHP+DOV6WUDKOHQ EHUDXV UHLFK YHU]LHUWH 'DUVWHOOXQJ 0LW .RSLH GHU 3XEOLNDWLRQ :LQ]LJH$EVSOLWWHUXQJEHLGHQ)DUEHQXQGHLQHNOHLQH$EVSOLW WHUXQJDP)XgVRQVWLQWDNWXQGLQKHUYRUUDJHQGHP=XVWDQG u

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP$SULO DXVGHU6DPPOXQJ'U6WRO]7ULHU 3XEOL]LHUW XQG ]XJHZLHVHQ . 6FKDXHQEXUJ 6WXGLHQ ]XU XQWHULWDOLVFKHQ 9DVHQPDOHUHL;,,,  6VRZLH6$EEDE $SXOLDQUHG}JXUHRLQRFKRHRIWKH%DOWLPRUH3DLQWHU-XJRIW\SXVZLWK WUHHIRLOPRXWKDQGWZRSODVWLFZDUULRUKHDGVDWERWKHQGVRIWKHULEEHGKDQGOH $ERXW%&2QWKHFRUSXVDVHDWHG\RXQJZRPDQZLWKEDOODQGZUHDWKLQ IURQWRIKHUD~RDWLQJ(URVZLWK~RZHUDQGPLUURU)URPWKHOHIWDSSURDFKHV DQRWKHU\RXQJZRPDQKROGLQJDIDQDQGDODUJHER[7LQ\~DNHVRIWKHZKLWH DQG\HOORZFRORUDQGDOLWWOHVSOLQWHURIWKHIRRWDUHPLVVLQJRWKHUZLVHLQWDFW DQGLQDVSOHQGLGFRQGLWLRQBeautiful and detailed image! With copies of the corresponding pages of the publication by Konrad Schauenburg!

41


26

26 $SXOLVFKH2LQRFKRHGHV%DOWLPRUH0DOHUV8PY&KU.DQ QHGHU)RUPYRP7\SXVPLW.OHHEODWWP©QGXQJXQGJHULSS WHP +HQNHO + FP k 0©QGXQJ FP k )Xg FP 5RW}JXULJ 'HWDLOV LQ *HOE XQG :HLg $XI GHP .¤USHU HLQH JH~©JHOWH)UDXPLW6FKDFKWHOXQG:HLQWUDXEHYRUHLQHP$OWDU 'DUXQWHUHLQ:HOOHQEDQG5©FNZ”UWLJ3DOPHWWH]ZLVFKHQ5DQ NHQ$XIGHU6FKXOWHU(LHUVWDEDXIGHP+DOV6WUDKOHQNUDQ]$Q +HQNHOXQG0©QGXQJJHEURFKHQXQGZLHGHU]XVDPPHQJHVHW]W NHLQH)HKOVWHOOHQ u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ +: HUZRUEHQ LP 'H]HPEHUDXVGHU6DPPOXQJ:LQNHOV(VVHQ 9JOGLH/HNDQLV6DPPOXQJ0DODJX]]L9DOHUL%DULLQ59$S,,6 1UPLW7DI $SXOLDQUHG}JXUHRLQRFKRHRIWKH%DOWLPRUH3DLQWHU-XJRIW\SXVZLWK WUHHIRLOPRXWKDQGULEEHGKDQGOH$ERXW%&2QIURQWVLGHRIWKHFRUSXV DZLQJHGZRPDQZLWKER[DQGJUDSHLQIURQWRIDQDOWDU+DQGOHDQGPRXWK DUHEURNHQDQGUHDWWDFKHGQRPLVVLQJSDUWV

42



 6L]LOLVFKH %DXFKOHN\WKRV GHV 0DOHUV YRQ %0 ) Um 330 v. &KU+FPkFPk)XgFP5RW}JXULJ'HWDLOVLQ *HOEXQG:HLg9RUQHDXIGHP.¤USHUHLQHMXQJHKDOEQDFNWH )UDX GLH DXI HLQHP )HOVHQ VLW]W XQG HLQ 7\PSDQRQ K”OW 9RQ OLQNV Q”KHUW VLFK HLQH ZHLWHUH )UDX PLW )U©FKWHVFKDOH .UDQ] XQG7K\UVRV=ZLVFKHQEHLGHQ)UDXHQHLQ3IHLOHUGDU©EHUHLQ )HQVWHU 5©FNZ”UWLJ 3DOPHWWH ]ZLVFKHQ 5DQNHQ PLW %O©WHQ EHUGHQ)LJXUHQ3XQNWUHLKHQXQG:HOOHQEDQGDXIGHP+DOV 6WUDKOHQNUDQ]'HFNIDUEHQWHLOZHLVHYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP-XQL DXVGHU6DPPOXQJGH0©QWHU%U©VVHO =XP0DOHUGHUGHPEHNDQQWHUHQ0DQIULD0DOHUQDKHVWHKWYJOGLH3\[LV 3DOHUPRLQ/&661UPLW7DI 6LFLOLDQUHG}JXUHVTXDWOHN\WKRVRIWKH3DLQWHURI%0)$ERXW%& 2QWKHIURQWDVHPLQXGHZRPDQZLWKW\PSDQRQVLWWLQJRQDURFN)URPOHIWD IXUWKHUZRPDQZLWKERZORIIUXLWVZUHDWKDQGWK\UVRVDSSURDFKHV%HWZHHQ ERWKZRPHQDSLOODUDQGDERYHDZLQGRZ&RDWLQJSDLQWLVSDUWLDOO\UXEEHG RIIRWKHUZLVHLQWDFW


28 29

28 3DHVWDQLVFKH%DXFKOH\NWKRVGHV0DOHUVYRQ1HDSHOUm 320 Y&KU+FPkFPk)XgFP5RW}JXULJ'HWDLOV LQ:HLg$XIGHU9RUGHUVHLWHHLQ)UDXHQNRSIPLW6SKHQGRQH 6FKPXFN XQG 6WLUQVWUDKOHQ 5©FNZÂ&#x201D;UWLJ 3DOPHWWH ]ZLVFKHQ 5DQNHQDXI6FKXOWHUXQG+DOV%OÂ&#x201D;WWHUIULHV,QWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP0Â&#x201D;U] DXVHLQHU3ULYDWVDPPOXQJLQ'RUWPXQG 9JOGLH/HN\WKRV3DHVWXPLQ59361UPLW7DIG 3DHVWDQUHG}JXUHVTXDWOHN\WKRVRIWKH3DLQWHURI1DSOHV %&2QWKHIURQWVLGHWKHKHDGRIDZRPDQZLWKVSKHQGRQHMHZHOOHU\DQG UD\VDWWKHIRUHKHDG,QWDFW

29 (WUXVNLVFKH%DXFKOHN\WKRVGHU6RNUD*UXSSH+Â&#x201D;OIWH-KY &KU+FP*ODQ]WRQZDUHSVHXGRURW}JXULJPLWWRQJUXQGL JHU'HFNIDUEHXQG5LW]XQJHQ1DFNWHU-©QJOLQJPLW6SLHO]HXJ 5DVVHO"  5©FNZÂ&#x201D;UWLJ 3DOPHWWH ]ZLVFKHQ 5DQNHQ $XI GHP +DOV%OÂ&#x201D;WWHUVWDE'HFNIDUEHDQZHQLJHQ6WHOOHQHWZDVYHUULHEHQ VRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP-XQL DXVGHU6DPPOXQJGH0©QWHU%U©VVHO (WUXVFDQ VTXDW OHN\WKRV RI WKH 6RNUD *URXS VW KDOI WK FHQWXU\ %& %ODFNJOD]HZDUHSVHXGRUHG}JXUHZLWKVXSHUSRVHGFRORUDQGLQFLVHGGHFRU 1XGH\RXWKZLWKWR\ UDWWOH" 6XSHUSRVHGFRORUSDUWLDOO\VOLJKWO\UXEEHGRII RWKHUZLVHLQWDFW

43


30 .DPSDQLVFKHU .HUQRV &XPDH &    Y &KU +RKHU UXQGHU 6W”QGHU PLW YLHU NOHLQHQ 6SHQGHQW¤SIFKHQ YLHU 3UR WRPHQLQ*HVWDOWYRQ)UDXHQN¤SIHQXQG HLQHP5LQJKHQNHO+FP%FP k6WDQG~”FKHFP'HUREHUH7HLO LVWJDQ]PLW*ODQ]WRQ©EHU]RJHQDXIGHU %DVLV 0DOHUHL LQ URW}JXULJHU 7HFKQLN %HLGVHLWLJ )UDXHQN¤SIH PLW 6DNNRV GD ]ZLVFKHQ3DOPHWWHQPLW5DQNHQ:HQLJH ZLQ]LJH $EVSOLWWHUXQJHQ GHV *ODQ]WRQV VRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPP OXQJ+:HUZRUEHQLP-XQLDXVGHU6DPP lung de Münter, Brüssel. 'HU.HUQRVGLHQWHQLFKWZLHGLHK”X}JHHQJOLVFKH EHUVHW]XQJFUXHWwVXJJHULHUWDOV%HK”OWQLVI©U YHUVFKLHGHQH*HZ©U]VDXFHQ9LHOPHKUZXUGHQLQ GHQ7¤SIFKHQPHKUHUHODQGZLUWVFKDIWOLFKH*DEHQ DQGLH*¤WWHU]XPHLVW'HPHWHUXQG3HUVHSKRQH JHRSIHUW=XU]HLWOLFKHQXQGVWLOLVWLVFKHQ(LQRUG QXQJYJOHLQHQ.HUQRVLQ&DSXDLQ/&66 1UPLW7DI

30

&DPSDQLDQNHUQRVZLWKIRXUOLWWOHSRWVDQGIRXU SURWRPHVLQIRUPRIZRPHQKHDGV&XPDH&   %& 8SSHU SDUW ZLWK EODFN JOD]H RQ WKH EDVH LQ UHG}JXUH WHFKQLTXH WZR ZRPHQKHDGV ZLWKVDNNRVDQGSDOPHWWHV)HZWLQ\~DNHVRIWKH EODFNJOD]HDUHUXEEHGRIIRWKHUZLVHLQWDFW

31 $SXOLVFKH (SLFK\VLV GHU 0HQ]LHV*UXS SH 8P  Y &KU .DQQH PLW 6FKQD EHODXVJXVV XQG .¤USHU LQ 3\[LGHQIRUP + FP k FP k 6WDQG~”FKH FP 6HLWOLFK GHV $XVJXVVHV ]ZHL NOHLQH SODVWLVFKH )UDXHQN¤SIH $XI GHU 6FKXOWHULQURW}JXULJHU7HFKQLNPLW'H WDLOVLQ*HOEXQG:HLgHLQVLW]HQGHU(URV PLW6FKDFKWHOXQG(IHXEODWW5©FNZ”UWLJ XQGDXIGHP+HQNHO3DOPHWWHQXQG5DQ NHQ DP 5DQG (LHUVWDE $XI GHP &RU SXV LQ *QDWKLD7HFKQLN JHULW]WH 5DQNH PLWZHLgHQ(IHXEO”WWHUQ$XIGHU8QWHU VHLWH HLQ .UHX] LQ 5RW :HQLJH ZLQ]LJH $EVSOLWWHUXQJHQVRQVWLQWDNWPLWIULVFKHU (UKDOWXQJ u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPP OXQJ+:HUZRUEHQLP'H]HPEHUDXVGHU Sammlung de Münter, Brüssel. =XZHLVXQJ GXUFK .RQUDG 6FKDXHQEXUJ 6FKUHLEHQYRQ 

31

44

$SXOLDQ HSLFK\VLV ZLWK EHDNHG VSRXW DQG S\[LV IRUPHGFRUSXVRIWKH0HQ]LHV*URXS$ERXW %& 6LGHZD\V RI WKH KDQGOH WZR OLWWOH SODVWLF IRUPHGKHDGVRIZRPHQ2QWKHVKRXOGHULQUHG }JXUHWHFKQLTXH(URVVLWWLQJRQWKHJURXQGDQG KROGLQJ D ER[ DQG D LY\OHDI 2Q WKH FRUSXV LQ *QDWKLDWHFKQLTXHDQHQJUDYHGWHQGULOZLWKZKLWH LY\OHDYHV%HORZWKHERWWRPDFURVVLQUHG)HZ WLQ\VSOLQWHUVDUHPLVVLQJRWKHUZLVHLQWDFWDQGLQ good condition.


32 (WUXVNLVFKH 6FKQDEHONDQQH GHU 6RNUD *UXSSH  +Â&#x201D;OIWH  -K Y &KU %LNRQL VFKH .DQQH PLW OÂ&#x201D;QJOLFKHP $XVJXVV + FP*ODQ]WRQZDUHSVHXGRURW}JXULJ PLWWRQJUXQGLJHU'HFNIDUEHXQG5LW]XQ JHQ$XIGHU6FKXOWHUHLQDXIHLQHU5DQ NH VLW]HQGHU (URV PLW .UDQ] ]ZLVFKHQ 5DQNHQ 'DU©EHU :HOOHQEDQG DXI GHP %DXFK2OLYHQ]ZHLJ:HQLJHZLQ]LJH$E SODW]XQJHQGHV*ODQ]WRQVVRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPP OXQJ +: H[ +LUVFK 1DFKIROJHU $XNWLRQ  /RVH[6OJ&0*$XJVEXUJ (WUXVFDQELFRQLFDOMXJZLWKEHDNHGVSRXWRIWKH 6RNUD*URXSVWKDOIWKFHQWXU\%&%ODFNJOD ]HZDUHSVHXGRUHG}JXUHZLWKVXSHUSRVHGFRORU and incised decor. On the shoulder a seated Eros ZLWKZUHDWKEHWZHHQWHQGULOV7LQ\~DNHVRIWKH EODFNJOD]HDUHPLVVLQJRWKHUZLVHLQWDFW

32

33 $SXOLVFKHU 6N\SKRV GHU 736*UXSSH 8P  Y &KU + FP % FP k FP k )Xg FP 5RW}JXULJ 'H WDLOV LQ *HOE XQG :HLg $XI GHU 9RU GHUVHLWH HLQ )UDXHQNRSI PLW 6DNNRV DXI GHU5©FNVHLWHHLQHQDFKUHFKWVVFKUHLWHQ GH MXQJH )UDX PLW .Â&#x201D;VWFKHQ XQG :HLQ WUDXEH ,Q GHQ +HQNHO]RQHQ 3DOPHWWHQ ]ZLVFKHQ 5DQNHQ XQG XQWHU GHU /LSSH :HOOHQEÂ&#x201D;QGHU=ZHLNOHLQH5LVVHEHLHL QHPZLQ]LJH)HKOVWHOOH u

3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ +: HUZRUEHQ LP 2NWREHU  DXV HLQHU 3ULYDWVDPPOXQJLQ'RUWPXQG 736VWHKWI©U7XULQDQG3ROLFRUR6N\SKRL9JOGHQ6N\SKRV'XEOLQLQ59$S,,6 1UPLW7DI $SXOLDQUHG}JXUHVN\SKRVRIWKH736*URXS$ERXW%&2QVLGH$WKHKHDGRIDZRPDQZLWK VDNNRVRQVLGH%\RXQJZRPDQZDONLQJWRWKHULJKWDQGKROGLQJER[DQGJUDSH7ZRVPDOOFUDFNVDW RQHDWLQ\VSOLQWHULVPLVVLQJ

33

33

45


34

34

34 $SXOLVFKHU 6FKDOHQVN\SKRV DXV GHU :HUNVWDWWGHV'DULXVXQG8QWHUZHOW PDOHUV8PY&KU+FP% FP k FP 5RW}JXULJ 'H WDLOVLQ*HOEXQG5RW$XIHLQHU6HL WH GHU .RSI HLQHU )UDX PLW 6DNNRV DXIGHUDQGHUHQHLQ3DQWKHU'DU©EHU (IHXEOÂ&#x201D;WWHU XQG MH HLQ 2UQDPHQW EDQGLQGHQ+HQNHO]RQHQ3DOPHWWHQ XQG5DQNHQ(LQH6HLWHPHKUIDFKJH EURFKHQ XQG ZLHGHU ]XVDPPHQ JH VHW]WGDEHLZLQ]LJH$EVSOLWWHUXQJHQ u 

3URYHQLHQ] $XV GHU 6DPPOXQJ 15 2EHUED\HUQHUZRUEHQLQGHQHU-DKUHQ LP0©QFKQHU.XQVWKDQGHO $SXOLDQ UHG}JXUHG FXSVN\SKRV IURP WKH :RUNVKRS RI WKH 'DULXV DQG 8QGHUZRUOG 3DLQWHUV $ERXW  %& 2Q RQH VLGH WKH KHDGRIDZRPDQZLWKVDNNRVRQWKHRWKHU VLGH D SDQWKHU 2QH VLGH EURNHQ LQ VHYHUDO IUDJPHQWVDQGUHDVVHPEOHGIHZWLQ\VSOLQWHUV are missing.

 $SXOLVFKHU (XOHQVN\SKRV  -K Y &KU + FP % FP k FP 5RW}JXULJ %HLVHLWLJ (XOH ]ZLVFKHQ 2OLYHQ]ZHLJHQ 0LW %HVWLPPXQJV]HW WHO GHV 6DPPOHUV $XV )UDJPHQWHQ ]XVDPPHQJHVHW]W NOHLQH UHWXVFKLHUWH )HKOVWHOOHQDQGHQ%UXFKNDQWHQ u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU ZRUEHQHU-DKUHELV $SXOLDQUHG}JXUHGRZOVN\SKRVWKFHQWXU\ %& 5HDVVHPEOHG IURP IUDJPHQWV OLWWOH UHWRXFKHGVSRWVDWWKHFUDFNVWith collectorâ&#x20AC;&#x2DC;s note!

36

36

46

36 3ODVWLVFKHV DSXOLVFKHV 5K\WRQ :HUN VWDWW GHV %DOWLPRUH0DOHUV    Y &KU (LQKHQNHOLJHU %HFKHU GHVVHQ XQWHUH +Â&#x201D;OIWH GLH )RUP HL QHV YHUVFKOHLHUWHQ )UDXHQNRSIHV PLW $PS\[ KDW + FP k 0©QGXQJ FP 5RW}JXULJ 'HWDLOV LQ *HOE XQG :HLg ,Q GHU REHUHQ )ULHV]RQH LVW HLQ NQLHQGHU (URV PLW JH¤IIQHWHU


6FKDFKWHOGDUJHVWHOOW5©FNZÂ&#x201D;UWLJVHLWOLFKGHV+HQNHOV]ZHL3DO PHWWHQ'DU©EHU(LHUVWDEGDUXQWHU:HOOHQEDQG$XV)UDJPHQ WHQ ]XVDPPHQJHVHW]W DQ GHQ %UXFKNDQWHQ NOHLQH UHWXVFKLHUWH )HKOVWHOOHQ u 3URYHQLHQ]$XVGHU6DPPOXQJ%&00DQQKHLPLQ)DPLOLHQEHVLW]VHLW $QIDQJGHV-KV $SXOLDQUK\WRQLQIRUPRIWKHKHDGRIDYHLOHGZRPDQZLWKDPS\[:RUNVKRS RIWKH%DOWLPRUH3DLQWHU%&,QWKHXSSHUSDUWDUHG}JXUHGIULH]H ZLWK(URVKROGLQJDQRSHQER[5HDVVHPEOHGIURPIUDJPHQWVDWWKHFUDFNV IHZUHWRXFKHGPLVVLQJVSRWV

 $VNRVLQ)RUPHLQHV3IHUGHVGHU*UXSSHYRQ6HOLQXQW 6HULH(  6L]LOLVFKY&KU+FP/FP$VNRVLQ)RUP HLQHV OLHJHQGHQ =\OLQGHUV PLW DEJHUXQGHWHQ (QGHQ XQG ]ZHL 0©QGXQJHQ$XVRUDQJHIDUEHQHP7RQPLWURWEUDXQHUXQGZHL gHU%HPDOXQJ$QHLQHU6HLWHEH}QGHWVLFKHLQSODVWLVFKPRGHO OLHUWHU3IHUGHNRSIDQGHUDQGHUHQ6HLWHHLQHNRQLVFKH7©OOH©EHU HLQHPSODVWLVFKPRGHOOLHUWHQ3IHUGHVFKZDQ]GHUDXIGHUUHFKWHQ

6HLWHGHV3IHUGHKLQWHUWHLOVDX~LHJW+LQWHUGHP3IHUGHNRSIHLQH DPSKRUHQI¤UPLJH0©QGXQJPLW]ZHLNXU]HQ%©JHOKHQNHOQ$Q GHU8QWHUVHLWHELOGHQ]ZHL+DNHQYRUQHXQGUXGLPHQWÂ&#x201D;UH6WXP PHOKLQWHQGLH3IHUGHEHLQH'LH%HPDOXQJ]HLFKQHW]XPHLQHQ 'HWDLOV GHV 3IHUGHV QDFK ZLH 0Â&#x201D;KQH =DXP]HXJ XQG %HLQH ]XPDQGHUHQVLQGDXFKGLH0©QGXQJHQIDUEOLFKXQGRUQDPHQ WDODN]HQWXLHUW=XVÂ&#x201D;W]OLFKLVWDXIHLQHU3IHUGH~DQNHHLQ6FKZDQ GDUJHVWHOOW 0LW 7/$QDO\VH /LQNHV 2KU IHKOW %HPDOXQJ ]XP 7HLOHWZDVYHUULHEHQDQVRQVWHQLQWDNW u 3URYHQLHQ]([6DPPOXQJ3&6©GGHXWVFKODQGHUZRUEHQEHL*DOHULH 3XK]H)UHLEXUJ=XOHW]W*RUQ\ 0RVFK$XNWLRQ/RV=XU .OÂ&#x201D;UXQJGHU(LJHQWXPVIUDJH]XU©FNJH]RJHQ(LQH5©FNIRUGHUXQJVHLWHQVGHU LWDOLHQLVFKHQ%HK¤UGHQLVWQLFKWHUIROJW 3XEOL]LHUW**©QWQHU +UVJ 0\WKHQXQG0HQVFKHQ$XVVWHOOXQJ:©U]EXUJ  6I1U $VNRVRIWKH*URXSRI6HOLQXQW 6HULH( LQVKDSHRIDKRUVHZLWKVSRXWV LQWKHPLGGOHDQGLQWKHEDFN3DLQWHGGHWDLOVOLNHOHJVH\HVDQGEULJJOHLQ EURZQLVKUHGDQGZKLWHDOVRSDLQWHGRUQDPHQWVDQGVZDQRQWKHERG\LQ EURZQLVKUHG6LFLOLDQ%&/HIWHDUPLVVLQJFRORXULVVOLJKWO\ UXEEHG:LWK7/DQDO\VLV



47


38

38 *ULHFKLVFKHU $VNRV LQ )RUP HLQHV )XgHV PLW 6DQGDOH 0DJQD *UDHFLD-KY&KU+FP/FP+HOOEUDXQHU7RQ PLWEUDXQHPEHU]XJ6DOEJHI”gLQ)RUPHLQHV)XgHVPLW6DQ GDOH,QGHU0©QGXQJHLQ6LHEU©FNZ”UWLJHLQ$XVJXVVLQ)RUP HLQHV/¤ZHQNRSIHV0LW)RWRXQG%HVFKUHLEXQJGHVHKHP%HVLW ]HUV+HQNHOVRZLHKLQWHUHU7HLOGHU6RKOHXQGUHFKWHU7HLOGHU )HUVHPRGHUQHUJ”Q]WXQGUHWXVFKLHUW u 3URYHQLHQ]$XVGHU6DPPOXQJ3URIHVVRU+(+HVVHQLP)UHLEXUJHU .XQVWKDQGHOHUZRUEHQ%HL*RUQ\ 0RVFK$XNWLRQ *UHHN}JXUDODVNRVLQVKDSHRIDIRRWZLWKVDQGDO0DJQD*UDHFLDWKUG FHQWXU\%&%ULJKWEURZQFOD\ZLWKEURZQVOLS,QWKHVSRXWDVLHYHEDFNZDUGV DVSRXWLQIRUPRIDOLRQhVKHDG+DQGOHUHDUSDUWRIWKHVROHLQFOWKHULJKW SDUWRIWKHKHHODUHPRGHUQDQGUHWRXFKHGWith foto and description of the former owner!

39 $SXOLVFKH/HNDQLV1DFKIROJHGHV%DOWLPRUH0DOHUVY &KU+PLW'HFNHOFP%PLW+HQNHOQFPk'HFNHO FP k )Xg FP 5RW}JXULJ 'HWDLOV LQ *HOE XQG :HLg $XI GHP 'HFNHO DXI 6HLWH $ HLQH *HUDQRPDFKLH EHL GHU HLQ 3\JP”HLQ5©VWXQJXQGJURgHPHQWEO¤gWHP3KDOOXVJHJHQHL QHQ.UDQLFK JULHFK*HUDQRV N”PSIW$XI6HLWH%V”XJWHLQH 'DPKLUVFKNXK HLQHQ (URV =ZLVFKHQ GHQ 6]HQHQ 3DOPHWWHQ DP'HFNHOUDQGHLQ:HOOHQEDQG0LW7/$QDO\VH(LQ5DQGIUDJ

48

PHQWGHV'HFNHOVZLHGHUDQJHVHW]WNOHLQHWHLOZHLVHUHWXVFKLHUWH $EVSOLWWHUXQJDP5DQGXQG)XgGHU6FKDOH u 3URYHQLHQ]([6DPPOXQJ3&6©GGHXWVFKODQGHUZRUEHQ'H]HPEHU EHL6RWKHE\hV=XOHW]W*RUQ\ 0RVFK$XNWLRQ/RV=XU .O”UXQJGHU(LJHQWXPVIUDJH]XU©FNJH]RJHQ(LQH5©FNIRUGHUXQJVHLWHQVGHU LWDOLHQLVFKHQ%HK¤UGHQLVWQLFKWHUIROJW 3XEOL]LHUW**©QWQHU +UVJ 0\WKHQXQG0HQVFKHQ$XVVWHOOXQJ:©U]EXUJ  6II1U 6WLOLVWLVFK VHKU ”KQOLFK LVW ZLH *XGUXQ *©QWQHU LP :©U]EXUJHU .DWDORJ DQPHUNWGLH3\[LV0HOERXUQH6OJ*HGGHV$59$S6XSSO,,E PLW7DI&,, 'LH*HUDQRPDFKLHGHU3\JP”HQZLUGVFKRQYRQ+RPHULQGHU,OLDV   HLQGULQJOLFKEHVFKULHEHQ3UREOHPDWLVFKHULVWGLH'DUVWHOOXQJDXIGHU5VGLH YRQ*XGUXQ*©QWQHULP:©U]EXUJHU$XVVWHOOXQJVNDWDORJDOV$QVSLHOXQJDXI GHQ7HOHSKRVP\WKRVYHUVWDQGHQZLUG'HU+HUDNOHVVRKQXQGVS”WHUH.¤QLJ YRQ0\VLHQZDUDXVJHVHW]WXQGELV]XVHLQHU5HWWXQJGXUFK+LUWHQYRQHL QHU+LUVFKNXKJHV”XJWZRUGHQ(LQ”KQOLFKHV0RWLY}QGHWVLFKVFKOLHgOLFK DXFKLQGHUU¤PLVFKHQ0\WKRORJLHDOV5RPXOXVXQG5HPXVYRQGHU:¤O}Q HUQ”KUWZXUGHQ $SXOLDQUHG}JXUHOHNDQLVZLWKOLG)ROORZHURIWKH%DOWLPRUH3DLQWHU %&2QWKHOLGRQRQHVLGHDJHUDQRPDFK\EHWZHHQDQDUPHGS\JP\DQG DFUDQH JUHHNJHUDQRV RQWKHRWKHUVLGHDKLQGLVVXFNOLQJ(URVSHUKDSVD UHIHUHQFHWRWKHP\WKRI7HOHSKRVWKHVRQRI+HUDFOHV2QHIUDJPHQWRIWKH ULPRIWKHOLGLVUHDWWDFKHGIHZOLWWOHVSOLQWHUVRIWKHULPDQGIRRWRIWKHFXS DUH PLVVLQJ SDUWLDOO\ UHWRXFKHG Published lekanis with very interesting P\WKRORJLFDOVFHQHV:LWK7/$QDO\VLV


39

39

49


40 $SXOLVFKH/HNDQLVGHV0HQ]LHV0DOHUV Y&KU+PLW'HFNHOFP%FPk'HN NHOFPk)XgFP5RW}JXULJ'HWDLOVLQ :HLg $XI GHP 'HFNHO DXI 6HLWH $ HLQ VLW]HQ GHU(URVPLW.UDQ]YRULKPHLQ$OWDU$XI6HLWH % VLW]HQGH )UDX PLW 6SHQGHQVFKDOH XQG .UDQ] =ZLVFKHQ GHQ )LJXUHQ 3~DQ]HQ XQG 3DOPHWWHQ $XI GHP 'HFNHONQDXI HLQH 5RVHWWH DXI GHP 'HFNHOUDQG HLQ :HOOHQEDQG XQG DXI GHU $X gHQVHLWHGHU6FKDOHZHLgHU6WDEIULHV(LQHNOHLQH $EVSOLWWHUXQJ DP 6FKDOHQUDQG VRQVW LQWDNW PLW ]DKOUHLFKHQ6LQWHUUHVWHQ u

40

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+: HUZRUEHQLQGHQHUELVHU-DKUHQ 9JO GLH )UDXHQGDUVWHOOXQJ DXI GHU 2LQRFKRH $18 &DQEHUUDLQ59$S,,61UPLW7DI $SXOLDQUHG}JXUHOHNDQLVZLWKOLGRIWKH0HQ]LHV3DLQWHU %&2QWKHOLGRQVLGH$D(URVVLWWLQJRQDURFN DQGKROGLQJDZUHDWKLQIURQWRIKLPDQDOWDU2QVLGH%D \RXQJZRPDQVLWWLQJRQDQDOWDUDQGKROGLQJDERZORIIUXLWV DQGDZUHDWK%HWZHHQWKH}JXUHVODUJHSDOPHWWHV2XWVLGH RIWKHFXSDZKLWHIULH]HRIOLQHV/LWWOHVSOLQWHURIWKHFXSULP LVPLVVLQJRWKHUZLVHLQWDFWZLWKQXPHURXVWUDFHVRIVLQWHU

41 .OHLQH DSXOLVFKH /HNDQLV :HUNVWDWW GHU .DQWKD URV*UXSSH    Y &KU + PLW 'HFNHO FP % FP k 'HFNHO FP k )Xg FP 5RW}JXULJ 'HWDLOV LQ :HLg $XI GHP 'HFNHO DXI EHLGHQ 6HLWHQ HLQ )UDXHQNRSI PLW 6DNNRV GD]ZLVFKHQ 3DOPHWWHQ $XI GHP 'H FNHONQDXIHLQH5RVHWWHXQGDXIGHP'HFNHOUDQG HLQ:HOOHQEDQG:LQ]LJH$EVSOLWWHUXQJDP'H FNHOUDQG )UDJPHQW HLQHV +HQNHOV JHEURFKHQ XQGZLHGHUDQJHVHW]W u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+: HUZRUEHQ LP 0Â&#x201D;U]  DXV HLQHU 3ULYDWVDPPOXQJ LQ 'RUWPXQG 41

6PDOO $SXOLDQ UHG}JXUH OHNDQLV ZLWK OLG :RUNVKRS RI WKH.DQWKDURV*URXS%&2QWKHOLGRQERWK VLGHVWKHKHDGRIDZRPDQZLWKVDNNRVEHWZHHQSDOPHWWHV 7LQ\VSOLQWHUVRIWKHNQREDUHPLVVLQJOLWWOHIUDJPHQWRIRQH KDQGOHLVEURNHQDQGUHDWWDFKHG

42 .OHLQH DSXOLVFKH /HNDQLV :HUNVWDWW GHU .DQWKD URV*UXSSH    Y &KU + PLW 'HFNHO FPk'HFNHOFPk)XgFP5RW}JX ULJ'HWDLOVLQ:HLg$XIGHP'HFNHODXIEHLGHQ 6HLWHQ HLQ )UDXHQNRSI PLW 6DNNRV GD]ZLVFKHQ 3DOPHWWHQ $XI GHP 'HFNHONQDXI HLQH 5RVHWWH XQG DXI GHP 'HFNHOUDQG HLQ :HOOHQEDQG 0LW %HVWLPPXQJV]HWWHO GHV 6DPPOHUV :LQ]LJH $E VSOLWWHUXQJHQDP6FKDOHQUDQGVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU -DKUHELVH[0©Q]JDOHULH*UXQRZ%HUOLQ/DJHUOLVWH -DQXDU1U

42

50

6PDOO$SXOLDQUHG}JXUHOHNDQLVZLWKOLGZRUNVKRSRIWKH .DQWKDURV*URXS%&2QWKHOLGRQERWKVLGHV WKHKHDGRIDZRPDQZLWKVDNNRVEHWZHHQSDOPHWWHV7LQ\ VSOLQWHUVRIWKHULPRIWKHFXSDUHPLVVLQJRWKHUZLVHLQWDFW With collectorâ&#x20AC;&#x2DC;s note!


43 3DHVWDQLVFKH 6FKDOH GHV 0DOHUV YRQ 1HDSHO  Um 320 v. Chr. Scha OH PLW LQQHQ DEJHVHW]WHP 5DQG XQG QLHGULJHP 5LQJIXg + RKQH +HQNHO FP%FPkFPk)Xg FP 5RW}JXULJ 'HWDLOV LQ *HOE XQG:HLg,P,QQHUHQHLQHKDOEQDFN WH VLW]HQGH )UDX PLW .UDQ] 9RU LKU HLQ QDFNWHU -©QJOLQJ PLW %DOOWXUPw GHUVHLQHQOLQNHQ)XgDXIHLQHKHXWH NDXP QRFK HUNHQQEDUH 5DQNH VHW]W +LQWHUGHU6LW]HQGHQHLQ]ZHLVWX}JHU $OWDU 'DU©EHU DXI GHP 5DQG HLQH JHULW]WH5DQNH$XgHQEHLGVHLWLJ2OL YHQ]ZHLJ 'HFNIDUEHQ WHLOZHLVH YHU EODVVW VRQVW LQWDNW PLW 6SXUHQ YRQ 6LQWHU u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ +: HUZRUEHQ LP 0DL DXVGHU6DPPOXQJGH0©QWHU%U©VVHO 9JO]XP-©QJOLQJGLH6FKDOH3DHVWXP 59361UPLW7DII XQG]XU VLW]HQGHQ )UDX GLH 6FKDOH 0DGULG  59361UPLW7DIK 

43

3DHVWDQ UHG}JXUH FXS RI WKH 3DLQWHU RI 1DSOHV$ERXW%&6WHPOHVVFXS ZLWKRIIVHWULPLQVLGH,QVLGHDVHPLQXGHJLUO ZLWKZUHDWKVLWWLQJWRWKHOHIW,QIURQWRIKHU D QDNHG \RXWK ZLWK URZ RI EDOOV VHWWLQJ KLV OHIWIRRWRQDWHQGULO%HKLQGWKHJLUODQDOWDU $ERYHRQWKHULPDQLQFLVHGWHQGULO2XWVLGH RQ HDFK VLGH D ROLYHEUDQFK &RDWLQJ SDLQW LVSDUWLDOO\UXEEHGRIIRWKHUZLVHLQWDFWZLWK WUDFHVRIVLQWHU

44 .DPSDQLVFKHU )LVFKWHOOHU GHV 5RELQ VRQ0DOHUV  9LHUWHO  -K Y &KU + ELV FP k FP 7HOOHU PLW ©EHUK”QJHQGHP NRQYH[HQ 5DQG 5RW}JXULJ 'HWDLOV LQ ZHLgHU )DUEH /HLFKWNRQNDYH2EHUVHLWHPLWWLJHLQH ]HQWUDOH9HUWLHIXQJ*HJHQGHQ8KU ]HLJHUVLQQVFKZLPPHQ]ZHLJHVWUHLIWH 0HHUEUDVVHQ XQG HLQH %UDQGEUDVVH LQ GHQ =ZLVFKHQU”XPHQ HLQH NOHLQH JHVWUHLIWH %UDVVH XQG HLQH 0XVFKHO $XIGHP7HOOHUUDQGHLQ:HOOHQEDQG (LQLJH 5DQGIUDJPHQWH JHEURFKHQ XQGZLHGHUDQJHVHW]W u 3URYHQLHQ] ([ :6 0©QFKHQ HKHPDOV 6DPPOXQJ.RQUDG6WUHKO   9JOGHQ7HOOHULQHLQHU3ULYDWVDPPOXQJLQ %HUQLQ,0F3KHH$'7UHQGDOO*UHHN 5HG}JXUHG )LVKSODWHV   6  1U  PLW7DID=XP0DOHUVDXFK&KU=LQGHO 0HHUHVOHEHQXQG-HQVHLWVIDKUW'LH)LVFKWHOOHU GHU6DPPOXQJ)ORUHQFH*RWWHW  6 I1U &DPSDQLDQUHG}JXUH}VKSODWHRIWKH5RELQ VRQ3DLQWHUZLWKWZRVWULSHGEUHDPVDQGRQH VDGGOHGEUHDPEHWZHHQWKHODUJH}VKDVPDOO VWULSHGEUHDPDQGDVHDVKHOOUGTXDUWHUWK FHQWXU\%&6HYHUDOIUDJPHQWVRIWKHULPDUH EURNHQDQGUHDWWDFKHG

44

51




 .DPSDQLVFKHU )LVFKWHOOHU GHV +HOJR ODQG0DOHUV  9LHUWHO  -K Y &KU + ELV FP k FP 7HOOHU PLW ©EHUKÂ&#x201D;QJHQGHP NRQYH[HQ 5DQG 5RW}JXULJ 'HWDLOV LQ ZHLgHU )DU EH 6WDUN NRQNDYH 2EHUVHLWH PLWWLJ HLQH ]HQWUDOH 9HUWLHIXQJ *HJHQ GHQ 8KU]HLJHUVLQQVFKZLPPHQGUHL0HH UHVEUDVVHQ $XI GHP 7HOOHUUDQG HLQ :HOOHQEDQG :LQ]LJH $EVSOLWWHUXQJ DP5DQGVRQVWLQWDNW u 3URYHQLHQ]([&KULVWRSK/HRQ%DVHOVHLWGHQ HU-DKUHQ 9JOGHQ7HOOHULQHLQHU+DPEXUJHU3ULYDW VDPPOXQJ LQ , 0F3KHH  $' 7UHQGDOO *UHHN 5HG}JXUHG )LVKSODWHV   6 1UPLW7DIG=XP0DOHUVDXFK &KU=LQGHO0HHUHVOHEHQXQG-HQVHLWVIDKUW 'LH)LVFKWHOOHUGHU6DPPOXQJ)ORUHQFH*RWWHW  6I1U &DPSDQLDQ UHG}JXUH }VKSODWH RI WKH +HOJRODQG3DLQWHUZLWKWKUHHVWULSHGEUHDPV UGTXDUWHUWKFHQWXU\%&7LQ\VSOLQWHURI WKHULPLVPLVVLQJRWKHUZLVHLQWDFW

46

52

46 $SXOLVFKHU )LVFKWHOOHU GHV )URVFK 0DOHUV 7DUHQW GULWWHV 9LHUWHO  -K Y&KU7HOOHUPLWNRQNDYHU2EHU~Â&#x201D; FKH©EHUKÂ&#x201D;QJHQGHP5DQGXQGHLQHU


]HQWUDOHQ9HUWLHIXQJ+FPk FP k )Xg FP 5RW}JXULJ =HQWUDO LQ GHU 9HUWLHIXQJ 5RVHW te, darum ein Wellenband und GUHL XQJHZ¤KQOLFKH )LVFKGDUVWHO OXQJHQ JHJHQ GHQ 8KU]HLJHUVLQQ $XIJUXQG GHU GXUFKJHKHQGHQ 5©FNHQ~RVVHQN¤QQWHHVVLFKXP YHUVFKLHGHQH /LSS}VFKH KDQGHOQ $XIGHP5DQGDXgHQHLQ:HOOHQ band. 0LW .RSLH GHU 3XEOLNDWLRQ .OHLQH)HKOVWHOOHDP)Xg%HPD OXQJYHUULHEHQ u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ +: HUZRUEHQ LP 'H]HPEHUDXVGHU6DPPOXQJGH Münter, Brüssel. 3XEOL]LHUW XQG ]XJHZLHVHQ . 6FKDXHQEXUJ6WXGLHQ]XUXQWHULWDOLVFKHQ 9DVHQPDOHUHL;,9  6IVRZLH 6$EEDE 9JO GHQ QDPHQVJHEHQGHQ 7HOOHU &ROOHFWLRQ *HGGHV 0HOERXUQH $ EHL,0F3KHH$'7UHQGDOO$GGHQGD WR*UHHN5HG}JXUHG)LVK3ODWHV$QWLNH .XQVW61UPLW7DI  $SXOLDQUHG}JXUH}VKSODWHRIWKH)URJ 3DLQWHU 7DUDQWR WKLUG TXDUWHU WK FHQWXU\%&,QWKHFHQWUDOGHSUHVVLRQD URVHWWHDQGDURXQGDEDQGRIZDYHV$OO URXQGDQWLFORFNZLVHWKUHHXQXVXDO}VK SHUKDSVWKUHHGLIIHUHQWZUDVVHV2XWVLGH RIWKHULPDIXUWKHUEDQGRIZDYHV/LWWOH IUDJPHQWRIWKHIRRWLVPLVVLQJSDLQWLQJ LVSDUWLDOO\UXEEHGRIIWith copies of the corresponding pages of the publication by Konrad Schauenburg!

 .DPSDQLVFKH +\GULD  +Â&#x201D;OIWH  -K Y &KU + FP % PLW +HQNHOQ FP k 0©QGXQJ FP k )Xg FP *ODQ] WRQZDUH6RQGHUIRUPGHU+\GULD PLW DEJHUXQGHWHU 6FKXOWHU .DO SLV $XIGHU/LSSHLQURW}JXULJHU 7HFKQLN HLQ (LHUVWDE 0LW DXIJH WUDJHQHU 7RQIDUEH DXI GHP +DOV HLQ/RUEHHUNUDQ]VRZLH/LQLHQDQ GHQ+HQNHODQVÂ&#x201D;W]HQXQGDXIGHP )Xg,QWDNW u



3URYHQLHQ] (KHPDOV &KULVWRSK /HRQ %DVHOHUZRUEHQ &DPSDQLDQ EODFNJOD]HG K\GULD QG KDOI WK FHQWXU\ %& 2Q WKH OLS HJJ DQGGDUW LQ UHG}JXUH WHFKQLTXH :LWK VXSHUSRVHGFRORXUDODXUHOZUHDWKRQWKH QHFNDQGOLQHVDURXQGWKHKDQGOHVDQG RQWKHIRRW,QWDFW

53


48 *URgHU DSXOLVFKHU 6N\SKRV GHU *QD WKLD:DUH 6SÂ&#x201D;WHV  -K Y &KU + FP%FPkFP*ODQ] WRQZDUH PLW URWHU JHOEHU XQG ZHL gHU %HPDOXQJ $XI GHU 9RUGHUVHLWH /DXEH PLW :HLQUDQNH GDULQ %OXPH PLWURWHQ%OÂ&#x201D;WWHUQ$XIGHU5©FNVHL WHJHULW]WH/DXEHPLW3XQNWJLUODQGHQ GDULQ HLQH 5RVHWWH 8QWHU GHU /LSSH (LHUVWDE$XVJURgHQ)UDJPHQWHQ]X VDPPHQJHVHW]WNOHLQH6WHOOHDP)Xg PRGHUQHUJÂ&#x201D;Q]WVRQVWYROOVWÂ&#x201D;QGLJ u 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQ ELV /DUJH$SXOLDQVN\SKRVRIWKH*QDWKLDZDUH ZLWK UHG \HOORZ DQG ZKLWH FRORU 2Q WKH IURQWVLGHDQDUERXUZLWKYLQHWHQGULOLQVLGH D~RZHUZLWKUHGOHDYHV2QWKHEDFNVLGHDQ HQJUDYHGDUERXUZLWKGRWWHGJDUODQGLQVLGH DURVHWWH5HDVVHPEOHGIURPODUJHIUDJPHQWV OLWWOH SDUW RI WKH IRRW LV PRGHUQ RWKHUZLVH FRPSOHWH 48

49 .DPSDQLVFKH 2LQRFKRH 6SÂ&#x201D;WHV  -K Y &KU )RUP $ PLW JHULSSWHP .¤USHU + FP k FP k 0©QGXQJ FP *QDWKLDZDUH PLW ZHLgHUXQGURWHU%HPDOXQJ$XIGHP +DOVHLQH(IHXUDQNHGDUXQWHUDXIGHU 6FKXOWHU HLQ 'HO}Q 'UHL )UDJPHQWH GHU0©QGXQJJHEURFKHQXQGZLHGHU DQJHVHW]W*ODQ]WRQHWZDVEHULHEHQ u Provenienz: Ex Sammlung 6©GGHXWVFKODQGYRU

E.H.,

&DPSDQLDQRLQRFKRHRIIRUP$ZLWKULEEHG FRUSXVRIWKH*QDWKLDZDUH/DWHWKFHQWXU\ %& 2Q WKH QHFN LY\WHQGULO DQG EHORZ RQ WKH VKRXOGHU D GROSKLQ 7KUHH IUDJPHQWV RI WKHPRXWKDUHEURNHQDQGUHDWWDFKHGEODFN JOD]HSDUWLDOO\VOLJKWO\UXEEHG

 3DDUE¤RWLVFKH.DQWKDURL+Â&#x201D;OIWH -KY&KU+FP% FPkFP*ODQ]WRQZD UHPLWZHLgHU'HFNIDUEH$XgHQDXI MHGHU 6HLWH 2OLYHQ]ZHLJ %HLP JU¤ gHUHQ EHLGH +HQNHO JHEURFKHQ XQG ZLHGHUDQJHVHW]W u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ /RVH[6DPPOXQJ$$0©QFKHQ HUZRUEHQ]ZLVFKHQXQG

49

54

3DLU RI EODFNJOD]H NDQWKDURL ZLWK ZKLWH FRORU %RHRWLDQ QG KDOI WK FHQWXU\ %& 2XWVLGHRQHDFKVLGHDQROLYHEUDQFK%RWK KDQGOHVRIWKHODUJHUNDQWKDURVDUHEURNHQ and reattached.




 $WWLVFKHU .DQWKDURV GHU 6W 9DOHQWLQ.ODVVH  +Â&#x201D;OIWH  -K Y &KU *UXSSH 9,, YRQ +RZDUG XQG -RKQVRQ + FP % FPk0©QGXQJFP5RW}JXULJ'HWDLOVLQ:HLg$XI EHLGHQ 6HLWHQ REHQ MH HLQ )ULHV DXV KRFKUHFKWHFNLJHQ )HOGHUQ PLW=ZHLJHQGDEHLDEZHFKVHOQGVFKZDU]H=ZHLJHDXI7RQJUXQG XQG ZHLgH =ZHLJH DXI 6FKZDU] 'DUXQWHU ZHLgHU 2OLYHQ]ZHLJ XQG HLQ 6WDEIULHV 0LW%HVWLPPXQJV]HWWHOGHV6DPPOHUV .OHLQH $EVSOLWWHUXQJHQ DQ 0©QGXQJ XQG 5LQJIXg HLQ )UDJPHQW GHV )XgHVJHEURFKHQXQGZLHGHUDQJHVHW]WPHKUHUH.UDW]HU u 3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ H[ 0©Q]JDOHULH *UXQRZ %HUOLQ /DJHUOLVWH-DQXDU1U =X GHQ DWWLVFKHQ .DQWKDURL GLHVHU .ODVVH V 6 +RZDUG  )3 -RKQVRQ $PHULFDQ-RXUQDORI$UFKDHRORJ\6II $WWLFUHG}JXUHVHVVLOHNDQWKDURVRIWKH6DLQW9DOHQWLQ&ODVVQGKDOIWK FHQWXU\ %& 2Q ERWK VLGHV DERYH IULH]H ZLWK DOWHUQDWLQJ EODFN DQG ZKLWH EUDQFKHV%HORZDZKLWHROLYHEUDQFKDQGDURZRIEODFNOLQHV/LWWOHVSOLQWHUV



RIULPDQGIRRWDUHPLVVLQJRQHIUDJPHQWRIWKHIRRWEURNHQDQGUHDWWDFKHG IHZVFUDWFKHVWith collectorâ&#x20AC;&#x2DC;s note!

 $SXOLVFKHU.DQWKDURVGHU6W9DOHQWLQ.ODVVH0LWWH-KY&KU +FP%FPk0©QGXQJFP'HWDLOVLQ:HLgXQG 5RW$XIEHLGHQ6HLWHQMHZHLOVHLQ)HOGPLWURWZHLgHQ5DXWHQ GDUXQWHU ZHLgHU /RUEHHU]ZHLJ REHQ XQG XQWHQ HLQ VFKZDU]HU 6WDEIULHVDXIURWHP*UXQG,QWDNWPLW]DKOUHLFKHQ6LQWHUUHVWHQ u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP-XQL DXVGHU6DPPOXQJ'U6WRO]7ULHU $SXOLDQVHVVLOHNDQWKDURVRIWKH6DLQW9DOHQWLQ&ODVV$ERXWWKHPLGGOHWK FHQWXU\%&2QERWKVLGHVD]RQHZLWKUHGDQGZKLWHUKRPEVEHORZDZKLWH ODXUHOEUDQFKDERYHDQGEHORZDIULH]HZLWKEODFNOLQHVRQUHGJURXQG,QWDFW ZLWKPDQ\UHPDLQVRIVLQWHU



55




 $SXOLVFKH (SLFK\VLV 6SÂ&#x201D;WHV  -K Y &KU 6FKQDEHONDQQH PLW RYRLGHP &RUSXV XQG KRKHP +HQNHO VHLWOLFK GDUDQ /¤ZHQ NRSIDSSOLNHQ + FP *QDWKLD:DUH 'HWDLOV LQ 5RW *HOE XQG :HLg $XI 6FKXOWHU XQG %DXFK (LHUVWÂ&#x201D;EH ]ZHLIDUELJH *LUODQGHQ :HLQUDQNHQ XQG 0Â&#x201D;DQGHU +HQNHO XQG $XVJXVV JHEURFKHQXQGZLHGHUDQJHVHW]WYROOVWÂ&#x201D;QGLJ u 3URYHQLHQ]([7$-$13DULV$XNWLRQ$SULOH[/RVGDYRU LQHLQHUIUDQ]¤VLVFKHQ3ULYDWVDPPOXQJ $SXOLDQHSLFK\VLVRIWKH*QDWKLDZDUH/DWHWKFHQWXU\%&2QWKHFRUSXV HJJDQGGDUWWZRFRORXUHGJDUODQGVYLQHDQGPHDQGHU+DQGOHLQFOWKHVSRXW EURNHQDQGUHDWWDFKHGDOOFRPSOHWH

56



 $SXOLVFKH (SLFK\VLV 6SÂ&#x201D;WHV  -K Y &KU 6FKQDEHONDQQH PLW RYRLGHP &RUSXV XQG KRKHP +HQNHO VHLWOLFK GDUDQ /¤ZHQ NRSIDSSOLNHQ + FP k FP *QDWKLD:DUH PLW 5LW]XQ JHQ 'HWDLOV LQ 5RW *HOE XQG :HLg $XI 6FKXOWHU XQG %DXFK 6WDEIULHV(LHUVWDE0Â&#x201D;DQGHU2OLYHQ]ZHLJHVHLWOLFKHLQHU5RVHW WHVWLOLVLHUWHV)OHFKWEDQGXQG(IHXEOÂ&#x201D;WWHU0LW%HVWLPPXQJV]HWWHO GHV6DPPOHUV,QWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV $SXOLDQ RYRLG HSLFK\VLV RI WKH *QDWKLD ZDUH ZLWK SODVWLF OLRQKHDGV /DWH WKFHQWXU\%&2QWKHFRUSXVEHWZHHQHQJUDYHGOLQHVVHYHUDOIULH]HVZLWK SDLQWHGRUQDPHQWVHJHJJDQGGDUWPDHDQGHUDQGROLYHEUDQFKHV,QWDFW With collectorâ&#x20AC;&#x2DC;s note!


 $SXOLVFKHU .HUQRV  -K Y &KU %FP+FPkFPMH*HIÂ&#x201D;g =ZHL PLWHLQDQGHU YHUEXQGHQH EDX FKLJH 'HFNHOJHIÂ&#x201D;gH *QDWKLD:DUH 'HWDLOV LQ 5RW *HOE XQG :HLg $XI GHP &RUSXV 6WULFKGHNRU DXI GHQ 'HFNHOQ 5RVHWWHQ XQG %O©WHQ VRZLH %ODWWGHNRU 2EHU~Â&#x201D;FKH HWZDV EHULH EHQ +HQNHO ZLHGHU DQJHVHW]W XQG QDFKJHPDOWHLQ*HIÂ&#x201D;gDXV)UDJPHQ WHQZLHGHU]XVDPPHQJHVHW]WZLQ]LJH )UDJPHQWHGHU'HFNHOIHKOHQ u 3URYHQLHQ]$XVGHU6OJ'..RSHQKDJHQ YRUPDOVDXVHLQHU1RUGHXURSÂ&#x201D;LVFKHQ6DPP OXQJHUZRUEHQLQGHQHUHU-DKUHQ



$SXOLDQ NHUQRV RI WKH *QDWKLD ZDUH UG FHQWXU\%&2QWKHFRUSXVOLQHVDQGRQWKH OLGVURVHWWHVDQG~RZHUVDQGOHDYHV6XUIDFH VOLJKWO\UXEEHGRIIKDQGOHUHSDLQWHGDQGUHDW WDFKHGRQHS\[LVUHDVVHPEOHGWLQ\IUDJPHQWV RIWKHOLGVPLVVLQJ

 .DPSDQLVFKHU *XWWXV  +Â&#x201D;OIWH  -K Y &KU + FP / FP k FP*ODQ]WRQZDUHPLWJHULSSWHP .¤USHU$XIGHP5©FNHQGHUIURQWD OH.RSIHLQHV3DQPLW=LHJHQK¤UQHUQ XQG (IHXNUDQ] 2EHU~Â&#x201D;FKH WHLOZHLVH YHUULHEHQVRQVWLQWDNW u 3URYHQLHQ]$XV6DPPOXQJ/-1LHGHUODQGH H[*RUQ\ 0RVFK$XNWLRQ/RV DXVDPHULNDQLVFKHU3ULYDWVDPPOXQJ &DPSDQLDQEODFNJOD]HGJXWWXVZLWKULEEHG FRUSXVQGKDOIWKFHQWXU\%&$ERYHWKH SODVWLFDOO\ PRXOGHG KHDG RI 3DQ ZLWK LY\ ZUHDWK 6XUIDFH SDUWLDOO\ UXEEHG RWKHUZLVH intact.



 $SXOLVFKHU*XWWXVPLWSODVWLVFKHP'H NRU  +Â&#x201D;OIWH  -K Y &KU *ODQ] WRQZDUH PLW JHULSSWHP &RUSXV XQG KRKHP $XVJXVV + FP / FPk&RUSXVFP$XIGHP 5©FNHQ GLH SODVWLVFK DXVJHIRUPWH IURQWDOH%©VWHGHU$WKHQD=ZHLNOHL QH $EVSOLWWHUXQJHQ DP )Xg VRQVW LQWDNW u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDW VDPPOXQJ +: HUZRUEHQ LP $SULO  DXVGHU6DPPOXQJ'U6WRO]7ULHU $SXOLDQ EODFNJOD]HG JXWWXV ZLWK ULEEHG FRUSXVDQGORQJVSRXWQGKDOIWKFHQWXU\ %& $ERYH WKH SODVWLFDOO\ PRXOGHG EXVW RI $WKHQD 7ZR OLWWOH VSOLQWHUV RI WKH IRRW DUH PLVVLQJRWKHUZLVHLQWDFW



80

57


 $SXOLVFKH(SLFK\VLV-KY&KU 6FKQDEHONDQQH GHU *ODQ]WRQZD UHPLW~DFKHPJHULSSWHQ.¤USHU XQGVHLWOLFKHQ$SSOLNHQLQ)RUP YRQ )UDXHQN¤SIHQ + FP k FP $XI GHU 6FKXOWHU JH VWHPSHOWH 3DOPHWWHQ GLH GXUFK 5LW]XQJHQ PLWHLQDQGHU YHUEXQ GHQ VLQG 6SUXQJ LP +DOV GD EHLNOHLQH)HKOVWHOOHQHLQNOHLQHV )UDJPHQWGHV5LQJIXgHVIHKOW u Provenienz: Aus der Sammlung H.W., %D\HUQVHLWGHQHU-DKUHQHUZRU EHQLP0©QFKQHU.XQVWKDQGHO $SXOLDQ EODFNJOD]HG HSLFK\VLV ZLWK VTXDW ULEEHG FRUSXV DQG WZR DSSOLTXHV LQIRUPRIZRPHQKHDGVQGKDOIWK FHQWXU\ %& 2Q WKH VKRXOGHU VWDPSHG SDOPHWWHV&UDFNDWWKHQHFNIHZVSOLQ WHUVDWWKLVFUDFNDQGDIUDJPHQWRIWKH IRRWDUHPLVVLQJ



 *XWWXVLQ%UXVWIRUP.DPSDQLHQ +Â&#x201D;OIWH-KY&KU+FP / FP k FP *ODQ]WRQ ZDUH VRJ &DOHQLVFKH .HUDPLN  ,P ,QQHUHQ HLQH 7RQNXJHO 5DV VHO 'D]XHLQNOHLQHU5LQJDVNRV HEHQIDOOV NDPSDQLVFKH *ODQ] WRQZDUH + FP / FP k FP6W©FN,QWDNW u 3URYHQLHQ] $XV GHU 6DPPOXQJ 15 2EHUED\HUQ HUZRUEHQ LQ GHQ HU -DKUHQLP0©QFKQHU.XQVWKDQGHO



58

*XWWXVRIWKHEODFNJOD]HZDUHLQIRUP RIDZRPDQhVEUHDVW,QVLGHDFOD\EXOOHW UDWWOH &DPSDQLDQVRFDOOHG&DOHQLDQ SRWWHU\QGKDOIWKFHQWXU\%&3OXVD ULQJDVNRVDOVR&DPSDQLDQEODFNJOD]H ZDUH$OOLQWDFW2 pieces!


60 $SXOLVFKH 6FKDOH GHU 5HG6ZDQ *UXSSH  +Â&#x201D;OIWH  -K Y &KU 1LHGULJH 6FKDOH PLW LQQHQ DEJH VHW]WHP 5DQG + RKQH +HQNHO FP%FPkFP6L[ 7HFKQLN ,P ,QQHUHQ HLQ ]ZHL IDFK JHUDKPWHU 7RQGR GDULQ HLQ 6FKZDQ©EHU:HOOHQ0LW%HVWLP PXQJV]HWWHO GHV 6DPPOHUV (LQ 5DQGIUDJPHQW JHEURFKHQ XQG ZLHGHUDQJHVHW]W u 3URYHQLHQ]([6DPPOXQJ96%HUOLQ HUZRUEHQHU-DKUHELV $SXOLDQ FXS RI WKH 5HG 6ZDQ *URXS QGKDOIWKFHQWXU\%&&XSRIEODFN JOD]HG ZDUH ZLWK GHFRUDWLRQ LQ 6L[ WHFKQLTXHZLWKRIIVHWULPLQVLGH,QVLGHD GRXEOHOLQHGWRQGRZLWKVZDQRYHUZDYHV 2QHIUDJPHQWRIWKHULPLVEURNHQDQG reattached. With collectorâ&#x20AC;&#x2DC;s note!

60

61 $SXOLVFKH 6FKDOH  +Â&#x201D;OIWH  -K Y &KU 6FKDOH PLW QLHGULJHP 5LQJIXg + RKQH +HQNHO FP B 20,6cm, Ã&#x2DC; 14,2cm, Ã&#x2DC; FuÃ&#x; FP;HQRQ:DUH,P,QQHUHQ 6WHPSHOGHNRUPLWYLHU3DOPHWWHQ 'DU©EHULVWPLWU¤WOLFKHP6FKOLN NHU HLQ +XQG JHPDOW XPODXIHQG HLQ /RUEHHUNUDQ] $XI GHU $X gHQVHLWH MHZHLOV HLQ 2OLYHQ]ZHLJ (LQ+HQNHOXQGGUHLNOHLQH5DQG IUDJPHQWHJHEURFKHQXQGZLHGHU DQJHVHW]W u 3URYHQLHQ]$XVGHQHKHPDOLJHQ5HVWEH ständen der Münchner Münzhandlung .DUO.UHVVHUZRUEHQYRU $SXOLDQ VWHPOHVV FXS RI WKH ;HQRQ *URXSZLWKVXSHUSRVHGFRORXUQGKDOI WKFHQWXU\%&,QVLGHDVWDPSHGGHFRU ZLWK IRXU SDOPHWWHV RYHUOLHG E\ SDLQWHG GRJDQGDODXUHOZUHDWK2XWVLGHRQHDFK VLGH DQ ROLYHEUDQFK 2QH KDQGOH DQG WKUHH VPDOO ULPIUDJPHQWV DUH EURFNHQ and reattached.

61

59


62 $SXOLVFKH *ODQ]WRQVFKDOH PLW SODVWLVFKHP 'HNRU  +Â&#x201D;OIWH  -K Y &KU + FP k FP 8PODXIHQG DXI GHU $XgHQVHLWH SODVWLVFKHU 'HNRU LQ )RUP YRQ =XQJHQVWÂ&#x201D;EHQ *ODQ]WRQ DQ ZH QLJHQ 6WHOOHQ YHUULHEHQ VRQVW LQWDNW u 62

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3UL YDWVDPPOXQJ+:HUZRUEHQLP)HEUX DUDXVGHU6DPPOXQJGH0©QWHU Brüssel. $SXOLDQ EODFNJOD]HG GLVK ZLWK ULEEHG FRUSXVQGKDOIWKFHQWXU\%&%ODFN JOD]H UXEEHG RII DW IHZ OLWWOH VSRWV RWKHUZLVHLQWDFW

63

63 $WWLVFKHU)LVFKWHOOHUY &KU 7HOOHU PLW NRQNDYHU 2EHU ~Â&#x201D;FKH ©EHUKÂ&#x201D;QJHQGHP 5DQG XQGHLQHU]HQWUDOHQ9HUWLHIXQJ+ FPkFPk)XgFP *ODQ]WRQZDUH$XIGHU8QWHUVHL WH GUHL *UDI}WL ]ZHL ]HLJHQ GLH %XFKVWDEHQ$17HLQHVHLQ L (=  $XIGHU)XgXQWHUVHLWH*UDI }WR L,, " 0LWLWDOLHQLVFKHU ([SRUWOL]HQ] )HKOVWHOOHQ DQ  GHV 5DQGHV HLQ 6SUXQJ PHKUH UHREHU~Â&#x201D;FKLJH%HVWRgXQJHQ u 3URYHQLHQ]([6DPPOXQJ=*1HDSHO davor in englischer Privatsammlung. =X JULHFKLVFKHQ +DQGHOVPDUNHQ DXI 9DVHQV$:-RKQVWRQ7UDGHPDUNVRQ *UHHN 9DVHV   $GGHQGD   XQG$GGHQGD%DQG  

63

60

$WWLF}VKSODWHRIWKHEODFNJOD]HGZDUH %&8QGHUQHDWKWKUHHJUDI}WL WZRZLWKWKHOHWWHUV$17RQHZLWKL    $QRWKHU JUDI}WR EHORZ WKH IRRW ZLWKL,, " 0LVVLQJSDUWVDWDERXW WKUHHTXDUWHUVRIWKHULPRQHFUDFNOLWWOH VSOLQWHUVRIWKHVXUIDFHDUHPLVVLQJWith H[SRUWOLFHQFHIURP,WDO\


64

64 0LQRLVFKH6FKQDEHONDQQH6+,,,$(QGHGHV-KVY&KU+ FPkFP+HOOEUDXQHU7RQPLWURWEUDXQHU%HPDOXQJ $XIGHU6FKXOWHUGUHL*UXSSHQYRQVWLOLVLHUWHQ$UJRQDXWHQDXV GHU *DWWXQJ GHU &HSKDORSRGD $XI +DOV XQG $XVJXVV /LQLHQ 'HU +HQNHOU©FNHQ LVW PLW )DUEH EHGHFNW XQG HQGHW XQWHQ DXI 6FKXOWHU XQG %DXFK LQ HLQHP VWLOLVLHUWHQ .UDNHQ RGHU LQ HLQHU Qualle. 0LW 7/$QDO\VH $XV )UDJPHQWHQ ]XVDPPHQ JHVHW]W ZHQLJHNOHLQH5HWXVFKHQDQGHQ%UXFKNDQWHQNOHLQH)UDJPHQWH GHU0©QGXQJXQGDQGHU6FKXOWHUHUJÂ&#x201D;Q]W6RQVWNRPSOHWW u

3URYHQLHQ]([1DFKODVV.DULQ.RUWH%D\HUQLP)DPLOLHQEHVLW]VHLWGHQ HU-DKUHQ 9JO]XU*HIÂ&#x201D;gIRUP'DV0\NHQLVFKH+HOODV+HLPDWGHU+HOGHQ+RPHUV $XVVWHOOXQJ%HUOLQ  61U]XU'DUVWHOOXQJGHU$UJRQDXWHQ HEHQGD61U 0LQRDQMXJZLWKEHDNHGVSRXW6+,,,$ODWHWKFHQWXU\%&2QWKH VKRXOGHUWKUHHJURXSVRIVW\OL]HG$UJRQDXWDHRIWKHJHQHULFJURXS&HSKDORSRGD $WWKHHQGRIWKHKDQGOHDVW\OL]HGRFWRSXVRUDMHOO\}VK5HDVVHPEOHGIURP IUDJPHQWVIHZVPDOOUHWRXFKHGDUHDVDWWKHFUDFNVOLWWOHIUDJPHQWVRIWKHVSRXW DQGDWWKHVKRXOGHUUHVWRUHG2WKHUZLVHLQWDFW:LWK7/DQDO\VLV

61




66

 )XgVFKDOH VWOLFKHU 0LWWHOPHHUUDXP    Y &KU 6WHLO ZDQGLJHU .HOFK DXI KRKHP )Xg PLW ]ZHL +HQNHOQ + FP k 0©QGXQJ FP %LFKURPH ,9:DUH %HLJHU 7RQ PLW UR WHUXQGGXQNHOEUDXQHU%HPDOXQJ$XgHQ)HOGHUPLWVHQNUHFK WHQ /LQLHQ )LVFKJUDWPXVWHUQ XQG NRQ]HQWULVFKHQ +DOENUHLVHQ VRZLH 6RQQHQV\PEROHQ ,QQHQ NRQ]HQWULVFKH .UHLVH .OHLQH $EVSOLWWHUXQJHQDQ0©QGXQJXQG)Xg u 3URYHQLHQ]$XVGHU6DPPOXQJ152EHUED\HUQHUZRUEHQLQGHQHU -DKUHQDXVGHU6DPPOXQJ=LPPHUPDQQ0©QFKHQ /DUJHVWHPPHGERZOZLWKWZRKDQGOHVRIWKH%LFKURPH,9:DUH(DVWHUQ 0HGLWHUUDQHDQ%&/LWWOHVSOLQWHUVRIWKHULPDQGIRRWDUHPLVVLQJ

66 =ZHL HLQKHQNHOLJH .DQQHQ *ULHFKLVFK ¤VWOLFKHU 0LWWHOPHHU UDXPD .OHLQH.DQQHGHU5HG3ROLVKHG:DUHPLWJUDYLHUWHP 'HNRUY&KU+FPkFP$XI+DOVXQG .¤USHU =LFN]DFNOLQLHQ ]ZLVFKHQ ZDDJHUHFKWHQ /LQLHQE©QGHOQ ,P REHUHQ %HUHLFK PHKUIDFK JHEURFKHQ XQG ZLHGHU ]XVDP PHQ JHVHW]W GDEHL HLQH ZLQ]LJH )HKOVWHOOH DP 0©QGXQJVUDQG E .DQQHGHU:KLWH3DLQWHG:DUHPLWEUDXQHU%HPDOXQJ

62

Y&KU+FPkFP$XIGHP.¤USHUDEZHFK VHOQG)HOGHUPLW1HW]PXVWHUXQGVHQNUHFKWHQ/LQLHQPLWDOWHU QLHUHQGHU )©OOXQJ :LQ]LJH $EVSOLWWHUXQJHQ DQ GHU 0©QGXQJ VRQVWLQWDNW6W©FN u 3URYHQLHQ]$XVGHU6DPPOXQJ152EHUED\HUQHUZRUEHQLQGHQHU -DKUHQDXVGHU6DPPOXQJ=LPPHUPDQQ0©QFKHQ 7ZRRQHKDQGOHMXJV*UHHN(DVWHUQ0HGLWHUUDQHDQD 6PDOOMXJRIWKH5HG 3ROLVKHG:DUHZLWKHQJUDYHGGHFRU%&2QQHFNDQGFRUSXV ]LJ]DJRUQDPHQWEHWZHHQEXQFKHVRIKRUL]RQWDOOLQHV7KHXSSHUSDUWLVEURNHQ VHYHUDOWLPHVDQGUHDVVHPEOHGRQO\RQHWLQ\VSOLQWHURIWKHULPLVPLVVLQJE  -XJRJWKH:KLWH3DLQWHG:DUHZLWKEURZQSDLQWLQJ%&2QWKH FRUSXVDOWHUQDWLQJ}HOGVZLWKQHWGHFRUDQGYHUWLFDOOLQHVZLWKSDUWLDOO\}OOHG LQWHUVSDFHV7LQ\VSOLQWHUVRIWKHPRXWKDUHPLVVLQJRWKHUZLVHLQWDFW2 pieces!




68

 .RULQWKLVFKHU$PSKRULVNRVGHV$PSHUVDQG0DOHUV0LWWHONRULQ WKLVFKY&KU+FPkFPk)XgFP 6FKZDU]}JXULJ'HWDLOVLQ5RW$XI6FKXOWHUXQG%DXFKMHHLQ 7LHUIULHV$XIGHU6FKXOWHU3DQWKHUXQG6FKZDQDXIGHP%DXFK =LHJHQERFN ]ZLVFKHQ ]ZHL 3DQWKHUQ LQ GHQ =ZLVFKHQU”XPHQ 3XQNWHXQG5RVHWWHQEHUGHP)Xg6WUDKOHQNUDQ].OHLQH$E VSOLWWHUXQJHQ DQ 0©QGXQJ XQG )Xg *ODQ]WRQ DP )Xg HWZDV EHULHEHQ u 3URYHQLHQ]$XVGHQHKHPDOLJHQ5HVWEHVW”QGHQGHU0©QFKQHU0©Q]KDQGOXQJ .DUO.UHVVHUZRUEHQYRU =XP0DOHUV'$$P\[&RULQWKLDQ9DVH3DLQWLQJRIWKH$UFKDLF3HULRG  6IIPLW7DI &RULQWKLDQ EODFN}JXUH DPSKRULVNRV RI WKH $PSHUVDQG 3DLQWHU 0LGGOH &RULQWKLDQ%&2QVKRXOGHUDQGEHOO\WZRDQLPDOIULH]HVRQWKH VKRXOGHUSDQWKHUDQGVZDQRQWKHEHOO\JRDWEHWZHHQWZRSDQWKHUV/LWWOH VSOLQWHUVRIPRXWKDQGIRRWDUHPLVVLQJWKHEODFNJOD]HRIWKHIRRWLVSDUWLDOO\ UXEEHGRII

68 .RULQWKLVFKH 'UHLIXg3\[LV PLW 'HFNHO YLHOOHLFKW (PSHGRFOHV 0DOHU6S”WNRULQWKLVFKY&KU+PLWRKQH'HFNHO FPkFPk'HFNHOFP6FKZDU]}JXULJ$XI GHP'HFNHO7LHUIULHV6HLWOLFKHLQHUGRSSHOWHQ/RWXVEO©WHMHHLQH 6LUHQH HLQ 3DQWKHU HLQ 6WLHU OLQNV  RGHU (EHU UHFKWV  VRZLH HLQ 3DQWKHU $XI GHP .QDXI HLQH 5RVHWWH $XI GHQ GUHL %HL QHQMHZHLOVJHJHQVW”QGLJD ]ZHL6SKLQJHQE ]ZHL3DQWKHUXQG F ]ZHL6WLHUHZREHLGHUUHFKWHQXU]XU+”OIWHZLHGHUJHJHEHQ LVW:HQLJHZLQ]LJH$EVSOLWWHUXQJHQDQ6FKDOHQUDQGXQG'HN NHO)DUEHVWHOOHQZHLVHDEJHULHEHQ]ZLVFKHQGHQ)©gHQXQGDXI GHP%RGHQVWDUNH6LQWHUUHVWH u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ7/6DFKVHQHUZRUEHQFDDXV alter Berliner Sammlung. 9JO'$$P\[&RULQWKLDQ9DVH3DLQWLQJRIWKH$UFKDLF3HULRG  6 IPLW7DI &RULQWKLDQEODFN}JXUHWULSRGS\[LVZLWKOLGSHUKDSVWKH(PSHGRFOHV3DLQWHU /DWH&RULQWKLDQ%&2QWKHOLGDQLPDOIULH]H,QWKHPLGGOHD GRXEOHORWXVEXGWROHIWDQGULJKWVLUHQVSDQWKHUVEXOO OHIW RUERDU ULJKW  DQG}QDOO\DSDQWKHU2QWKHWKUHHIHHWD WZRVSKLQJHVE WZRSDQWKHUV DQGF WZREXOOV2QO\IHZWLQ\VSOLQWHUVRIWKHULPDQGDWWKHOLGDUHPLVVLQJ FRORULVSDUWLDOO\UXEEHGRIIEHWZHHQWKHIHHWDQGXQGHUQHDWKUHVWRIVLQWHU

63


69



69 =ZHLNRULQWKLVFKH.XJHODU\EDOORL)U©KNRULQWKLVFKY &KU 6FKZDU]}JXULJ 'HWDLOV LQ 5RW D  + FP k FP $XI &RUSXV7LHUIULHVPLW=LHJHQERFN]ZLVFKHQ/¤ZHXQG3DQWKHU E  + FP k FP $XI &RUSXV 7LHUIULHV PLW =LHJHQERFN ]ZLVFKHQ6WHLQNDX]XQG/¤ZH6W©FN%HPDOXQJDQZHQLJHQ NOHLQHQ6WHOOHQHWZDVYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ+:HUZRUEHQLP0Â&#x201D;U] DXVGHU6DPPOXQJ6FKHOOLQJHUKRXW 7ZR(DUO\&RULQWKLDQEODFN}JXUHDU\EDOORV%&D *RDWEHWZHHQ OLRQDQGSDQWKHUE *RDWEHWZHHQRZODQGOLRQ6XUIDFHDWIHZVSRWVVOLJKWO\ UXEEHGRIIRWKHUZLVHLQWDFW2 pieces!

 $U\EDOORV LQ +DVHQIRUP 0LWWHONRULQWKLVFK    Y &KU + FP / FP %HLJHU 7RQ PLW GXQNHOEUDXQHU %HPDOXQJ $QJDEH YRQ 2KUHQ $XJHQ XQG 1DVH )HOO LQ VHQNUHFKWHQ /LQLHQ JHSXQNWHW /Â&#x201D;XIH JDQ] EHPDOW DXI GHU 8QWHUVHLWH HLQ :LQNHOPÂ&#x201D;DQGHU =ZHL DQWLNH REHU~Â&#x201D;FKLJH $ESODW]XQJHQ DP +LQWHUWHLOVRQVWLQWDNW u 3URYHQLHQ]$XVGHU6DPPOXQJ152EHUED\HUQHUZRUEHQLQGHQHU -DKUHQLP0©QFKQHU.XQVWKDQGHO 9JO6%¤KP.RULQWKLVFKH)LJXUHQYDVHQ  61U+PLW$EE  )LJXUDODU\EDOORVLQIRUPRIDO\LQJKDUH0LGGOH&RULQWKLDQ%& %HLJHFOD\ZLWKGDUNEURZQSDLQWLQJ7ZRVSOLQWHUVRIWKHUHDUDUHFKLSSHG RIIGXULQJWKHSURGXFWLRQLQDQFLHQWWLPHVRWKHUZLVHLQWDFW

 ,WDORJHRPHWULVFKH.OHHEODWWNDQQH6XEJHRPHWULVFKY &KU %DXFKLJH .DQQH PLW .OHHEODWWP©QGXQJ NRQLVFKHP +DOV XQGSUR}OLHUWHP+HQNHO+FP+HOOEUDXQHU7RQPLWURW EUDXQHU%HPDOXQJ$XIGHP+DOV6WUDKOHQNUDQ]DXI6FKXOWHUX &RUSXV /LQLHQGHNRU $XI GHU 6FKXOWHU ZHLWHUKLQ HLQ )ULHV PLW VWLOLVLHUWHQ7LHUHQ 9¤JHO" (LQVWDELOLVLHUWHU6SDQQXQJVULVVLQ WDNW u 3RUYHQLHQ]$XVGHU6DPPOXQJ'U9=6FKZHL]HUZRUEHQLQGHQHU ELVHU-DKUHQYRQELVDOV/HLKJDEHLQGHU$UFKÂ&#x201D;RORJLVFKHQ 6DPPOXQJ GHU 8QLYHUVLWÂ&#x201D;W =©ULFK ]X $XVVWHOOXQJV]ZHFNHQ H[ *RUQ\  0RVFK$XNWLRQ-XQL/RV([6OJ$00LWWHOGHXWVFKODQG ,WDORJHRPHWULFMXJ6XEJHRPHWULF%&2QWKHVKRXOGHUDIULH]H ZLWKVW\OL]HGDQLPDOVSHUKDSVELUGV2QHFUDFNLVVWDELOL]HGRWKHUZLVHLQWDFW

 (WUXVNRNRULQWKLVFKH2OSH*UXSSHGHUSK¤QLNLVFKHQ3DOPHWWHQ Y&KU.DQQHPLWJHUDGHU0©QGXQJXQG]ZHL5RWHO OHQVHLWOLFKGHV+HQNHOV+FPkFP'HWDLOVLQ:HLg XQG5RW9RQXQWHQQDFKREHQHLQ6WUDKOHQNUDQ]+DOENUHLVH SK¤QL]LVFKH3DOPHWWHQXQGDXIGHU6FKXOWHU=XQJHQVWDE.OHLQH )HKOVWHOOHDP)Xg2EHU~Â&#x201D;FKHWHLOZHLVHYHUULHEHQ u 3URYLQLHQ] ([ 6DPPOXQJ $0 0LWWHOGHXWVFKODQG HUZRUEHQ LP 0Â&#x201D;U] EHL'DQLHO0H\HU/DHU,QKDEHUYRQ'DQLHO0H\HU$QWLTXLWÂ&#x201D;WHQXQG $XNWLRQHQ0©QVWHUHUZRUEHQ =XU*UXSSHGHUSK¤QLNLVFKHQ3DOPHWWHQV0%HQW] +UVJ 5DVQD'LH (WUXVNHU$XVVWHOOXQJ%RQQ  61U (WUXVFRFRULQWKLDQROSHRIWKH*URXSRIWKH3KRHQLFLDQ3DOPHWWHV W\SHRI SRO\FKURPH SDLQWHG YDVHV     %& /LWWOH IUDJPHQW RI WKH IRRW LV PLVVLQJVXUIDFHSDUWLDOO\UXEEHGRII

64


71

73

72

73 Daunisches Thymiaterion. Subgeometrisch III, frühes 3. Jh. v. &KU+RKHU6WÂ&#x201D;QGHUYRP7\SXV$PLWSUR}OLHUWHP)Xg]ZHL ZHLWHUHQ3UR}OHQXQG6FKDOHQDXIVDW]+FPkGHU6FKDOH FP%HLJHU7RQPLWGXQNHOEUDXQHU%HPDOXQJ9HUZHQGXQJ YRQURWHUXQGURVD)DUEH9RQXQWHQQDFKREHQ:HOOHQEDQG 5DXWHQPXVWHU :HOOHQEDQG +DNHQPÂ&#x201D;DQGHU /RUEHHU]ZHLJ (IHXUDQNH(LHUVWDE*LWWHUPXVWHUXQG:HOOHQEDQG,P6FKDOHQ EHFNHQYLHUEOÂ&#x201D;WWULJH5RVHWWHGDUXPDXIGHP5DQG:HOOHQEDQG ,P REHUHQ 7HLO JHEURFKHQ XQG ZLHGHU DQJHVHW]W VRQVW EHVRQ GHUVKLQVLFKWOLFKGHU)DUEHQJXWHUKDOWHQ u

3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ:HVWIDOHQHUZRUEHQ]ZLVFKHQ ELVDXVGHU6DPPOXQJ-RVHI:LQWHU 'DXQLDQ WK\PLDWHULRQ 6XEJHRPHWULF ,,, HDUO\ UG FHQWXU\ %& %HLJH FOD\ZLWKGDUNEURZQSDLQWLQJDQGUHGDQGSLQNFRORU6HYHUDOIULH]HVZLWK RUQDPHQWDOGHFRUOLNHEDQGVRIZDYHVODXUHOLY\DQGHJJDQGGDUW,QVLGHWKH ERZORQWKHWRSDIRXUOHDIURVHWWH%URNHQDWWKHXSSHUSDUWDQGUHDWWDFKHG RWKHUZLVHLQJRRGFRQGLWLRQZLWKIUHVKORRNLQJFRORUV

65


 Peuketischer Krater. Subgeometrisch, Y&KU+FP%FP k FP k 0©QGXQJ FP +HOOEUDXQHU WHLOZHLVH U¤WOLFKHU 7RQ PLW GXQNHOEUDXQHU %HPDOXQJ $XI 6FKXOWHU %DXFK XQG +HQNHOQ ]DKO UHLFKH/LQLHQXQG)HOGHUGD]ZLVFKHQ XQGGDULQ2UQDPHQWHZLHVFKUDI}HU WH 5DXWHQ XQG 'UHLHFNH VRZLH HLQH =LFN]DFNOLQLH $XI GHP 0©QGXQJV UDQGUXQGH6HJPHQWHLQWHLOXQJHQXQG NOHLQH 'UHLHFNH 0LW 7/$QDO\VH Je HLQH$EVSOLWWHUXQJDQ0©QGXQJXQG )XgVRQVWLQWDNWPLW6LQWHUUHVWHQ u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDW VDPPOXQJ:5JHNDXIWDXVGHUQLH GHUUKHLQLVFKHQ 3ULYDWVDPPOXQJ 03 YRQ GHVVHQ9DWHULQGHQHUHU-DKUHQ HUZRUEHQ



3HXFHWLDQ NUDWHU ZLWK JHRPHWULF GHFRU 6XEJHRPHWULF%&$OLWWOHIUDJPHQW RIWKHULPDQGWKHIRRWDUHPLVVLQJRWKHUZLVH LQWDFWZLWKVLQWHU:LWK7/DQDO\VLV

75 5HOLHIDPSKRUD +HOOHQLVWLVFK .OHLQD VLHQ+”OIWH-KY&KU+FP kFPk0©QGXQJFP0D WUL]HQJHIRUPW 5¤WOLFKHU 7RQ PLW GXQNHOEUDXQHPEHU]XJ,PXQWHUHQ 9LHUWHO (LHUVWDE WURSIHQI¤UPLJH %O© WHQXQGXQWHQHLQ)ULHVDXV%OXPHQ %O”WWHUQ XQG %”XPHQ $XI GHP %R GHQHLQH5RVHWWH$QZHQLJHQ6WHOOHQ OHLFKWYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDW VDPPOXQJ:5JHNDXIWDXVGHUQLH GHUUKHLQLVFKHQ 3ULYDWVDPPOXQJ 03 YRQ GHVVHQ9DWHULQGHQHUHU-DKUHQ HUZRUEHQ *UHHNDPSKRUDZLWKPRXOGIRUPHGGHFRULQ IRUPRIHJJDQGGDUWGURSVKDSHGEORVVRPV DQGDIULH]HZLWK~RZHUVOHDYHVDQGWUHHV2Q WKHERWWRPDURVHWWH+HOOHQLVWLF$VLD0LQRU QGKDOIQGFHQWXU\%&6OLJKWO\UXEEHGDW IHZVSRWVRWKHUZLVHLQWDFW

75

66


 77

 +HOOHQLVWLVFKHU%HFKHU,WDOLHQ-KY&KU+FPk 0©QGXQJFP%DUERWLQHWHFKQLN5¤WOLFKHUEUDXQHU7RQPLW GXQNHOEUDXQHP EHU]XJ 8QWHU GHU /LSSH NOHLQH 0HGDLOORQV GDUXQWHU*LUODQGHQ©EHUHLQHPSODVWLVFKHQ:XOVWMit Echtheits EHVW”WLJXQJGHU*DOHULH*©QWHU3XK]H .RSLH XQG=HUWL}NDWYRQ 7KH$UW/RVV5HJLVWHU(LQ5DQGIUDJPHQWJHEURFKHQXQGZLHGHU DQJHVHW]WVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ$%DGH%D\HUQHUZRUEHQEHLGHU*DOHULH*©QWHU 3XK]H)UHLEXUJL%UHKHPDOV6DPPOXQJ&RWWLHU$QJHOL*HQIHUZRUEHQLQ GHQHU-DKUHQ +HOOHQLVWLFEHDNHU,WDO\QGFHQWXU\%&%DUERWLQHWHFKQLTXH5HGEURZQ FOD\ZLWKGDUNEURZQVOLS%HORZWKHOLSWKUHHPHGDOOLRQVDQGDJDUODQGRYHU DSODVWLFWRUXV2QHULPIUDJPHQWLVEURNHQDQGUHDWWDFKHGRWKHUZLVHLQWDFW :LWKFHUWL}FDWHVRIWKH*DOHULH*©QWHU3XK]HDQG7KH$UW/RVV5HJLVWHU FRSLHV 

77 )ODVFKHPLW5HOLHIGHNRU5¤PLVFKH.DLVHU]HLWFDQ &KU=\OLQGULVFKHHLQKHQNHOLJH)ODVFKHGHU)RUPPLW+DOV LQ *HVWDOW HLQHV )UDXHQNRSIHV + FP k FP )RUPJH W¤SIHUW6HLWH$PLW]ZHL5HJLVWHUQREHQ'LRQ\VRVJHVW©W]WYRQ ]ZHL 6DW\UQ OLQNV HLQ 6LOHQ GDUXQWHU $ULDGQH UHFKWV YRQ LKU +DVHQMDJG]X3IHUGHXQWHQGUHLUHLWHQGH(URWHQ6HLWH%PLW GUHL5HJLVWHUQREHQ$SKURGLWH]ZLVFKHQ]ZHLVLW]HQGHQ(URWHQ UHFKWV$UWHPLVPLW%RJHQLQGHU0LWWHXQGXQWHQ+DVHQMDJG]X 3IHUGH-HZHLOVOLQNVDP%LOGUDQGHLQ=ZHLJ+HQNHOJHEURFKHQ XQGZLHGHUDQJHVHW]WVRQVWLQWDNW u 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ HUZRUEHQDXVGHP1DFKODVVHLQHV=DKQDU]WHV 5RPDQSRWWHU\ERWWOHZLWK}JXUDOGHFRURIIRUPZLWKF\OLQGULFDOFRUSXVDQG QHFNLQIRUPRIZRPDQhVKHDG$ERXW$'0RXOGIRUPHG2Q VLGH$'LRQ\VRVVXSSRUWHGE\WZRVDW\UVWRWKHOHIW6LOHQDQGEHORZ$ULDGQH 7RWKHULJKWRI$ULDGQHDKXQWLQJVFHQHZLWKKRUVHPDQGRJDQGKDUHVLQ WKHORZHU}HOGWKUHHULGLQJFXSLGV2QVLGH%DERYH$SKURGLWHEHWZHHQWZR VHDWHGFXSLGVRQWKHULJKW$UWHPLVZLWKERZLQWKHPLGGOHDQGORZHU}HOG KXQWLQJVFHQHVZLWKKRUVHPHQGRJVDQGKDUHV+DQGOHEURNHQDQGUHDWWDFKHG RWKHUZLVHLQWDFW

67


 0RGHO I©U VSÂ&#x201D;WDQWLNH )ODVFKH PLW 5HOLHI 1RUGDIULND    -K Q &KU[FP*LSVPRGHOI©U HLQH KRKH ]\OLQGULVFKH )ODVFKH PLWODQJHP+DOV)ODVFKHQN¤USHU LQ ]ZHL YHUWLNDOH )HOGHU JHWHLOW LP OLQNHQ YLHU )UDXHQE©VWHQ PLW +DOVNUDJHQLPUHFKWHQ]ZLVFKHQ ]ZHL )UDXHQE©VWHQ HLQ ODXIHQGHU +XQGPLWHLQHP+DVHQGDUXQWHU HLQ PÂ&#x201D;QQOLFKHU .RSI RKQH +DOV NUDJHQ $XI GHU 6FKXOWHU 6WULFK GHNRU .OHLQH $EVSOLWWHUXQJHQ VRQVWLQWDNW u



3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ:5JHNDXIWDXV GHU QLHGHUUKHLQLVFKHQ 3ULYDWVDPPOXQJ 03 YRQ GHVVHQ 9DWHU LQ GHQ HU HU-DKUHQHUZRUEHQ 3DUWRIDJ\SVXPPRGHORID/DWH5RPDQ WHUUDFRWWDERWWOHZLWKUHOLHI1RUWK$IULFD WK  WK FHQWXU\ $' 6PDOO VSOLQWHUV PLVVLQJRWKHUZLVHLQWDFW

 5¤PLVFKH 3LOJHU~DVFKH    -K Q &KU + FP %  7 FP 5RWEUDXQHU 7RQ %HLGVHL WLJ DXV GHU JOHLFKHQ 0DWUL]H JH IRUPW HLQ JURgHV 0HGDLOORQ $P 5DQG XPODXIHQG HLQ /RUEHHU EDQG ,Q GHU 0LWWH 'LRQ\VRV PLW 7K\UVRV XQG $ULDGQH PLW .LWKD UD YRU HLQHU JURgHQ :HLQUDQNH $P REHUHQ 5DQG VWHKW D ,21< &2& XQG $D+ :HQLJH ZLQ]L JH%HVWRgXQJHQVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV 9JO ]XP %HLVSLHO GLH 'DUVWHOOXQJ DXI GHP VSÂ&#x201D;WKHOOHQLVWLVFKHQ 0DUPRUNUDWHU %RUJKHVHLP/RXYUH ,QY0$ 



68

5RPDQSLOJULP~DVNPDGHRIUHGEURZQ FOD\UGWKFHQWXU\$'2QERWKVL GHVIURPWKHVDPHPRXOGDODUJHWRQGR ,QVLGH'LRQ\VRVZLWKWK\UVRVDQG$ULDGQH ZLWKNLWKDUDLQIURQWRIDODUJHJUDSHYLQH VWRFN1H[WWRWKHLUKHDGVWKHLQVFULSWLRQV D,21<&2&DQGADH)HZWLQ\VSOLQ WHUVRIWKHVXUIDFHDUH~DNHGRIIRWKHUZLVH LQWDFW




 7HUUD 6LJLOODWD6FKDOH PLW 5HOLHIGHNRU *DOOLHQ    -K Q &KU +  FP k  FP 7HUUD 6LJLOODWD )RUPJHW¤SIHUW +RFKZDQGLJHXQWHQDEJHUXQGHWH6FKDOH PLWNOHLQHPQLHGULJHQ6WDQGULQJXZXO VWLJHU /LSSH 'UDJHQGRUII   'HU XP ODXIHQGH )ULHV ]HLJW DEZHFKVHOQG HLQHQ +DKQXQWHUHLQHP+DOENUHLVZREHLHLQ PDOGHU.UHLVXPGHQ+DKQJHVFKORVVHQ LVWXQGHLQHQDXVVFKUHLWHQGHQ0DQQPLW ZHKHQGHP8PKDQJYRUHLQHU6Â&#x201D;XOH0LW 7¤SIHUVWHPSHO 0LW5HFKQXQJ .RSLH  Ei QLJHIHLQH5LVVHLQGHU6FKDOHQZDQGYHU HLQ]HOW$EVSOLWWHUXQJHQVRQVWLQWDNW u 3URYHQLHQ](UZRUEHQEHL0©Q]KDQGOXQJ=ODWNR 3OHVDLQ)UDQNIXUWLP-DKU 0RXOGPDGH WHUUD VLJLOODWD ERZO ZLWK VPDOO ULQJIRRW3URYLQFHRI*DXOVWUGFHQWXU\$' 7KHURWDU\IULH]HVKRZVDOWHUQDWLQJDURRVWHUDQG DPDQZLWKDEORZLQJFORDNLQIURQWRIDFROXPQ :LWK SRWWHU VWDPS )LQH }VVXUHV DQG WKH UHG VOLS SDUWLDOO\ VOLJKWO\ FKLSSHG :LWK FRS\ RI WKH LQYRLFH

 5¤PLVFKHV *HIÂ&#x201D;g LQ )RUP HLQHV )UDXHQ NRSIHV1RUGDIULNDFDQ&KU + FP 6RJ $IULFDQ 5HG 6OLS :DUH $56  DXV GHU :HUNVWDWW GHV 1DYLJLXV 7HUUD 6LJLOODWD )RUPJHW¤SIHUW +RKHV *HIÂ&#x201D;gDXI~DFKHP6WDQGIXgGHU&RUSXV LQ )RUP GHV .RSIHV HLQHV MXQJHQ 0Â&#x201D;G FKHQV PLW HODERULHUWHU =RSIIULVXU REHQ HLQ ]\OLQGULVFKHU OHLFKW NRQLVFKHU +DOV DXIGHU5©FNVHLWHHLQJHULIIHOWHU%DQGKHQ NHO$XIGHP+DOVHLQHGUHL]HLOLJH:HUN VWDWWDQJDEH (; 2),&, QD   1$9 LQ /LJDWXU 2,5(6,60LQLPDOH%HVWR gXQJDP6WDQGVRQVWLQWDNW u



69


3URYHQLHQ] ([ 6DPPOXQJ 03 %DGHQ :©UWWHPEHUJ VHLW HU -DKUHQ HUZRUEHQ EHL *DOHULH.+=©KOHQGRUI.¤OQ 0LW 5HFKQXQJ I©U HLQH 7/$QDO\VH YRQ  YRQGHU8QLYHUVLW”W2[IRUGXQG7/$QDO\VHYRQ YRP/DERU5DOI.RWDOOD 5RPDQ PRXOGPDGH RQHKDQGOH }JXUH ERWWOH RI UHGFOD\ZLWKUHGVOLSLQIRUPRID\RXQJZRPDQ ZLWKHODERUDWHKDLUVW\OH}UPPDUNRQWKHQHFN 7HUUDVLJLOODWD$IULFDQ5HG6OLS:DUH $56 RI WKH :RUNVKRS RI 1DYLJLXV 1RUWK $IULFD DERXW $'7LQ\FKLSDWWKHERWWRPRWKHUZLVH LQWDFW:LWKLQYRLFHIRUD7/DQDO\VLVIURP RIWKH2[IRUG8QLYHUVLW\DQG7/DQDO\VLVIURP RIWKHODERUDWRU\5DOI.RWDOOD

 )O”VFKFKHQ LQ )RUP HLQHV .DOEVNRSIHV 5¤PLVFK  -K Q &KU + FP % FP 'RSSHOKHQNHOJHI”g DXV EHLJHP 7RQPLWEUDXQHPEHU]XJ,QWDNW u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ   /RV  DXV GHU 3ULYDWVDPPOXQJ ,1 %HUOLQHUZRUEHQLQHU-DKUHQ 

'RXEOHKDQGOHG~DVNLQIRUPRIWKHKHDGRIDFDOI %HLJH&OD\ZLWKEURZQVOLS5RPDQVWFHQWXU\ $',QWDFW



70


7(55$.277$6.8/3785



 7DQDJU”HULQwPLW)DUEVSXUHQ7DQDJUD-KY&KU7HUUDNRWWD +FP6WDWXHWWHHLQHUMXQJHQ)UDXGLHHLQHQUHLFKJHI”OWHOWHQ &KLWRQWU”JWGDU©EHUHLQHQJDQOLHJHQGHVXQG©EHUEHLGH$UPH GUDSLHUWHV+LPDWLRQ'LH*HZ”QGHU]HLJHQ6SXUHQYRQKHOOEODX HQ XQG URVD )DUEUHVWHQ 'HU UHFKWH $UP LVW DQJHZLQNHOW XQG

LQGHU+DQGK”OWVLHHLQHQUXQGHQ*HJHQVWDQGGHUQRFKVWDUN U¤WOLFKJHI”UEWLVW'HUOLQNH$UPOLHJWHQJDP.¤USHUDQXQG GLH OLQNH +DQG GLH KDOE YRP 0DQWHOVDXP YHUERUJHQ LVW K”OW HLQHQ EODWWI¤UPLJHQ )”FKHU 'HU &KLWRQ KDW HLQHQ 9I¤UPLJHQ +DOVDXVVFKQLWWRIIHQEDUWHLQH.HWWHXQGGHQIUHLOLHJHQGHQ+DOV

71




'DV +DDU LVW LQ JHGUHKWHQ /RFNHQ]XQJHQ JHRUGQHW XQG LQ HL QHP'XWW]XVDPPHQJHKDOWHQ'DU©EHUWUÂ&#x201D;JWVLHHLQHQKHOOEODX HQ .UDQ] PLW URVDIDUEHQHQ 2UQDPHQWHQ DQ 6WLUQ XQG 2KUHQ 'LH*HVLFKWV]©JHVLQGPLWURWHU%HPDOXQJDQJHGHXWHW%HVWHQV HUKDOWHQH)DUEUHVWH.RSIZLHGHUDQJHVHW]W%UHQQORFKDP5© FNHQ u 3URYHQLHQ](UZRUEHQFDEHL0 0%DVHO 7HUUDFRWWD7DQDJUD}JXULQHZLWKFRORXUWUDFHV7DQDJUDUGFHQWXU\%& 6KHLVGUHVVHGLQDQHOHJDQWO\GUDSHGFKLWRQDQGKLPDWLRQ%RWKKDYHWUDFHV RIOLJKWEOXHDQGOLJKWSLQN7KHULJKWKDQGLVKROGLQJDURXQGREMHFWWKHOHIW RQHLVKROGLQJDIDQLQWKHIRUPRIDOHDI6KHZHDUVKHUKDLULQDEXQZLWKD FKDSOHWZLWKRUQDPHQWV7KHIDFHLVSDLQWHGZLWKUHGFRORXU:HOOSUHVHUYHG WUDFHVRIFRORXUKHDGUHDWWDFKHGEXUQLQJKROHLQWKHEDFN

72

 6FKDXVSLHOHU DOV +HWÂ&#x201D;UH *ULHFKHQODQG  -K Y &KU +HOOURWH 7HUUDNRWWD+FP9ROOSODVWLVFKHV%LOGQLVHLQHV6FKDXVSLH OHUVGHU.RP¤GLHLQGHU5ROOHHLQHUDOWHQGLFNEÂ&#x201D;XFKLJHQ)UDX PLWODQJHPEUDXQHQ+DDUGLHLPHURWLVFKHQ*HVWXVHLQHVMXQ JHQ0Â&#x201D;GFKHQVLKUHQ0DQWHOO©IWHW$XIGHP+LQWHUNRSIHLQU¤W OLFKHV ~DPPHQÂ&#x201D;KQOLFKHV 2EMHNW 0LW 7/$QDO\VH 2EHU~Â&#x201D;FKH HWZDVEHULHEHQVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ'U601LHGHUED\HUQVHLWGHQHU-DKUHQ 7HUUDFRWWD}JXULQHRIDQDFWRURIWKH&RPHG\GLVJXLVHGDVDQROGZRPDQ SUREDEO\DKHWDLUDOLIWLQJKHUPDQWOHLQDQHURWLFJHVWXUH*UHHNWKFHQWXU\ %&6OLJKWO\ZRUQVXUIDFHRWKHUZLVHLQWDFW:LWK7/$QDO\VLV




 Reiter. 5¤PLVFK  -K Q &KU + FP % FP 7 PD[ FP'XQNHOEUDXQHU7RQKHOOEUDXQHUEHU]XJ0DWUL]HQJH IRUPW5©FNVHLWHJHUXQGHWPLWUXQGHP%UHQQORFK(LQHP”QQOL FKH)LJXUEHNOHLGHWPLWNQLHODQJHU7XQLNDVLW]WDXIHLQHP3IHUG XQGK”OWGLH=©JHO6HLQ*HVLFKWLVWGHP%HWUDFKWHU]XJHZDQGW DXI GHP .RSI WU”JW HU HLQH UXQGH .RSIEHGHFNXQJ .LQQ XQG 1DVHEHULHEHQDXIGHU5©FNVHLWHwLQEODXJUDXHU)DUEH u

3URYHQLHQ]([3ULYDWEHVLW]6.3DULV(UZRUEHQEHL-HDQ0DUF'HOYDX[ 1DFKODVVYHUVWHLJHUXQJ1DFKGHU=XULFKWXQJDOWHIUDQ]¤VLVFKH3ULYDWVDPP OXQJPLQGHU-DKUH 0DOH}JXUHZLWKWXQLFDULGLQJRQDKRUVH5RPDQVWFHQWXU\$'&KLQDQG QRVHZRUQDWWKHEDFNVLGHWKHQXPEHULQEOXHJUH\FRORXU

73






 )UDXHQ}JXUPLW%HFKHUVWOLFKHU0LWWHOPHHUUDXP-KY &KU %HLJHU 7RQ PLW ]DKOUHLFKHQ %HPDOXQJVUHVWHQ + FP 6WHKHQGH ZHLEOLFKH *HVWDOW LQ ODQJHP *HZDQG XQG PLW 5DX SHQRKUULQJHQ GHU UHFKWH $UP LVW DQJHZLQNHOW 'LH +DQG K”OW HLQHQDQGHU6FKXOWHUDXIJHOHJWHQ%HFKHU*HNOHEWHU%UXFKDQ GHU+©IWHUHFKWHU)XgZLHGHUDQJHVHW]W2EHU~”FKHLPXQWHUHQ %HUHLFKWHLOZHLVHDEJHSODW]W u 3URYHQLHQ]([6DPPOXQJ(+6©GGHXWVFKODQGYRU $IHPDOHWHUUDFRWWD}JXULQHLQORQJGUHVVKROGLQJDEHDNHULQKHUULJKWKDQG (DVWHUQ0HGLWHUUDQHDQ$UFKDLF3HULRGWKWKFHQWXU\%&7UDFHVRI FRORUUHDVVHPEOHGDWEHOO\ULJKWIRRWUHDWWDFKHGSDUWRIWKHVXUIDFHDWWKH ORZHUSDUWUXEEHGRII

 %UHWWLGRO%¤RWLHQY&KU+FP%FP+HOO EUDXQHU 7RQ %HPDOXQJ LQ 'XQNHO XQG 5RWEUDXQ )ODFKHU EUHWWDUWLJHU .¤USHU PLW $UPVWXPPHOQ GHU QDFK XQWHQ HWZDV DXVVFKZLQJW $XI GHP ODQJHQ +DOV VLW]W HLQ YRJHODUWLJHU .RSI PLW3RORVXQGODQJHP+DDU.OHLQH)HKOVWHOOHDP3RORVVRQVW LQWDNWPLWJXWHUKDOWHQHQ)DUEHQ u 3URYHQLHQ]$XVGHU6DPPOXQJ152EHUED\HUQHUZRUEHQLQGHQHU -DKUHQLP0©QFKQHU.XQVWKDQGHO )ODWLGROZLWKVKRUWDUPVDQGDELUGOLNHIDFHZLWKSRORV%ULJKWEURZQFOD\ ZLWKEURZQDQGUHGGLVKSDLQWLQJ%RHRWLD%&/LWWOHIUDJPHQWDW WKHSRORVLVPLVVLQJRWKHUZLVHLQWDFWZLWKZHOOSUHVHUYHGFRORUV



 $IIH %¤RWLVFKJHRPHWULVFK  +”OIWH  -K Y &KU + FP $XV KHOOEHLJHP 7RQ PLW U¤WOLFKHU 6WUHLIHQEHPDOXQJ 0LW %H VFKUHLEXQJGHVHKHPDOLJHQ%HVLW]HUV(UJ”Q]XQJUHFKWVDP.RSI JHNOHEWHU%UXFKDPOLQNHQ$UPXQG%HLQ u 74


3URYHQLHQ] ([ 6DPPOXQJ 3URI +( +HVVHQ HUZRUEHQ  %HL *RUQ\  0RVFK$XNWLRQ/RV 'LH )LJXU VWHOOW ZDKUVFKHLQOLFK HLQH 0HHUNDW]H GDU GLH ]% DXFK LQ GHU DUFKDLVFKHQ 1XPLVPDWLN DOV %LOGPRWLY ]X }QGHQ LVW 9JO 5$ +LJJLQV *UHHN 7HUUDFRWWDV  7DI' %RHRWLDQ WHUUDFRWWD }JXUH RI DQ DSH JXHQRQ" VWKDOIWKFHQWXU\%&/HIW DUPDQGIRRWUHDWWDFKHGSDUWDWWKHULJKW VLGHRIWKHKHDGUHVWRUHG

 0DXOWLHU 5¤PLVFKH .DLVHU]HLW  -KQ&KU+HOOURWH7HUUDNRW WD + FP % FP $XI HLQHU TXDGHUI¤UPLJHQ %DVLV VWHKHQGHV 0DXOWLHU PLW DQJHOHJWHQ 2KUHQ XQG 6DWWHOGHFNH 6LQWHU©EHU]XJ DQ GHU 9RUGHUVHLWH DXVJHEURFKH QHV)HOG]ZLVFKHQGHQ%HLQHQ u 3URYHQLHQ] ([ 1DFKODVV .DULQ .RUWH %D\HUQGDYRU)DPLOLHQEHVLW]LQ'HXWVFK ODQGVHLWGHQHU-DKUHQ



5RPDQ WHUUDFRWWD PXOH ZLWK VDGGOH EODQNHW VW  UG FHQWXU\ $' 3DUW RI WKHVXUIDFHEHWZHHQWKHOHJVEURNHQRXW 6LQWHUHG

 0RGHO I©U HLQ U¤PLVFKHV .DYDOOH ULHSIHUG    -K Q &KU  [ FP +Â&#x201D;OIWH HLQHV *LSVPR GHOV I©U HLQ 3IHUGH}J©UFKHQ 'HU 3IHUGNRSI PLW NXU]HU 6FKQDX]H VSLW]HP 2KU XQG 0Â&#x201D;KQH $XI GHP .¤USHU /LQLHQ GLH GLH 6DW WHOGHFNH DQJHEHQ XQG NRQ]HQWUL VFKH .UHLVH I©U 3KDOHUDH .OHLQH $EVSOLWWHUXQJHQVRQVWLQWDNW u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ:5JHNDXIWDXV GHU QLHGHUUKHLQLVFKHQ 3ULYDWVDPPOXQJ 03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ 9JOÂ&#x201D;KQOLFKH0RGHOLQ+/DQJH5¤PL VFKH7HUUDNRWWHQDXV6DO]EXUJ  6 I1U=XGHU$XVU©VWXQJHLQHV .DYDOOHULHSIHUGHV LQ GHU U¤PLVFKHQ $U PHHV0-XQNHOPDQQ'LH5HLWHU5RPV ,,,  6I 3DUWRIJ\SVXPPRGHORID5RPDQPLOLWDU\ KRUVH}JXUHQGUGFHQWXU\$'7LQ\ VSOLQWHUVPLVVLQJRWKHUZLVHLQWDFW 

75


e Hahn. *ULHFKHQODQG    -K Y &KU+FP+HOOEUDXQHU7RQPLW 5HVWHQ YRQ (QJREH XQG %HPDOXQJ ,QWDNW u 3URYHQLHQ]([6DPPOXQJ/0XQ])XOGD HUZRUEHQ 7HUUDFRWWD FRFN *UHHN WK  WK FHQWXU\ %&7UDFHVRISDLQWLQJ

e Taube. +HOOHQLVWLVFK  -K Y &KU / FP +HOOEUDXQHU 7RQ PLW 5H VWHQYRQEHLJHPEHU]XJ'LH)©gH ZDUHQ VHSDUDW JHIHUWLJW DXV DQGHUHP 0DWHULDO (LQ )Xg HUJ”Q]W VRQVW LQ WDNW u 

3URYHQLHQ]([6DPPOXQJ/0XQ])XOGD HUZRUEHQ 7HUUDFRWWD GRYH +HOOHQLVWLF UG FHQWXU\ %& 0LVVLQJ IHHW KDG EHHQ ZRUNHG VHSDUDWHO\

 %RRWPLW:LGGHUNRSI0LWWHOLWDOLHQFD -KY&KU%UDXQHU7RQ/FP %UDXQH ,PSDVWR.HUDPLN 2IIHQHV NDKQI¤UPLJHV %RRW GHQ %XJ ]LHUW HLQ:LGGHUNRSIDP+HFNHLQNQDXI DUWLJHU .QRSI 0HKUIDFK JHEURFKHQ 6SLW]HGHV.RSIHVHUJ”Q]W u 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEH VW”QGHQGHU0©QFKQHU0©Q]KDQGOXQJ.DUO .UHVVYRU 2SHQ ERDW ZLWK D UDP KHDG DV VKLSyV ERZ PDGHRIEURZQFOD\VRFDOOHGLPSDVWRZDUH &HQWUDO,WDO\DERXWWKFHQWXU\%&7LSRI WKHUDPKHDGUHDWWDFKHGERDWUHDVVHPEOHG RIODUJHIUDJPHQWV





76


 

 .RSIGHV'LRQ\VRV7DUHQWFDY&KU5HOLHIDXVKHOOUR WHP7RQ+FP%”UWLJHU0”QQHUNRSIPLWODQJHPJHS~HJWHP %DUW%XFNHOORFNHQDQGHU6WLUQXQGODQJHP©EHUGLH6FKXOWHUQ KLQDEIDOOHQGHP+DDU$XIGHP.RSIVLW]WHLQP”FKWLJHU.UDQ] PLW HLQHP DXIUDJHQGHP HLI¤UPLJHP 2EMHNW LP =HQWUXP ,P +DOVJHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUZRUEHQEHL *DOOHULD6HURGLQH$VFRQD 'HU.RSIJHK¤UW]XHLQHU.DWHJRULHYRQ'HQNP”OHUQGHUHQ%HGHXWXQJQLFKW JDQ]JHNO”UWLVW0HLVWZLUGHLQEHLP6\PSRVLRQJHODJHUWHU0DQQGDUJHVWHOOW GHUHQWZHGHULQ*HVWDOWGHV*RWWHV'LRQ\VRVRGHUDOV6\PSRVLDVWHUVFKHLQW 9HUPXWOLFK VWDPPHQ GLHVH 7RQUHOLHIV YRQ HLQHP +HURHQNXOW KDEHQ DEHU DXFKPLWGLRQ\VLVFKJHSU”JWHQ-HQVHLWVYRUVWHOOXQJHQ]XWXQ9JO+DXFKGHV 3URPHWKHXV$XVVWHOOXQJ0©QFKHQ  6$EE $Q $UFKDLF WHUUDFRWWD KHDG RI EHDUGHG 'LRQ\VRV ZLWK ODYLVKO\ GHFRUDWHG ZUHDWKLQHOHJDQWDUFKDLFVW\OH7DUDQWRDERXW%&%URNHQLQWKH QHFN

 .RSIHLQHV*ULHFKHQ7DUHQWVS”WHV-KY&KU+FP $XVKHOOEHLJHP7RQ9ROOSODVWLVFKHUE”UWLJHU.RSIHLQHV”OWHUHQ 0DQQHV 0LW %HVFKUHLEXQJ GHV HKHPDOLJHQ %HVLW]HUV ,P +DOV JHEURFKHQVRQVWQXUOHLFKWEHULHEHQ u 3URYHQLHQ]([6DPPOXQJ3URI+(+HVVHQHUZRUEHQLP)UDQNIXUWHU .XQVWKDQGHO%HL*RUQ\ 0RVFK$XNWLRQ/RV 'HU.RSIJLEWHLQHQ,GHDOW\SXVGHUJULHFKLVFKHQ.ODVVLNZLHGHUZLHHUDXI JULHFKLVFKHQ *UDEUHOLHIV DEHU DXFK LQGLYLGXDOLVLHUWHU LQ GHQ 3RUWU”WV GHU NODVVLVFKHQ=HLW]X}QGHQLVW$XIJUXQGGHULNRQRJUDSKLVFKHQ9HUZDQGVFKDIW PLWGHP7\SXV6RSKRNOHV/DWHUDQwZXUGHDXFKHLQ%LOGQLVGHVEHU©KPWHQ 7UDJ¤GLHQGLFKWHUVGDULQJHVHKHQ7DWV”FKOLFKKDQGHOWHVVLFKZRKOXPGLH 'DUVWHOOXQJHLQHVLGHDOLVLHUWHQ9HUVWRUEHQHQZLHHULQGHU.RURSODVWLN7DUHQWV K”X}J]X}QGHQLVW 7HUUDFRWWDKHDGRIDQLGHDOL]HG*UHHNPDQLQWKHW\SLFDOVW\OHRIWKH&ODVVLFDO 3HULRG7DUDQWRODWHWKWKFHQWXU\%&%URNHQDWWKHQHFNVXUIDFHVOLJKWO\ UXEEHG:LWKGHVFULSWLRQRIWKHIRUPHURZQHU



 :HLEOLFKHV.¤SIFKHQ-KY&KU7HUUDNRWWD+FP.RSIHL QHUMXQJHQ)UDXPLWRYDOHPLGHDOLVLHUWHP*HVLFKWHLQHUKRKHQ 6WLUQXQGYROOHQ/LSSHQ*HVFKHLWHOWH:HOOHQIULVXUPLW'XWWJH VFKP©FNW PLW HLQHP 'LDGHP XQG SHUOHQI¤UPLJHQ 2KUULQJHQ $P+DOVVLQG9HQXVULQJH]XVHKHQ$P+DOVJHEURFKHQ%HVWR gXQJDQGHU1DVH)DUEUHVWHLP1DFNHQ u 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV 7HUUDFRWWDKHDGRID\RXQJZRPDQUGFHQWXU\%&:HDULQJDGLDGHPDQG HDUULQJV%URNHQLQWKHQHFNVOLJKWO\ZRUQDWWKHQRVH7UDFHVRIFRORXUDW WKHQHFN

77


 0DWUL]HI©UGHQ.RSIHLQHU6WDGWW\FKH *ULHFKLVFKHU2VWHQ-KY&KU +FP'XQNHOEUDXQHU7RQ)RUP I©U GDV 9RUGHUWHLO HLQHV ZHLEOLFKHQ .RSIHV PLW .UDQ] XQG 0DXHUNURQH 7\FKH RGHU .\EHOH  0LW .RSLH GHU 5HFKQXQJ YRQ 0©Q]HQ XQG 0HGDLO OHQYRQ,QGUHL7HLOH]HUEURFKHQ XQGZLHGHU]XVDPPHQJHVHW]WELVDXI HLQHNOHLQH$EVSOLWWHUXQJYROOVWÂ&#x201D;QGLJ u 

3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ+: +DPEXUJ HUZRUEHQ  EHL 0©Q]HQ XQG0HGDLOOHQ%DVHO%HL*RUQ\ 0RVFK $XNWLRQ/RV 7HUUDFRWWDPDWUL[IRUWKHWXUUHWHGKHDGRIWKH FLW\JRGGHVV7\FKHZLWKZUHDWK(DVW*UHHN QGVWFHQWXU\%&%URNHQLQWKUHHSLHFHV DQG UHDVVHPEOHG H[FHSW D OLWWOH VSOLQWHU FRPSOHWH:LWKFRS\RIWKHLQYRLFHRI0©Q]HQ XQG0HGDLOOHQIURP



 =ZHL 7HUUDFRWWD$SSOLNHQ *URgJULH FKHQODQGFDY&KUD + FPURWEUDXQHU7RQ)ODFKHV5HOL HILQ)RUPGHV.RSIHVHLQHVEÂ&#x201D;UWLJHQ )OXVVJRWWHV $FKHORRV"  PLW NXU]HQ 6WLHUK¤UQHUQ %XFNHOORFNHQ YROXPL Q¤VHP%DUWPLWODQJHP6FKQDX]HULP DUFKDLVFKHQ 6WLO E  + FP )ODFKHV 7RQUHOLHIPLWHLQHU3DOPHWWHDXI]ZHL 9ROXWHQ DXI6RFNHO 6W©FN u 3URYHQLHQ] ([ 6DPPOXQJ )7 %DGHQ :©UWWHPEHUJ D  HUZRUEHQ EHL &\EHOH 3DULV JHNDXIW DXI GHU &XOWXUD %DVHO  E  JHNDXIW  EHL &KDUOHV (GH /RQGRQ SXEOLQ.DWDORJ1U (LQH JHQDXH 3DUDOOHOH LP %ULWLVK 0XVHXP /RQGRQ5HJ1R 7ZR WHUUDFRWWD DSSOLTXHV IURP 0DJQD *UDHFLDRQHGHSLFWLQJWKHKHDGRIDEHDUGHG ULYHUJRG $FKHORRV" WKHRWKHUDSDOPHWWH %RWKDERXW%&LQDUFKDLFVW\OH SLHFHV

 (WUXVNLVFKHU 9RWLYIXg    -K Y &KU /  FP ,Q +RKOIRUP PRGHO OLHUW $XV KHOOEUDXQHP 7RQ 1DWXUD OLVWLVFK JHVWDOWHWHU UHFKWHU )Xg DXI HLQHU6RKOH=ZHL/¤FKHULQGHU6RK OHHLQVREHQLP%HLQ*URgHU=HKLVW JHEURFKHQNOHLQH$EVSOLWWHUXQJHQDQ GHU6RKOH u



3URYHQLHQ]([6DPPOXQJ66%D\HUQVHLW  9JO0%HQW] +UVJ 5DVQD'LH(WUXVNHU $XVVWHOOXQJ%RQQ  61U (WUXVFDQ YRWLY IRRW UG  VW FHQWXU\ %& 5LJKWIRRWZLWKVROH%LJWRHLVEURNHQ:LWK WZRKROHVLQWKHVROHDQGRQHRQWRSRIWKHOHJ

78


 8WHUXV9RWLY ,WDOLVFK    -K Y &KU + FP +HOOHU 7RQ 7HUUD NRWWDGDUVWHOOXQJ HLQHU *HE”UPXWWHU 3DUWLHOO REHU~”FKOLFKH $XVEU©FKH VRQVWLQWDNW u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ +: HUZRUEHQ LP 6HSWHPEHU 9JO(.©Q]HO0HGL]LQLQGHU$QWLNH   6  I 0 %HQW] +UVJ  5DVQD  'LH (WUXVNHU $XVVWHOOXQJ %RQQ   6  I1U 9RWLYHLQIRUPRIDQXWHUXV,WDOLFUGVW FHQWXU\%&6XSHU}FLDOGDPDJHV

 3KDOOXV9RWLY (WUXVNLVFK    -K Y &KU / FP + FP 9RWLY HLQHV 3HQLV PLW +RGHQVDFN .OHLQH $XVEU©FKHVRQVWLQWDNW u 3URYHQLHQ]$XV6DPPOXQJ/-1LHGHUODQGH H[ *RUQ\  0RVFK $XNWLRQ   /RV  'DYRU VHLW GHQ HU -DKUHQ LQ GHXWVFKHU3ULYDWVDPPOXQJ 9JO(.©Q]HO0HGL]LQLQGHU$QWLNH   6I



9RWLYHRIDSHQLV(WUXVFDQUGQGFHQWXU\ %&6PDOOGDPDJHVDWWKHHGJHVRWKHUZLVH LQWDFW

 &DPSDQD5HOLHI PLW +HUDNOHV LQ GHU 3DO”VWUD  +”OIWH  -K Y &KU / FP7FP+FP PLW5DK PHQ  ,Q HLQHU 6”XOHQDUFKLWHNWXU ZDKUVFKHLQOLFK GHP 3RUWLNXV HLQHU 3DO”VWUD VWHKW ]HQWUDO GLH 6WDWXH GHV E”UWLJHQ +HUDNOHV PLW .HXOH LQ GHU 5HFKWHQ XQG /¤ZHQIHOO XP GHQ OLQ NHQ$UPJHZLFNHOWDXIHLQHUHUK¤KWHQ %DVLV 7\SXV &KLDUDPRQWL"  5HFKWV XQGOLQNVYRQGHU]HQWUDOHQ+HUDNOHV 6WDWXH VWHKHQ MHZHLOV ]ZHL ZHLWHUH $WKOHWHQ6WDWXHQ DXI UHFKWHFNLJHQ %DVHQ/LQNVVLQGMHZHLOV]ZHL)DXVW N”PSIHUGDUJHVWHOOWGHUHQ8QWHUDUPH PLW /HGHUE”QGHUQ XPZLFNHOW VLQG Rechts sind ein sich mit einer Stri JLOLV UHLQLJHQGHU 6SRUWOHU 6FKDEHU $SR[\RPHQRV  VRZLH HLQ -©QJOLQJ PLW HLQHU 6LHJHVSDOPH LQ GHU /LQNHQ DEJHELOGHWEHUHLQ'ULWWHOGHVREH UHQ7HLOVPLWGHU%HNU¤QXQJIHKOWLQ GHU 0LWWH JHEURFKHQ SDUWLHOO EHULH EHQ ZLQ]LJH )UDJPHQWH IHKOHQ )DU EUHVWHLQHLQHPZHLgHQ+RO]UDKPHQ PLWVHQ u



3URYHQLHQ] ([ 6% %D\HUQ (UZRUEHQ DXV 0©QFKQHU :RKQXQJVDX~¤VXQJ ZRKO HU-DKUH 9JO0©QFKHQ6WDDWOLFKH$QWLNHQVDPPOXQ

79




JHQ,QY6//LWHUDWXU$96LHEHUW*HVFKLFKWH Q LQ7RQ5¤PLVFKH $UFKLWHNWXUWHUUDNRWWHQ  6I.DW +HUDNOHV DOV 6WLIWHU GHU 2O\PSLVFKHQ 6SLHOH ZLUG EHVRQGHUV KÂ&#x201D;X}J PLW 6WDQGELOGHUQ LQ GHQ DQWLNHQ 6SRUWVWÂ&#x201D;WWHQ JHHKUW 'LH 6WDWXHQDXIVWHOOXQJ LQ GHQ 6Â&#x201D;XOHQJÂ&#x201D;QJHQ GHU *\PQDVLHQ XQG 3DOÂ&#x201D;VWUHQ IDQG DXFK (LQ]XJ LQ GLH 'DUVWHOOXQJHQ DXI GHQ &DPSDQD5HOLHIV GLH GLH WHLOZHLVH DXIZÂ&#x201D;QGLJH $UFKLWHNWXUGHU7UDLQLQJVDQODJHGHWDLOUHLFKZLHGHUJHEHQZDVEHLXQVHUHP ([HPSODUOHLGHUJU¤gWHQWHLOVYHUORUHQLVW(LQJXWHV%HLVSLHOGDI©ULVWGDV]LWLHUWH &DPSDQD5HOLHIDXVGHU0©QFKQHU$QWLNHQVDPPOXQJ(LQH=XRUGQXQJGHU GDUJHVWHOOWHQ6Â&#x201D;XOHQDUFKLWHNWXU]XHLQHPUHDOHQ%DXZHUNLVWQLFKWP¤JOLFK ,Q 5RP ZXUGHQ LQ GHQ +RUWL 6DOOXVWLDQL HLQH 5HLKH YRQ MHZHLOV DXV GHU JOHLFKHQ)RUPVWDPPHQGHU3ODWWHQGHVREHQEHVFKULHEHQHQ7\SVJHIXQGHQ 0¤JOLFKHUZHLVH ]LHUWHQ GLH 5HOLHIV GLH SDOÂ&#x201D;VWUDDUWLJH *DUWHQDQODJH HLQHU U¤PLVFKHQ9LOOD,QGHU%LOGNRPSRVLWLRQPLWGHP5©FNJULIIDXIEHU©KPWH VWDWXDULVFKH9RUELOGHU +HUDNOHVYRP7\S&KLDUDPRQWL"$SR[\RPHQRVGHV /\VLSS ZLUGHLQJHZLVVHU%LOGXQJVDQVSUXFKGHVUHLFKHQ5¤PHUVJHVHKHQGHU VLFKGHPÂ&#x20AC;RWLXPyKLQJDE &DPSDQDUHOLHIRIWHUUDFRWWDGHSLFWLQJDSDUWRIDSRUWLFXVZLWK}YHVWDWXHV ,QWKHFHQWHUWKHVWDWXHRI+HUDFOHVZLWKFOXEDQGOLRQVNLQRQWKHOHIWWZR ER[HUVDQGRQWKHULJKWDQDWKOHWHZLWKVWULJLOLVDQGD\RXQJPDQZLWKDSDOP EUDQFK,WDO\QGKDOIRIVWFHQWXU\%&0RUHWKDQRQHWKLUGRIWKHXSSHU SDUW LV PLVVLQJ EURNHQ LQ WKH PLGGOH SDUWLDOO\ UXEEHG RII WLQ\ IUDJPHQWV PLVVLQJWUDFHVRIFRORXULQDZKLWHZRRGHQIUDPHZLWKH\HOHWVIRUVXVSHQGLQJ

 5HOLHIPLW*¤WWLQ5¤PLVFK-KQ&KU+FP)URQWDOH 'DUVWHOOXQJ HLQHU *¤WWLQ PLW 3RORV GLH LQ HLQHU 6FK©U]H YRU GHP 2EHUN¤USHU )U©FKWH KÂ&#x201D;OW 8PIDQJHQ ZLUG VLH YRQ HLQHU $XUHROH)UDJPHQWLHUWGDVXQWHUH'ULWWHOJHEURFKHQXQGZLHGHU DQJHVHW]W u 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ HUZRUEHQDXVGHP1DFKODVVHLQHV=DKQDU]WHV 7HUUDFRWWDUHOLHIZLWKJRGGHVVZHDULQJDSRORVDQGKROGLQJLQDQDSURQIUXLWV 5RPDQQGUGFHQWXU\$')UDJPHQWDU\EURNHQDQGUHDWWDFKHG

80




67(,16.8/3785



81




 7RUVRGHV$VNOHSLRV5¤PLVFKH.DLVHU]HLW-KQ&KU:HL gHU IHLQNULVWDOOLQHU 0DUPRU + FP 8QWHUOHEHQVJURgH )LJXU HLQHV0DQQHVGHUVLFKPLWGHUUHFKWHQ6FKXOWHUDXIHLQHQ6WDE VW©W]WXPGHQVLFKHLQH6FKODQJHULQJHOWGLHHUPLWHLQHP(LI©W WHUW'LHLQGLH+©IWHJHVWHPPWH/LQNHEOHLEWXQWHUGHP0DQWHO YHUERUJHQGHUGHQ.¤USHUPLWHLQHPVWUHQJHQ)DOWHQZXUIEH GHFNWXQGQXUGLH%UXVWXQGGLHUHFKWH6FKXOWHUIUHLOÂ&#x201D;VVW=XVHL QHQ)©gHQHLQ2PSKDORV.RSIXQG)©gHPLW9RUGHUVHLWHGHU 3OLQWKHJHEURFKHQUHFKWHU$UPZLHGHU]XVDPPHQJHVHW]WDEHU NRPSOHWW u 3URYHQLHQ] ([ 6DPPOXQJ 3URI 'U :XWWJH 0©QFKHQ (UZRUEHQ LP 0©QFKQHU.XQVWKDQGHOLQGHQHUHU-DKUHQ

82

'LH 6WDWXHWWH VWHKW LQ HLQHU 5HLKH YRQ U¤PLVFKHQ 1DFKELOGXQJHQ HLQHV JURgSODVWLVFKHQJULHFKLVFKHQ2ULJLQDOVGDVLP-KY&KUHQWVWDQGHQVHLQ PXVV'LHHUKDOWHQHQU¤PLVFKHQ.RSLHQHUJHEHQHLQÂ&#x201D;XgHUVWNRPSOH[HV%LOG =XGHU]DKOHQPÂ&#x201D;gLJJU¤gWHQ*UXSSH 7\S,,,D JHK¤UWDXFKXQVHU([HPSODU (VZLUGDQJHQRPPHQGDVVGLHVHU7\SGDV.XOWELOGZLHGHUJLEWGDV Y&KULQ$WKHQDXIJHVWHOOWZXUGHDOVGHU.XOWGHV$VNOHSLRVDOV)LOLDONXOW YRQ(SLGDXURVGRUWHLQJHI©KUWZRUGHQZDU/LW/,0&,,  II1U IIVY$VNOHSLRV(%HUJHU=ZHLQHXH6NXOSWXUHQIUDJPHQWHLP%DVOHU /XGZLJ0XVHXPLQ3UDHVWDQW,QWHUQD)HVWVFKULIW8+DXVPDQQ  EHV 7DI.1HXJHEDXHU$VNOHSLRV%Z3U  %9LHUQHLVHO 6FKO¤UE*O\SWRWKHN0©QFKHQ.DWDORJGHU6NXOSWXUHQ,,  II 0DUEOH}JXULQHRI$VNOHSLRVIHHGLQJWKHVQDNHLQWKH*LXVWLQLW\SH$WWKH IHHW2PSKDORV5RPDQVWQGFHQWXU\$'DIWHUWKHFODVVLFDOSURWRW\SH ZKLFKZDVHUHFWHGLQ$WKHQVDURXQG%&7RUVR+HDGIHHWDQG IRUHSDUWRIWKHSOLQWKEURNHQ




83




 *UDEVWHOH DXV 0DUPRU VWOLFKHU 0LWWHOPHHUUDXP    -K Y &KU :HLgHU IHLQNULVWDOOLQHU 0DUPRU + FP % FP 7 FP $XI GHU 5©FNVHLWH YLHU PRGHUQH %HIHVWLJXQJVVFKUDXEHQ +RFKUHFKWHFNLJH VLFK QDFK REHQ OHLFKW YHUM©QJHQGH 6WHOH PLW ]ZHL5HJLVWHUQXQG*LHEHOPLW6HLWHQDNURWHUHQ,PREHUHQ5H JLVWHUGHU*UDEKHUUDOVJHODJHUWHU6\PSRVLDVWDXIHLQHU.OLQHPLW 7ULQNJHI”gXQG.UDQ]=XVHLQHU5HFKWHQVHLQHDXIHLQHP+RN NHU VLW]HQGH VLWWVDP YHUVFKOHLHUWH *HPDKOLQ ,P 9RUGHUJUXQG HLQPLW6SHLVHQJHGHFNWHU7LVFKXQGGUHLNOHLQH'LHQHU}JXUHQ ,PXQWHUHQ5HJLVWHULVWGDV3DDUHUQHXW]XVHKHQGLHVPDOGHU 3DWURQLQGHU$WWLW©GHHLQHVVLW]HQGHQ3KLORVRSKHQGLH*HPDK OLQ DOV VRUJHQGH 0XWWHU PLW HLQHP 6”XJOLQJ LP $UP ,Q GHQ (FNHQ ]ZHL NOHLQH 'LHQHU (UJ”Q]W VLQG 7HLOH GHV .RSIHV GHU *HPDKOLQ XQG GLH 1DVH GHV 0DQQHV LP REHUHQ %LOGIHOG (LQ 'LHQHUJHVLFKW JHEURFKHQ VRQVW H[]HOOHQW HUKDOWHQ 8QWHQ EH VFKQLWWHQ u 84

3URYHQLHQ] $XV GHU 6DPPOXQJ 'U .ODXV 0RUNUDPHU 2EHUKDXVHQ (UZRUEHQEHL$[HO:HEHU.XQVWGHU$QWLNH.¤OQ PLWKDQGVFKULIWOLFKHU ([SHUWLVHYRQ.RSLH ([*DOHULH*DFNVW”WWHU)UDQNIXUW PLW.RSLH GHU([SHUWLVH  ,QGHQPHLVWHQ]ZHL]RQLJHQ*UDEUHOLHIHVGLHVHU=HLWZLUGLPXQWHUHQ%LOGIHOG GHU%HUXIGHV*UDEKHUUQWKHPDWLVLHUW,QXQVHUHP)DOOVLQGDOOHUGLQJVGLH VRUJHQGH0XWWHUXQGLKULQHLQHP7UDXHUJHVWXVYHUKDUUHQGHU*HPDKOGDV 7KHPDZDVRIIHQEDUHLQHULQGLYLGXHOOHQ6LWXDWLRQJHVFKXOGHWLVW9LHOOHLFKW YHUVWDUEGLH)UDXLP.LQGEHWWZHVKDOEGLHVHEHVRQGHUH9DULDQWHJHVWDOWHW ZXUGH9JO(3IXKO+0RHELXV'LHRVWJULHFKLVFKHQ*UDEUHOLHIV,,   II1U0&UHPHU+HOOHQLVWLVFKU¤PLVFKH*UDEVWHOHQLP QRUGZHVWOLFKHQ.OHLQDVLHQ  7DI $KHOOHQLVWLFJUDYHVWHOHVKRZLQJWKHGHFHDVHGDQGKLVZLIHDVV\PSRVLDVWV DFFRPSDQLHGE\VHUYDQWVLQWKHXSSHUURZDQGLQWKHPDQQHURIDSKLORVRSKHU DQGDVFDULQJPRWKHUZLWKEDE\LQWKHORZHUURZ(DVWHUQPHGLWHUUDQHDQQG VWFHQWXU\%&3DUWRIWKHODG\yVKHDGDQGWKHQRVHRIWKHPDQUHVWRUHG /RZHUSDUWFXWRII:LWKH[SHUWLVHRI$[HO:HEHURI FRS\ 


$

$ $SKURGLWH5¤PLVFKH.DLVHU]HLW-KQ&KU:HLgHUIHLQ NULVWDOOLQHU 0DUPRU + FP $XI HLQHU SUR}OLHUWHQ %DVLV VWH KHQGH /LHEHVJ¤WWLQ GLH LQ GHU $UW GHU $QDG\RPHQH PLW GHU 5HFKWHQ LKU +DDU ZULQJW ZÂ&#x201D;KUHQG 6LH PLW GHU /LQNHQ GHQ %DXVFKLKUHVKHUDEJHIDOOHQHQ0DQWHOVYRUGLH6FKDPKÂ&#x201D;OWGHV VHQ DQGHUHV (QGH VLH QRFK PLW GHP OLQNHQ 8QWHUDUP DQ GHQ .¤USHU NOHPPW %HJOHLWHW ZLUG VLH YRQ HLQHP NOHLQHQ (URV ]X LKUHU/LQNHQGHUDXIHLQHP'HO}QDXVUXKW9ROOVWÂ&#x201D;QGLJXQJHEUR FKHQHUKDOWHQ2EHU~Â&#x201D;FKHOHLFKWDQJHZLWWHUW u

3URYHQLHQ]([6DPPOXQJ06:LHQ(UZRUEHQEHL'U$$0©QFKHQ (QGHGHUHUHU-DKUH 0DEOH}JXULQHRI9HQXV$SKURGLWHZULQJLQJKHUKDLUDQGWU\LQJWRKROG WRJHWKHUKHUPDQWOHLQDVK\JHVWXUH5RPDQ,PSHULDOSHULRGQGUGFHQWXU\ $',QWDFWEXWZLWKVOLJKWO\FRUURGHGVXUIDFH

85




 $SKURGLWHWRUVR5¤P.DLVHU]HLW-KQ&KU*URENULVWDOOLQHU 0DUPRU+FP+DOV$UPHXQG2EHUVFKHQNHOJHEURFKHQ $XgHUGHPIHKOWHLQ*URgWHLOGHVOLQNHQ*OXWÂ&#x201D;XV$QGHUOLQNHQ +©IWHGHU5HVWHLQHU6W©W]H%UXFK~Â&#x201D;FKHDQGHUUHFKWHQ%UXVW 0LW%HVFKUHLEXQJGHVHKHPDOLJHQ%HVLW]HUV,P+DOVJHEURFKHQ VRQVWQXUOHLFKWEHULHEHQ u 3URYHQLHQ]([6DPPOXQJ3URI+(+HVVHQHUZRUEHQLP)UDQNIXUWHU .XQVWKDQGHO'DYRU6DPPOXQJ3URI%XVFK+DPEXUJ%HL*RUQ\ 0RVFK $XNWLRQ/RV 'DV6W©FNIROJWYLHOOHLFKWGHP7\SXVGHU$SKURGLWH$QDG\RPHQHDOOHUGLQJV IHKOHQ 6SXUHQ GHU ODQJHQ +DDUORFNHQ DQ GHU 6FKXOWHU GLH YHUJOHLFKEDUH ([HPSODUHEHVLW]HQ 0DUEOHWRUVRRIQDNHG$SKURGLWH5RPDQ,PSHULDO3HULRGVWQGFHQWXU\ $'%URNHQDWWKHQHFNVXUIDFHVOLJKWO\UXEEHG

86

 Porträt eines Römers.  +Â&#x201D;OIWH  -K Q &KU :HLgHU IHLQNUL VWDOOLQHU 0DUPRU + FP /HEHQVJURgHU .RSI PLW NQDSSHP +DOVDXVVFKQLWW'HUEDUWORVH0DQQPLWKDJHUHQ=©JHQWUÂ&#x201D;JWHLQH PLWWHOODQJH 6LFKHOORFNHQIULVXU GLH GHXWOLFK YRQ GHQ %LOGQLVVHQ GHVMXOLVFKFODXGLVFKHQ.DLVHUKDXVHVEHHLQ~XVVWLVW'LHNQRFKL JH*HVWDOWXQJGHV*HVLFKWHVPLWGHPHWZDVDXIJHSROVWHUWHQ/LS SHQEHUHLFKVWHKWGDJHJHQQRFKLQGHU7UDGLWLRQUHSXEOLNDQLVFKHU 3RUWUÂ&#x201D;WV1DVHXQG.LQQHUJÂ&#x201D;Q]W u 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ EHL $XNWLRQVKDXV+DPSHO0©QFKHQFD $PDUEOHSRUWUDLWRIDURPDQFLWL]HQZLWKZDY\KDLUQGKDOIVWFHQWXU\ $'1RVHDQGFKLQUHVWRUHG




87


 Porträt eines Römers. 1. Jh. v. Chr. :HLgHU OHLFKW JHÂ&#x201D;GHUWHU IHLQNULVWDO OLQHU0DUPRU+FP)DVWYROOSOD VWLVFKHU 5HOLHINRSI HLQHV EDUWORVHQ 0DQQHV PLWWOHUHQ $OWHUV PLW YROOHP DQ GHQ *HKHLPUDWVHFNHQ HWZDV ]X U©FNZHLFKHQGHP+DDUGDVLQVLFKHO I¤UPLJHQ /RFNHQ GLH 6WLUQ EHGHFNW (LQH%HXOHDQGHUOLQNHQ6WLUQ5©FN ZÂ&#x201D;UWLJXQGXQWHUKDOEGHV.LQQVJHEUR FKHQ %HVWRgXQJHQ DQ .LQQ UHFKWHU :DQJHXQG1DVH u 3URYHQLHQ]([6DPPOXQJ(+6©GGHXWVFK ODQGYRU ,QVEHVRQGHUH GLH %HXOH DQ GHU 6WLUQ PDFKW GHXWOLFKGDVVKLHUHLQHVGHUW\SLVFKHQU¤PL VFKHQ %©UJHUSRUWUÂ&#x201D;WV YRUOLHJW GDV LQ UHSXE OLNDQLVFKHU 7UDGLWLRQ UHDOLVWLVFK LQGLYLGXHOOH $OWHUV]©JHZLHGHUJLEWGLHLPU¤PLVFKHQ:HU WHV\VWHPI©U%HJULIIHZLHÂ&#x20AC;DXFWRULWDVyRGHUÂ&#x20AC;YLU WXVyVWHKHQ'DV6W©FNVWDPPWZRKOYRQHLQHP VRJ.DVWHQJUDEUHOLHIHLQH*DWWXQJGLHYRUDO OHPI©UIUHLJHODVVHQH6NODYHQJHIHUWLJWZXUGH GLHEHVRQGHUHQ:HUWDXILKUQHXHUZRUEHQHV 5¤PHUWXPOHJWHQ$XIGLHVHQ5HOLHIVZXUGHQ GLH3RUWUÂ&#x201D;WLHUWHQLQHLQHPUHFKWHFNLJHQ5DK PHQSUÂ&#x201D;VHQWLHUWVRGDVVVLFKGDI©UDXFKGHU 1DPHÂ&#x20AC;)HQVWHUJXFNHUyHWDEOLHUWKDW



0DUEOH UHOLHI KHDG RI D 5RPDQ FLWL]HQ SUREDEO\ D OLEHUWXV LQ WKH UHDOLVWLF PDQQHU RIWKH5HSXEOLFDQWUDGLWLRQVWFHQWXU\%& )UDJPHQWDU\

 .RSI HLQHV MXQJHQ 0DQQHV +HOOHQL VWLVFK-KY&KU:HLgHUIHLQ NULVWDOOLQHU 0DUPRU + FP )DVW YROOSODVWLVFKHU .RSI PLW $QVDW]VSX UHQGHV5HOLHIJUXQGHVDP+LQWHUNRSI 'HUEDUWORVH-©QJOLQJPLWLGHDOHQ*H VLFKWV]©JHQ WUÂ&#x201D;JW HLQH NXU]H XQUH JHOPÂ&#x201D;gLJH %XFNHOORFNHQIULVXU GHUHQ /RFNHQ SDUDOOHOH 5HLKHQ QDFK KLQ WHQELOGHQ'HU.RSIZDUZRKOOHLFKW QDFK OLQNV JHZDQGW 1DVH XQG /LSSH EHVWRgHQ %UXFKNDQWHQ DP +DOV XQG +LQWHUNRSI u 3URYHQLHQ] $XV GHU 6DPPOXQJ 'U 60 1LHGHUED\HUQVHLWGHQHU-DKUHQ 0DUEOHKHDGRID\RXQJPDQZLWKFXUO\KDLU 3UREDEO\ IURP D JUDYH UHOLHI ZLWK WUDFHV RI WKHUHOLHIJURXQGRQWKHEDFNVLGH+HOOHQLVWLF 3HULRGUGVWFHQWXU\%&:RUQQRVHDQG OLSV&UDFNVDWEDFNVLGHDQGQHFN



88


 .QDEHQNRSI 5¤PLVFKH .DLVHU ]HLW-KQ&KU'XQNHOJHW¤Q WHU .DONVWHLQ + FP 3RUWUÂ&#x201D;W HLQHV -XQJHQ PLW JHVWDIIHOWHU 6L FKHOORFNHQIULVXU 1DFNHQVW©W]H .RSLH GHU 5HFKQXQJ EHLOLHJHQG 0LQ %HVWRgXQJ LP +DOV JHEUR FKHQ u 3URYHQLHQ] ([ *DOHULH *XGHD 3DULV  5RPDQ OLPHVWRQH KHDG RI D ER\ QG FHQWXU\$'0LQLPDOGHQWVEURNHQLQ WKHQHFN:LWKFRS\RIWKHLQYRLFH





89


111

111 5HOLHIPLW)UDXHQE©VWH5¤PLVFKH.DLVHU]HLW/HYDQWH-KQ &KU$ODEDVWHU+FP%FP7FP%UXFKVW©FNYRQHLQHP *UDEUHOLHI PLW GHU %©VWH HLQHU 'DPH GLH PLW HLQHP 'LDGHP .XJHORKUULQJHQHLQHU3HUOHQNHWWHXQGHLQHU+DOVNHWWHPLW0LW WHOPHGDLOORQJHVFKP©FNWLVW5HFKWVQHEHQGHP.RSI,QVFKULIW )UDJPHQWDULVFK u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ:HVWIDOHQ$XVHLQHU$XNWLRQ LQ3DGHUERUQ]ZLVFKHQXQG )UDJPHQWRIDDODEDVWHUIXQHUDU\UHOLHIVKRZLQJWKHEXVWRIDODG\ZHDULQJ SUHFLRXVMHZHOOHU\ULJKWRIWKHKHDGLQVFULSWLRQ/HYDQWH5RPDQ3HULRGQG FHQWXU\$')UDJPHQWDU\

90

111A 7HOHVSKRURV5¤PLVFK    -K Q &KU )HLQNULVWDOOLQHU 0DU PRU + FP .QDEH PLW .DSX]HQPDQWHO  +HUUOLFKH SROLHUWH 2EHU~Â&#x201D;FKH)©gHXQGNOHLQHU7HLOGHV*HZDQGHVJHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ06:LHQ(UZRUEHQEHL'U$$0©QFKHQ (QGHGHUHUHU-DKUH 7HOHVSKRURV GHUHV]XHLQHP>JXWHQ@(QGHEULQJW LVWGHU%HJOHLWHUGHV +HLOJRWWHV$VNOHSLRV $PDUEOH}JXUHRI7HOHVSKRURVZHDULQJDORQJFRDW5RPDQ,PSHULDO3HULRG QGUGFHQWXU\$')LQHO\SROLVKHGPDUEOHIHHWEURNHQVXSHU}FLDOGHQWV DWWKHOHIWVLGH


111A

91


112

112 %©VWHGHV6DUDSLV5¤PLVFKH.DLVHU]HLW-KQ&KU:HL gHUIHLQNULVWDOOLQHU0DUPRU+FP%©VWHGHVEÂ&#x201D;UWLJHQODQJ KDDULJHQ *RWWHV JHNOHLGHW LQ &KLWRQ XQG +LPDWLRQ DXI HLQHP *OREXVGHUDXIHLQHUSUR}OLHUWHQ%DVLVVLW]W3RORVXQG7HLOHGHU 3OLQWKHJHEURFKHQYHUVLQWHUW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ/RQGRQ 0LQLDWXUH PDUEOH EXVW RI 6DUDSLV RQ JOREH ZLWK SUR}OHG SOLQWK 5RPDQ ,PSHULDO3HULRGQGUGFHQWXU\$'3RORVDQGSDUWRIWKHSOLQWKEURNHQ DZD\SDUWLDOO\VLQWHUHGVXUIDFH

113 %DUEDU 5¤PLVFKH .DLVHU]HLW    -K Q &KU :HLgHU IHLQ NULVWDOOLQHU0DUPRU+FP5HOLHINRSIHLQHVEÂ&#x201D;UWLJHQÂ&#x201D;OWHUHQ 92

0DQQHVPLWODQJHQJHVWUÂ&#x201D;XEWHQ%XFNHOORFNHQXQG©EHUWULHEHQ ~HLVFKLJHP*HVLFKW)UDJPHQWDULVFK u 3URYHQLHQ] $XV GHU 6DPPOXQJ 'U 60 1LHGHUED\HUQ VHLW GHQ HU -DKUHQ :RKOYRQHLQHPKLVWRULVFKHQ5HOLHIRGHUHLQHPJURgHQ6FKODFKWHQVDUNRSKDJ 0DUEOH UHOLHI KHDG RI D EDUEDULDQ ZLWK EHDUG DQG VKDJJ\ KDLU 5RPDQ ,PSHULDO3HULRGQGUGFHQWXU\$')UDJPHQWDU\

 .RSIHLQHV.HQWDXUHQ+HOOHQLVPXV)U©KHU¤PLVFKH.DLVHU]HLW  -K Y &KU   -K Q &KU 5RWHU 0DUPRU URVVR DQWLFR  + FP )DVW YROOSODVWLVFKHU 5HOLHINRSI HLQHU PÂ&#x201D;QQOLFKHQ EÂ&#x201D;UWL JHQ*HVWDOWPLWWOHUHQ$OWHUVPLWJHVWUÂ&#x201D;XEWHP+DDULQGHPHLQ (IHXNUDQ] VLW]W 'LH 2KUHQ VLQG DOV 7LHURKUHQ PLW HWZDV QDFK


YRUQHJHULFKWHWHQ6SLW]HQJHVWDOWHW(WZDV EHULHEHQLP+DOVJHEURFKHQ u 3URYHQLHQ] $XV GHU 3ULYDWVDPPOXQJ -6 6©GGHXWVFKODQG HUZRUEHQ LQ GHQ HU ELV HU-DKUHQLPHQJOLVFKHQ.XQVWKDQGHO 'LH .HQWDXUHQ ZHUGHQ VHLW GHP  -K Y &KU GHP*HIROJHGHV'LRQ\VRV]XJHUHFKQHW9RQGHQ 6DW\UQXQWHUVFKHLGHQVLHVLFKYRUDOOHPGXUFKGLH IHKOHQGHQ +¤UQHU $XFK GLH W\SLVFKH 6WXSVQDVH IHKOW ,KQHQ 'RPLQLHUHQG EOHLEW HLQ NDQWLJHU ZLOGHUw 7\SXV PHLVW PLWWOHUHQ $OWHUV GHU QXU GXUFKVHLQH$WWULEXWHDOVGLRQ\VLVFKJHNHQQ]HLFKQHW ZLUG=XLNRQRJUDSKLVFKYHUZDQGWHQ.¤SIHQ* 0RUDZLHW]'HUJH]”KPWH.HQWDXU  6 9JODXFKGDVGRUWHUZ”KQWH6W©FNHEHQIDOOVDXV URWHP6WHLQ.XQVWKLVWRULVFKHV0XVHXP:LHQ,  $ UHG PDUEOH UHOLHI KHDG RI D EHDUGHG PDOH GLRQ\VLDF }JXUH PRVW SUREDEO\ D FHQWDXU ZLWK PXVFXODU IDFH DQG EULVWOHG KDLU ZHDULQJ DQ LY\ ZUHDWKQGFHQWXU\%&VWFHQWXU\$':RUQ VXUIDFH

115 -XJHQGOLFKHU +HOG 5¤PLVFKH .DLVHU]HLW +”OIWH-KQ&KU:HLgHUIHLQNULVWDO OLQHU0DUPRU+FP%FP5HOLHI IUDJPHQWYRQHLQHP6DUNRSKDJPLWGHP %LOGQLVHLQHV-©QJOLQJVPLWYHUWU”XPWHP QDFKOLQNVJHULFKWHWHP%OLFN)UDJPHQWD ULVFK u

113

3URYHQLHQ]([6.3DULVHUZRUEHQEHL2JHU %ODQFKHW 3DULV )UDQ]¤VLVFKHU )DPLOLHQEHVLW] 1DFKODVVDX~¤VXQJ $UHOLHIPDUEOHKHDGRID\RXQJKHUR)UDJPHQWRI DVDUFRSKDJXV5RPDQ,PSHULDO3HULRGQGKDOI QGFHQWXU\$')UDJPHQWDU\



115

93


 .RSIHLQHU0XVH5¤PLVFKH.DLVHU]HLW-KQ&KU )HLQNULVWDOOLQHU ZHLgHU 0DUPRU + FP :HLEOLFKHU .RSI PLW XQIHUWLJHU )ULVXU %LQGH XQG ]ZHL (LQODVVO¤ FKHUQDQGHU6WLUQ(WZDVSURYLQ]LHOOHU6WLOLP+DOVJH EURFKHQ,P%UXFKHLQDOWHUJHEURFKHQHU+RO]VWLIW u 3URYHQLHQ] ([ 6. 3DULV ([ )UD\VVH  $VVRFLHV 1DFKODVV DXV IUDQ]¤VLVFKHU 3ULYDWVDPPOXQJ ZRKO PLQG HU -DKUH V =XULFKWXQJ  ,QGHQEHLGHQ/¤FKHUQDQGHU6WLUQZDUHQGLHRIIHQEDUVHSDUDWJHIHU WLJWHQ)HGHUQHLQJHODVVHQGLHPDQRIWDXI'DUVWHOOXQJHQGHU0XVHQ DQDQWLNHQ6DUNRSKDJHQ}QGHW(VKDQGHOWVLFKXPGLH)HGHUQGHU 6LUHQHQGLHGLHVHQDFKGHPYHUORUHQHQ:HWWVWUHLWPLWGHQ0XVHQ ODVVHQPXVVWHQXQGOHW]WHUHIRUWDQDOV7URSKÂ&#x201D;HQDXIGHP.RSIWUXJHQ 0DUEOHKHDGRID0XVHZLWKWDHQLDDQGWZRKROHVIRUWKHVHSDUDWHO\ ZRUNHGVLUHQIHDWKHUVRQKHUKHDG5RPDQ,PSHULDO3HULRGQGUG FHQWXU\$'3URYLQFLDOVW\OHKDLUXQ}QLVKHGEURNHQLQWKHQHFNZLWK ROGEURNHQZRRGHQSLQIURPWKHSUHYLRXVFROOHFWLRQ

117 :HLEOLFKHV .¤SIFKHQ 5¤PLVFKH .DLVHU]HLW    -K Q &KU :HLgHU IHLQNULVWDOOLQHU 0DUPRU + FP 2YD OHU.RSIPLWLGHDOHQ*HVLFKWV]©JHQXQGNODVVL]LVWLVFKHU 6FKHLWHOIULVXUXQG'XWW'HU.RSILVW]XUUHFKWHQ6HLWH JHQHLJW ZLH GLH OHLFKWH 5XQGXQJ GHV +DOVDQVDW]HV DQ GHXWHW$P+DOVDQVDW]JHEURFKHQPLQ%HVWRgXQJHQDQ GHU1DVH u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ:HVWIDOHQHUZRUEHQ ]ZLVFKHQELVDXVGHU6DPPOXQJ-RVHI:LQWHU 

/LWWOHIHPDOHPDUEOHKHDGVWQGFHQWXU\$'%URNHQLQWKH QHFNVOLJKWO\ZRUQDWWKHQRVH

 .RSIGHU.\EHOH+HOOHQLVWLVFK-KY&KU+FP PLW6RFNHOFP)HLQNULVWDOOLQHU0DUPRU)UDXHQNRSI

117

94




PLW3RORV5©FNVHLWHXQGUHFKWH6HLWHGHV.RSIHVDQJHEURFKHQ PHKUHUH%HVWRgXQJHQ5HVWHYRQEUDXQHU9HUVLQWHUXQJ u 3URYHQLHQ]([6DPPOXQJ6.3DULVH[.Â&#x201C;0RQGR3DULV1RYHPEHU /RVH[*RUQ\ 0RVFK0©QFKHQ$XNWLRQ-XQL/RV +HDGRIWKHJRGGHVV&\EHOHZLWKSRORV+HOOHQLVWLFQGVWFHQWXU\%& %URNHQDWWKHQHFNDVZHOODVULJKWVLGHRIKHDGDQGEDFNVLGHVHYHUDOVSOLQWHUV RIWKHVXUIDFHDUHPLVVLQJEURZQZHDWKHULQJ

 .RSIHLQHV3DQWKHUV5¤PLVFKH.DLVHU]HLW-KQ&KU/ FP:HLgHUIHLQNULVWDOOLQHU0DUPRU,P+DOVJHEURFKHQ u 3URYHQLHQ]$XVGHU6DPPOXQJ&60©QFKHQH[&KULVWLHhV/RQGRQ $SULO/RVGDYRULQGHU6FKZHL]HU3ULYDWVDPPOXQJ90I©UGLHVH YRUHUZRUEHQ +HDGRIDSDQWKHUPDGHRI}QHZKLWHPDUEOH5RPDQ,PSHULDO3HULRGVW QGFHQWXU\$'%URNHQDWWKHQHFN

 6LPDIUDJPHQW PLW /¤ZHQNRSI  +Â&#x201D;OIWH  -K Y &KU :HLgHU IHLQNULVWDOOLQHU0DUPRU7FP%FP+FP*HEÂ&#x201D;ONWHLO PLW HLQHP SODVWLVFK DXVJHDUEHLWHWHQ IURQWDOHQ /¤ZHQNRSI GHU IRUPDOLQGHU7UDGLWLRQGHU/¤ZHQNRSIZDVVHUVSHLHUVWHKWLQGLH VHP)DOODEHUGHVVHQ)XQNWLRQQLFKWHUI©OOW u



3URYHQLHQ]([&KULVWLHyV1HZ<RUN/RV%HL*RUQ\ 0RVFK $XNWLRQ/RV 0DUEOHIUDJPHQWRIWKHVLPDRIDVPDOOJUHHNWHPSOHGHFRUDWHGZLWKDOLRQhV KHDGVWKDOIWKFHQWXU\%&



95


121 Reiterheros.    -K Q &KU .DON VWHLQ+FP/FP9ROOSODVWLVFKH *UXSSH EHVWHKHQG DXV HLQHP 3IHUG PLW HLQHU GDYRUVWHKHQGHQ *HVWDOW LQ 0LOLWÂ&#x201D;UWUDFKW PLW XPJHKÂ&#x201D;QJWHP 'ROFK)UDJPHQWDULVFK u 3URYHQLHQ] $XV GHU 6DPPOXQJ 76 /RQ GRQHUZRUEHQLQGHQHUHU-DKUHQ LQ/RQGRQ )UDJPHQWDU\ OLPHVWRQH }JXUH RI D PLOLWDU\ KHURZLWKKRUVHVWUGFHQWXU\$'

122 Tauroktonie. 5¤PLVFKH .DLVHU]HLW  -KQ&KU)ODFKHVGXUFKEURFKHQ JHDUEHLWHWHV5HOLHIDXVHWZDVJURENUL VWDOOLQHP0DUPRU%FP+FP ,P+DXSWIHOGGHUSHUVLVFKH*RWW0L WKUDV GHU GHQ 8UVWLHU HUVWLFKW XQG GDPLW HLQH 1HXHUVFKDIIXQJ GHU :HOW LQLWLLHUW 'HU 6WLHU ZLUG YRQ HLQHU 6FKODQJH XQG HLQHP +XQG DQJHJULI IHQ GLH GHVVHQ %OXW WULQNHQ 6HLWOLFK GLH SHUVLVFKHQ -©QJOLQJH &DXWHV XQG &DXWRSDWHV ZRKO DOV 6\PEROH I©U 6RQQHQXQWHUJDQJ XQG 6RQQHQDXI JDQJ,QHLQHPXQWHUHQ5HJLVWHUGDV PLW$UNDGHQLQGUHL%LOGIHOGHUJHJOLH GHUW LVW OLQNV GDV 5HJHQZXQGHU EHL GHPHLQNQLHQGHU+LUWHGHQ*RWWXP HLQH %HHQGLJXQJ GHU '©UUH ELWWHW LQ GHU0LWWH0LWKUDVXQG6ROEHLP.XOW PDKO XQG JDQ] UHFKWV 0LWKUDV XQG 6ROLP6RQQHQZDJHQ$XV)UDJPHQ WHQ ]XVDPPHQJHVHW]W REHUHU 7HLO IHKOW u

121

3URYHQLHQ]([6DPPOXQJ.7)UDQNUHLFK 'HXWVFKODQGVHLWFDHU-DKUH (LQHJXWH=XVDPPHQIDVVXQJLQ6SÂ&#x201D;WDQWLNH XQG IU©KHV &KULVWHQWXP $XVVWHOOXQJ )UDQNIXUW6II

122

$ PDUEOH UHOLHI VKRZLQJ VFHQHV IURP WKH PLWKUDLF FXOW ,Q WKH PDLQ SDQHO 0LWKUDV VDFUL}FLQJ WKH EXOO DVVLVWHG E\ D VQDNH DQG DGRJZLWK&DXWHVDQG&DXWRSDWHVZDWFKLQJ DWWKHVLGHV%HORZDVPDOOHUIULH]HZLWKWKUHH VFHQHV UDLQ ZRQGHU VKHSSHUG SUD\LQJ WR 0LWKUDV PHDORI6RODQG0LWKUDV0LWKUDV DQG 6RO LQ WKH FKDULRW 5RPDQ ,PSHULDO 3HULRGQGUGFHQWXU\$'5HDVVHPEOHG ZLWKWKHXSSHUSDUWPLVVLQJ

123 .RSWLVFKHV 5HOLHIIUDJPHQW    -K Q&KU:HLgHU.DONVWHLQ%+ FP7FP$XVVFKQLWWDXVHLQHP %RJHQUHOLHI PLW HLQHP VSULQJHQGHQ .DOE ]ZLVFKHQ 5DQNHQ 0RQWLHUW LQ HLQHP+RO]UDKPHQ6SUXQJ u 3URYHQLHQ] ([ 6DPPOXQJ 5 : +HVVHQ )DPLOLHQEHVLW]VHLWYRU 123

96

&RSWLF OLPHVWRQH UHOLHI IUDJPHQW VKRZLQJ D MXPSLQJFDOIEHWZHHQWHQGULOVWKWKFHQWXU\ $'0RXQWHGLQDIUDPH}VVXUH


BRONZESKULPTUR

124

97


124

124 Bronzeadler. 5¤PLVFKH .DLVHU]HLW    -K Q &KU %URQ]H YROOJXVV + FP / FP 5XKLJ VWHKHQGHU *UHLIYRJHO PLW OHLFKW JHQHLJWHP .RSI XQG HLQJHNODSSWHQ )O©JHOQ 'LH )HGHUQ VLQG JUDSKLVFK LQVNULELHUW XQG QXU ZHQLJ SODVWLVFK JHVWDOWHW Herrliche olivgrüne Patina!)©gHJHEURFKHQVHLWOLFKHU5LVV 36.000,â&#x20AC;&#x201C; 98

Provenienz: Ex Sammlung M.B., Bayern, seit mindestens vor 1953. Danach weiterhin Familienbesitz. %URQ]HFDVWVWDWXHRIDOLIHVL]HVWDQGLQJHDJOHWKHIHDWKHUVVOLJKWO\HQJUDYHG 5RPDQ,PSHULDO3HULRGUGWKFHQWXU\$'1LFHROLYHJUHHQSDWLQDIHHW EURNHQDWRQHVLGH}VVXUH


124A

124A ,VLV)RUWXQD 5¤PLVFKH .DLVHU]HLW  -K Q &KU %URQ]HKRKO JXVV + FP )LJXULQH GHU *¤WWLQ ,VLV)RUWXQD LQ $SKURGLWH Â&#x201D;KQOLFKHP+DELWXVPLWXPGLH+©IWHQJHVFKOXQJHQHP+LPDWLRQ XQG OHLFKW ©EHU GHU OLQNHQ 6FKXOWHU KHUDEJHUXWVFKWHP DQ GHQ Â&#x160;UPHOQ JHNQ©SIWHP GXUFKVFKHLQHQGHP 8QWHUJHZDQG $XI GHP.RSIWUÂ&#x201D;JWVLHHLQH*HLHUKDXEHPLWDXIJHVHW]WHU.URQHYRQ GHU QXU GHU XQWHUH 7HLO HUKDOWHQ LVW 'LH $UPH ZDUHQ VHSDUDW JHIHUWLJW ZREHL GLH OLQNH +DQG YRU GLH 6FKDP JHI©KUW  HLQHQ %DXVFKGHV+LPDWLRQKLHOW)HLQH$UEHLW6FK¤QHURWEUDXQH3DWL QD)©gHXQG.URQHJHEURFKHQ u

124A

3URYHQLHQ]([6DPPOXQJ06:LHQ(UZRUEHQEHL'U$$0©QFKHQ Ende der 1970er / 1980er Jahre. $EURQ]H}JXULQHRI,VLV)RUWXQDLQWKHW\SHRI9HQXVZHDULQJ&KLWRQDQG Himation. On the head a vulture cap and a crown. Roman Imperial Period, QGFHQWXU\$'$UPV PLVVLQJ ZRUNHGVHSDUDWHO\IHHWDQGWRSRIWKHFURZQ ORVW$WWUDFWLYHSDWLQD}QHTXDOLW\

99




 6LOEHUVWDWXHWWHGHU9HQXV5¤PLVFKH.DLVHU]HLW-KQ&KU + FP 6LOEHUJXVV .RQWUDSRVWLVFK VWHKHQGH 9HQXV GLH LQ GHU UHFKWHQ +DQG HLQHQ $SIHO KÂ&#x201D;OW XQG LQ HLQHQ 6SLHJHO GHQ VLHLQGHUOLQNHQ+DQGWUÂ&#x201D;JWEOLFNW$XIGHU6FKXOWHUXQGGHP 2EHUN¤USHUOLHJHQ+DDUVWUÂ&#x201D;KQHQGLHVLFKJHO¤VWKDEHQ$XIGHP .RSI WUÂ&#x201D;JW VLH HLQH 6WHSKDQÂ&#x2DC; 0LW 0HWDOODQDO\VH YRQ 5HVWDXUD Heerlen!'XQNOH7¤QXQJLQWDNW u 3URYHQLHQ]([6DPPOXQJ*-$0/1LHGHUODQGHVHLW 6LOYHUFDVWVWDWXHWWHRI9HQXVZLWKDSSOHDQGPLUURU5RPDQ,PSHULDO3HULRG VWQGFHQWXU\$'7LQWHGLQWDFWWith metall analysis of Restaura, Heerlen!

$ Hermes. 5¤PLVFKH.DLVHU]HLWDXJXVWHLVFK-KQ&KU%URQ ]HYROOJXVV PLW ]XJHK¤ULJHU SUR}OLHUWHU 5XQGEDVLV 6SXUHQ GHV HKHPDOLJHQ%OHLYHUJXVVHVHUKDOWHQ /LSSHQXQG%UXVWZDU]HQLQ .XSIHU HLQJHOHJW $XJHQ LQ 6LOEHU 6FKUHLWHQGHU QDFNWHU +HU PHVPLWHLQHPDQGHUOLQNHQ6FKXOWHUJH}EHOWHP0DQWHO,QGHU 5HFKWHQHLQ*HOGEHXWHOGLH/LQNHKLHOWHLQ.HU\NHLRQYRQGHP GHUXQWHUH$QVDW]HUKDOWHQLVW,PNXU]HQ%XFNHOORFNHQKDDUOLHJW HLQH%LQGHPLW)HGHUDQGHU6WLUQ$QGHQ6FKOÂ&#x201D;IHQ)O©JHOHer DXVUDJHQGH4XDOLWÂ&#x201D;W u 3URYHQLHQ]([6DPPOXQJ06:LHQ(UZRUEHQEHL'U$$0©QFKHQ Ende der 1970er / 1980er Jahre. $ EURQ]H }JXULQH RI +HUPHV RQ D SUR}OHG URXQG EDVH 5RPDQ ,PSHULDO 3HULRGVWFHQWXU\$'$XJXVWHDQHUD(\HVLQODLGLQVLOYHUOLSVDQGQLSSOHV in copper. Finest quality!

100


$

101


126 127

126 %UXVWEDQGO¤VHQGH9HQXV5¤PLVFKH.DLVHU]HLW-KQ&KU+ FP %URQ]HYROOJXVV .RQWUDSRVWLVFK VWHKHQGH 9HQXV ¤IIQHW GDV6WURSKLRQ6FK¤QHURWJU©QH3DWLQD)XgVSLW]HQJHEURFKHQ VRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ'U.%%D\HUQH[*RUQ\ 0RVFK$XNWLRQ /RV 'HUVHOWHQH7\SXVGHUEUXVWEDQGO¤VHQGHQ9HQXVwLVWDXFKLQHLQLJHQZHQLJHQ 0DUPRUVWDWXHQ 0HWURSROLWDQ0XVHXP1HZ<RUN0XVHR7RUORQLD5RP  ©EHUOLHIHUWXQGJHKWYHUPXWOLFKDXIHLQVS”WKHOOHQLVWLVFKHV9RUELOG]XU©FN V /,0&,,I1UIIVY$SKURGLWH 'LH)ULVXUGHU*¤WWLQZXUGHLQ XQVHUHU%URQ]HVWDWXHWWHGHU]HLWJHQ¤VVLVFKHQ0RGHDQJHSDVVWGLHORFNHUH NODVVL]LVWLVFKH6FKLFKWXQJGHUVHLWOLFKHQ6WU”KQHQYHUEXQGHQPLWHLQHU0H ORQHQIULVXUwDXIGHU.DORWWHXQGHLQHPJURgHQ'XWWLP1DFNHQ}QGHWVLFK JDQ]”KQOLFKEHL3RUWU”WVGHU.DLVHULQ&ULVSLQDGHU*DWWLQGHV&RPPRGXV %URQ]HVROLGFDVWVWDWXHWWHRI9HQXVVROYLQJKHUFKHVWVWUDS5RPDQ,PSHULDO 3HULRGQGFHQWXU\$'$WWUDFWLYHUHGJUHHQSDWLQDWLSVRIWKHIHHWEURNHQ otherwise intact.

102

127 9HQXV 'RQDXSURYLQ]HQ   -K Q &KU + FP %URQ ]HYROOJXVV 1DFNWH VWHKHQGH 9HQXV PLW 'LDGHP XQG ©EHU GLH 6FKXOWHUQ KHUDEIDOOHQGHQ +DDUORFNHQ 'LH UHFKWH +DQG GLH ZRKO HKHPDOV HLQH 6FKDOH KLHOW QDFK YRUQH JHVWUHFNW 0LW GHU OLQNHQ +DQG K”OW VLH HLQHQ *UDQDWDSIHO *XWHU 6WLO +HUUOLFKH JU©QH 3DWLQD O 'DXPHQ X =HLJH}QJHU VRZLH UHFKWHU )Xg JH EURFKHQVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ'U.%%D\HUQH[*RUQ\ 0RVFK$XNWLRQ /RV %URQ]HVROLGFDVWVWDWXHWWHRIVWDQGLQJQDNHG9HQXVZLWKGLDGHPDQGORQJ FXUO\KDLUDQGDSRPHJUDQDWHLQKHUOHIW7KHULJKWKDQGRULJLQDOO\KHOGD SKLDOH'DQXELDQSURYLQFHVVWQGFHQWXU\$'$WWUDFWLYHJUHHQSDWLQD left thumb and index and right foot broken, intact.


129 128

128 9HQXV'RQDXSURYLQ]HQ-KQ&KU+FPPLWDQWLNHP UXQGHPSUR}OLHUWHP6RFNHO%URQ]HYROOJXVV1DFNWHVWHKHQGH 9HQXV PLW +DDUNQRWHQ DXI GHP .RSI XQG ©EHU GLH 6FKXOWHUQ KHUDEIDOOHQGHQ+DDUORFNHQ'LHUHFKWH+DQGEHGHFNWGLH%UXVW GLH/LQNHGLH6FKDP*XWHU6WLO*U©QH3DWLQDLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ 'U .% %D\HUQ (UZRUEHQ LP 0©QFKQHU Kunsthandel, wohl 2000er Jahre. %URQ]HVROLGFDVWVWDWXHWWHRIVWDQGLQJQDNHG9HQXVZLWKKDLUNQRWDQGORQJ FXUO\KDLU7KHULJKWKDQGLVFRYHULQJKHUEUHDVWWKHOHIWKDQGLVFRYHULQJKHU SXELV2QDQDQWLTXHURXQGEDVH'DQXELDQSURYLQFHVVWQGFHQWXU\$' Green patina, intact.

129 3URYLQ]LDOU¤PLVFKH 6WDWXHWWH GHU 9HQXV    -K Q &KU + FP %URQ]HYROOJXVV 1DFNWH VWHKHQGH 9HQXV PLW ODQJHP ©EHU GHU 6WLUQ JHVFKHLWHOWHP +DDU GDV LP 1DFNHQ ]X HLQHP 'XWW]XVDPPHQJHQRPPHQLVWXQGDQGHQ6FKXOWHUQLQODQJHQ 6WUÂ&#x201D;KQHQ KHUDEIÂ&#x201D;OOW 'LH UHFKWH +DQG GLH ZRKO HKHPDOV HLQH 6FKDOHKLHOWQDFKYRUQHJHVWUHFNW0LWGHUOLQNHQ+DQGKÂ&#x201D;OWVLH HLQ(QGHGHV=RSIHVHPSRU7\SLVFKHU6WLOGHU'RQDXSURYLQ]HQ 6FK¤QHGXQNHOJU©QHXQGURWEUDXQH3DWLQDLQWDNW 2.000,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ'U.%%D\HUQH[*RUQ\ 0RVFK$XNWLRQ /RVH[*RUQ\ 0RVFK$XNWLRQ/RV %URQ]HVROLGFDVWVWDWXHWWHRIQDNHG9HQXVZULQJLQJKHUKDLUZLWKWKHOHIW KDQG7KHORZHUHGULJKWKDQGSUREDEO\KHOGDSKLDOHLQDQWLTXLW\VWQG FHQWXU\$'3URYLQFLDOVW\OHJUHHQDQGUHGGLVKSDWLQDLQWDFW

103


129A

129A Hermaphrodit. 5¤PLVFKH.DLVHU]HLW-KQ&KU%URQ]H YROOJXVV+FP*HVWDOWPLWZHLEOLFKHU)ULVXUXQG.¤USHUELO GXQJGLHLKUODQJHV*HZDQG©EHUGHQ%DXFKQDEHODQKHEWXQG HUVWDXQWDXILKUNOHLQHVDEHUHUUHJWHVPÂ&#x201D;QQOLFKHV*HVFKOHFKWVWHLO EOLFNW6FK¤QHJU©QH3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ06:LHQ(UZRUEHQEHL'U$$0©QFKHQ Ende der 1970er / 1980er Jahre. %URQ]H}JXUHRIKHUPDSKURGLWRVOLIWLQJKLVORQJVKLUWFRQWHPSODWLQJRQKLV JHQLWDOV5RPDQ,PSHULDO3HULRGVWQGFHQWXU\$'*UHHQSDWLQDLQWDFW

104

130

130 *DXNOHU " 5¤P.DLVHU]HLW-KQ&KU%URQ]HYROOJXVV PLW DQWLNHP 6RFNHO + FP PLW 6RFNHO  $XI HLQHP ]\OLQ GULVFKHQ 3RGHVW PLW HLQJH]RJHQHQ 6HLWHQ VWHKHQGH PÂ&#x201D;QQOLFKH )LJXUJHNOHLGHWLQHLQHK©IWODQJHNXU]Â&#x201D;UPHOLJH7XQLFDGLHDP 1DFNHQ PLW HLQHU .DSX]H YHUVHKHQ LVW 'HU VWÂ&#x201D;PPLJH 0DQQ WUÂ&#x201D;JW HLQHQ NXU]HQ %DUW XQG HLQH NXU]H 6LFKHOORFNHQIULVXU ,Q GHU5HFKWHQKÂ&#x201D;OWHUHLQHQVFKHLEHQI¤UPLJHQ*HJHQVWDQGLQGHU JHVHQNWHQ/LQNHQ.URWDOHQ " 6FK¤QHJU©QH3DWLQDLQWDNW 3.000,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ,./RQGRQVHLWFD 'LH'HXWXQJGHU)LJXULVWXQNODU'DV©EHUJURgH*HVFKOHFKWPDJI©U3ULDSXV VSUHFKHQDEHUDQGHUH$WWULEXWHGLHVHV*RWWHVIHKOHQ*URWHVN©EHUWULHEHQH *HVFKOHFKWVWHLOHVLQGDXFKHLQH(LJHQKHLWYRQ*DXNOHUGDUVWHOOXQJHQZRI©U YLHOOHLFKWDXFKGDV,QVWUXPHQWXQGGDVPHUNZ©UGLJH.OHLGXQJVVW©FNHLQH 0LVFKXQJDXV3DHQXODXQG7XQLFDVSUHFKHQPDJ


132 131

%URQ]H}JXULQHRIDMHVWHU " ZLWKHQRUPRXVSKDOOXVZHDULQJDVKRUWWXQLF ZLWKKRRGNURWDOHV " DQGDURXQGGLVNLQKLVULJKW5RPDQ,PSHULDO3HULRG VWUGFHQWXU\$'2QDQFLHQWSHGHVWDO*UHHQSDWLQDLQWDFW

%URQ]HVROLGFDVWVWDWXHWWHRIDVWDQGLQJQDNHG\RXQJPDOH,WDOLFODWHWK FHQWXU\ %& %URZQ SDWLQD ORZHU OHJV EURNHQ DQG UHDWWDFKHG ZLWK WLQ\ fragments missing.

131 .RXURV,WDOLVFK-KY&KU+FP%URQ]HYROOJXVV1DFN WHUVWHKHQGHU-©QJOLQJPLWJHVFKORVVHQHQ%HLQHQXQGDQJHOHJ WHQ$UPHQ:DKUVFKHLQOLFKHLQH6W©W]}JXU*XWHU6WLO%UDXQH 3DWLQD8QWHUVFKHQNHOJHEURFKHQXQGZLHGHU]XVDPPHQJHVHW]W PLWZLQ]LJHQIHKOHQGHQ)UDJPHQWHQ u

132 =HXV RGHU 3RVHLGRQ 5¤PLVFK    -K Q &KU + FP %URQ]HYROOJXVV 1DFNWHU LP $XVIDOOVFKULWW VWHKHQGHU EÂ&#x201D;UWLJHU *RWWPLWHUKREHQHU5HFKWHUXQGYRUJHVWUHFNWHU/LQNHU6FK¤QH JU©QH3DWLQD u

3URYHQLHQ] ([ 6DPPOXQJ 'U .% %D\HUQ (UZRUEHQ LP 0©QFKQHU Kunsthandel, wohl 2000er Jahre. 9JO6&DVVDQL +UVJ 7KH$UWRIWKH,WDOLF3HRSOHVIURPWR%& $XVVWHOOXQJ*HQI  6I

3URYHQLHQ]$XV6DPPOXQJ/-1LHGHUODQGHH[*RUQ\ 0RVFK$XNWLRQ /RVDXV86DPHULNDQLVFKHP3ULYDWEHVLW] %URQ]H}JXUHRI=HXVRU3RVHLGRQQGUGFHQWXU\$'$WWUDFWLYHSDWLQD hands and right leg broken.

105


133 134

133 6WDWXHWWH GHV 0HUNXU 5¤PLVFK    -K Q &KU + FP %URQ]HYROOJXVV'HWDLOVLQ.DOWDUEHLW.RQWUDSRVWLVFKVWHKHQGHU 0HUNXU PLW .RSI~©JHOQ *HOGE¤UVH XQG JH~©JHOWHP .HU\NHL RQ 'HU 0DQWHO OLHJW DXI GHU OLQNHQ 6FKXOWHU XQG LVW YRQ GRUW ©EHUGHQ5©FNHQXPGHQ$UPJHI©KUWYRQGHPHUKHUDEIÂ&#x201D;OOW )OXVVSDWLQDPHVVLQJIDUEHQZLQ]LJH)UDJPHQWHGHV.HU\NHLRQV IHKOHQ u

134 -XJHQGOLFKHU$WKOHW5¤P.DLVHU]HLW-KQ&KU%URQ]HYROO JXVV+FP1DFNWHUVWHKHQGHU-©QJOLQJLQNODVVL]LVWLVFKHP 6WLO'XQNHOJU©QH3DWLQDUHFKWHU8QWHUDUPXQG)XgXQGOLQNHU 8QWHUVFKHQNHOJHEURFKHQ u

3URYHQLHQ]([6DPPOXQJ*-$0/1LHGHUODQGHVHLW

%URQ]H}JXULQHRIDQDNHGEURDGVKRXOGHUHGDWKOHWH5RPDQ,PSHULDO3HULRG VWFHQWXU\$'5LJKWDUPDQGOHIWORZHUOHJEURNHQ$WWUDFWLYHJUHHQSDWLQD

Bronze statuette of standing Mercury with tiny wings in the hair, purse and kerykeion, the mantle is lying over the left shoulder and falling down from WKHDUP5RPDQVWQGFHQWXU\$'5LYHUSDWLQDEUDVVFRORXUHGWLQ\ fragments of the kerykeion missing.

106

3URYHQLHQ]$XV6DPPOXQJ/-1LHGHUODQGHH[*RUQ\ 0RVFK$XNWLRQ /RV




136

 $SKURGLWH PLW 6SLHJHO 5¤P .DLVHU]HLW  -K Q &KU ZRKO DQWRQLQLVFK + FP %URQ]HYROOJXVV 6WHKHQGH $SKURGLWH PLW YRUGHU6FKDPYHUNQRWHWHP+©IWPDQWHOPLWHLQHP.ODSSVSLHJHO LQGHU5HFKWHQXQGHLQHP'LDGHPLP+DDUGDVLQGHU0RGHGHV IRUWJHVFKULWWHQHQ-KVQ&KUIULVLHUWLVW5]XLKUHQ)©gHQHLQ NOHLQHV%HFNHQLQGHPHLQH7DXEHVLW]W6DPWLJHJU©QH3DWLQD LQWDNW u

136 +HUDNOHV(WUXULHQ-KY&KU+ RKQH6RFNHO FP%URQ ]HYROOJXVV )URQWDO VWHKHQGHU QDFNWHU +HUDNOHV PLW NXU]HP +DDUVFKQLWW8PGHQOLQNHQ$UPGDV/¤ZHQIHOOJHZLFNHOWYRQ GHPDXFKHLQ7HLOKHUDEIÂ&#x201D;OOW'LHHUKREHQH5HFKWHKÂ&#x201D;OWGLH.HX OH 0LW GHU 5HFKQXQJ GHU *DOHULH 6FKPLGW 0©QFKHQ .RSLH  'XQNHOJU©QH3DWLQDHLQ)Xg]XP6RFNHOJHQDGHOWVRQVWLQWDNW u

3URYHQLHQ]$XV6DPPOXQJ/-1LHGHUODQGHH[*RUQ\ 0RVFK$XNWLRQ /RV

Provenienz: Erworben in Southampton in den 1980er Jahren; erworben bei *DOHULH:6FKPLGW0©QFKHQH[6DPPOXQJ0*0©QFKHQ

%URQ]H}JXULQHRI9HQXVKROGLQJDIROGLQJPLUURULQKHUULJKWKDQG$GLDGHP VLWVLQKHUKDLUZKLFKLVGRQHLQWKHIDVKLRQRIWKH$QWRQLQH3HULRG%HVLGHV KHUDGRYHRQDVWHPPHGEDVLQ5RPDQ,PSHULDO3HULRGQGFHQWXU\$' Green patina, intact.

(WUXVFDQEURQ]H}JXUHRI+HUDFOHVZLWKDOLRQVNLQDQGDFOXEWKFHQWXU\ %&'DUNSDWLQDRQHOHJLVQDLOHGWRWKHEDVHRWKHUZLVHLQWDFW

107


137 .QLHQGHU .QDEH Römische Kaiser ]HLW-KQ&KU+FP%URQ ]HYROOJXVV .QDEH LQ NXU]Â&#x201D;UPHOLJHU 7XQLND LQ NQLHQGHU $EZHKUKDOWXQJ GDV UHFKWH .QLH DXIJHVHW]W GDV OLQNH DQJH]RJHQGLH5HFKWHDXIGHQ%RGHQ JHVW©W]W GLH /LQNH DEZHKUHQG HUKR EHQ'HQYRUJHVWUHFNWHQ.RSIPLWLQ 6LOEHU HLQJHOHJWHQ $XJHQ VFKP©FNW ORFNLJHV©EHUGLH6FKXOWHUQKLQDEIDO OHQGHV+DDU*U©QH3DWLQDLQWDNW 2.000,â&#x20AC;&#x201C; 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ /RQGRQ %URQ]H }JXUH RI D NQHHOLQJ ER\ ZLWK ORQJ curly hair in defensive posture with the left arm raised protecting his head. He is wearing a short tunic. Eyes inlaid in silver. Green patina, intact. Roman Imperial Period, 1st / QGFHQWXU\$'

137

138 0LQLDWXUJUXSSH PLW 7DXURNWRQLH Rö PLVFK    -K Q &KU / FP + FP %URQ]HYROOJXVV 0LWKUDV EH NOHLGHW PLW +RVHQ XQG HLQHU 7XQL NDNQLHWPLWZHKHQGHP0DQWHOXQG SKU\JLVFKHU .DSSH PLW GHP OLQNHQ %HLQDXIGHP5©FNHQHLQHV]X%RGHQ JHVXQNHQHQ6WLHUHVUHLgWPLWGHU/LQ NHQGHQ.RSIGHV6WLHUHVQDFKKLQWHQ XQGYHUVHW]WLKPPLWGHU5HFKWHQHL QHQ 'ROFKVWRg 0LWKUDV EOLFNW GDEHL ]XP %HWUDFKWHU $XI GHU 5©FNVHLWH 6W©W]HQZRKOXUVSU©QJOLFKHLQ*HUÂ&#x201D; WHRGHU0¤EHODXIVDW]%UDXQH3DWLQD LQWDNW u Provenienz: Ex Wiener Privatsammlung M.S., seit 1990er Jahren. 'DV 0RWLY GHU 6WLHUW¤WXQJ JULHFK tauroktonoj  LPLWLHUW NODVVLVFKH JULHFKLVFKH 'DUVWHOOXQJHQ GHU JH~©JHOWHQ 1LNHGLHHLQHQ6WLHUW¤WHW.DQRQLVLHUWZXUGH GDV'DUVWHOOXQJVVFKHPDXPY&KUYRQ einer Bildhauerschule in Pergamon. Das 0RWLY GHU GHQ 6WLHU W¤WHQGHQ 1LNH NDP XQWHUGHU+HUUVFKDIWGHV.DLVHUV7UDMDQ    Q &KU  ZLHGHU LQ 0RGH XQG ZXUGH ]XP9RUELOGI©UGLH7DXURNWRQLHLP0LWKUDV Kult, in dem sie das wichtigste Motiv darstellt. In den unterschiedlichen Gattungen Malerei, 6NXOSWXUXQG5HOLHI}QGHWVLFKGDV0RWLYLP 0LWWHOSXQNWYRQMHGHP0LWKUÂ&#x201D;XP

138

108

Bronze miniature group depicting the tauroctony: Mithras with Phrygian cap kneeling on a bull by killing him. Roman, QGUGFHQWXU\$'%URZQSDWLQDLQWDFW


139 Reitender Imperator. Röm. Kaiser ]HLW-KQ&KU=ZHLWHLOLJPDVVLYH %URQ]HPLW6LOEHUHLQODJHQ+FDFP 5¤PLVFKHU )HOGKHUU LQ 0LOLWÂ&#x201D;UWUDFKW DXI HLQHP JDORSSLHUHQGHP 3IHUG 'LH5HFKWHLVWHUKREHQXQGKLHOWHKH PDOV HLQHQ 6SHHU 'LH .XU]KDDUIUL VXU XQG GDV &LQJXOXP GDV =HLFKHQ GHV %HIHKOVKDEHUV GHXWHQ DXI HLQHQ 6ROGDWHQNDLVHU GHV  -KV *HZLVVH Â&#x160;KQOLFKNHLWEHVWHKW]X6HYHUXV$OH[ DQGHU*U©QH3DWLQDLQWDNW u Provenienz: Ex Sammlung D.G., in Bayern seit ca. 2000. %URQ]HWZRSDUWLWHPLQLDWXUHEURQ]H}JXUHRID ULGLQJHPSHURUSUREDEO\6HYHUXV$OH[DQGHU %URQ]H ZLWK VLOYHU LQOD\V UG FHQWXU\ $' Green patina, intact.

139

140 %URQ]HQH .ULHJHU}JXU 8PEULHQ FD  -K Y &KU / FP 9ROOJXVV 1DFNWHU LP $XVIDOOVFKULWW VWHKHQGHU VFKHPDWLVFKHU.ULHJHUGLH$UPHZHLW YRP .¤USHU JHVWUHFNW PLW HLQHP +HOP PLW KRKHP +HOPEXVFK 'DV *HVFKOHFKWVWHLO SODVWLVFK KHUYRUJH KREHQ 'LH $XJHQ GLH %UXVWZDU]HQ XQGGHU1DEHOGXUFKJHSXQ]WH.UHLVH DQJHJHEHQ'HU+HOPYRP.RSIDE JHVHW]W GHU 0XQG GXUFK HLQH .HUEH DQJHJHEHQ GDV *HVLFKW GUHLHFNVI¤U PLJ8QWHUGHP)XgHLQ(LQODVV]DS IHQ *U©QEUDXQH 3DWLQD UHFKWHU 8QWHUVFKHQNHOXQG$UPHQGHQIHKOHQ UHFKWHU$UPJHNOHEW u 3URYHQLHQ]([6DPPOXQJ'U0(EQ¤WKHU 6FKZHL]VHLWHUHU-DKUH 3XEOL]LHUW LQ 6 &DVVDQL +UVJ  7KH $UW RIWKH,WDOLF3HRSOHVIURPWR%& $XVVWHOOXQJ*HQI  61U  ([HPSODUYRQOLQNV  Bronze schematic naked warrior with a FUHVFHQWVKDSHG KHOPHW WKH DUPV DQG OHJV wide spread, with triangular face with punched circles for the eyes and a slash for the mouth, XQGHUWKHIRRWDSLQ8PEULDDERXWWKFHQ WXU\%&*UHHQEURZQSDWLQDULJKWORZHUOHJ and tips of the arms broken, right forearm bro ken and reattached. Published!

140

109


142

141

141 ,GRO DXV %OHL 8PEULHQ FD  -K Y &KU / FP 9ROOJXVV 6FKHPDWLVFKH ELV DXI GHQ SODVWLVFKHQ .RSI ~DFKH )LJXU PLW DXVJHVWUHFNWHQ $UPHQ XQG %HLQHQ LQ GHU UHFKWHQ +DQG HLQ /RFKI©UGLH$XIQDKPHHLQHUVHSDUDWJHIHUWLJWHQ/DQ]H$XIGHP .RSIHLQH6FKHLEH]XU:LHGHUJDEHGHV+HOPEXVFKHVGLH$XJHQ DOV JHSXQ]WH .UHLVH GHU 0XQG GXUFK HLQH .HUEH DQJHJHEHQ 'LH%UXVWZDU]HQXQGGHU1DEHOJHSXQ]WH.UHLVHGDUXQWHU]ZHL /LQLHQ GLH GLH 8QWHUNDQWH GHV 3DQ]HUV ZLHGHUJHEHQ VROOHQ *UDXEUDXQH3DWLQDUHFKWHV%HLQYHUERJHQ/DQ]HJHEURFKHQ 1.000,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ'U0(EQ¤WKHU6FKZHL]VHLWHUHU Jahre. 3XEOL]LHUWLQ6&DVVDQL +UVJ 7KH$UWRIWKH,WDOLF3HRSOHVIURPWR

110

%&$XVVWHOOXQJ*HQI  61UE UHFKWH)LJXU]ZLVFKHQ]HLWOLFK YHUERJHQ  &DVWOHDGLGROGHSLFWLQJDVFKHPDWLFZDUULRU}JXUHZKLFKLVDSDUWRIWKHKHO PHWHGKHDG~DW,QWKHULJKWKDQGDKROHIRUDVHSDUDWHO\ZRUNHGVSHDU(\HV nipples and navel as punched circles, under the navel two lines representing a EHOWWKHPRXWKLQGLFDWHGE\DJURRYH8PEULDDERXWWKFHQWXU\%&*UH\ brown patina, right leg slightly bent, lance broken. Published!

142 Krieger mit Umhang. ,EHULVFKFD-KY&KU%URQ]HYROO JXVV+FP.ULHJHUPLWHLQHUERGHQODQJHQ7XQLFDXQGHLQHP 8PKDQJ EHNOHLGHW GHU LQ GHU OLQNHQ +DQG XUVSU©QJOLFK HLQH /DQ]HWUXJGLH5HFKWHLVWPLWGHU+DQGLQQHQ~Â&#x201D;FKHQDFKYRU


142

143

QH LP 2UDQWHQJHVWXV DXVJHVWUHFNW 'HU 5XQGVFKLOG K”QJW DXI GHP5©FNHQ*U©QH3DWLQD5HVWHYRQ6LQWHU$WWULEXWGHUOLQ NHQ+DQGYHUORUHQLQWDNW u Provenienz: Ex Sammlung M.E., Schweiz, seit 1970er Jahren. 9JO'LH,EHUHU$XVVWHOOXQJ3DULV%DUFHORQD%RQQ  61U %URQ]HYRWLYH}JXUHGHSLFWLQJDZDUULRUZLWKRULJLQDOO\KHOGDVSHDULQWKHOHIW KDQG$URXQGVKLHOGDWWKHEDFNKHLVVWDQGLQJZLWKKLVULJKWKDQGH[WHQGHG SDOPVRXWZDUGLQVXSSOLFDWLRQ,EHULDQDERXWWKUGFHQWXU\%&*UHHQ patina, traces of sinter, attribute of the left hand missing, intact.

143 „Priester“. ,EHULVFK FD    -K Y &KU %URQ]HYROOJXVV + FP6FKODQNH)LJXUPLWVHLWOLFKDQJHOHJWHQ$UPHQXQGYRU VWHKHQGHQ)©gHQ'DV*HZDQGLVWGXUFKIHLQH5LW]OLQLHQDQJH JHEHQ/”QJOLFKHU.RSIPLWPDQGHOI¤UPLJHQ$XJHQ7RQVXUw XQG :XOVWOLQLH DP 1DFNHQ +HUUOLFKH GXQNHOJU©QH 3DWLQD LQ WDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ/RQGRQ 9JO'LH,EHUHU$XVVWHOOXQJ3DULV%DUFHORQD%RQQ  61U %URQ]HYRWLYH}JXUHGHSLFWLQJDVOHQGHUSULHVW " ZHDULQJDORQJGUHVV,EHULDQ DERXWWKUGFHQWXU\%&$WWUDFWLYHJUHHQSDWLQDLQWDFW

111


144 

144 6WDWXHWWH DXV %OHL 5¤PLVFKH .DLVHU]HLW  9LHUWHO  -K Q &KU+FP+HUPHQI¤UPLJH*HVWDOWPLWJURgHP.RSIXQG IHOOÂ&#x201D;KQOLFKHU%HNOHLGXQJ%HLJH3DWLQDLP+DOVJHEURFKHQXQG ZLHGHUDQJHVHW]W u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5HUZRUEHQLQGHQ 1970er bis 1980er Jahren. /HDG}JXULQHRIDJRGLQIRUPRIDKHUPD5RPDQ,PSHULDO3HULRGQGTXDUWHU QGFHQWXU\$'%HLJHSDWLQDEURNHQDWWKHQHFNDQGUHDWWDFKHG

 -XJHQGOLFKHU3ULDSRV-KQ&KU+FP%URQ]HYROOJXVV 8QEÂ&#x201D;UWLJHU LWK\SKDOOLVFKHU 3ULDSRV PLW )UXFKWVFKXU] XQG *HOGEHXWHO%UDXQH3DWLQD)©gHJHEURFKHQ u 3URYHQLHQ]$XV6DPPOXQJ/-1LHGHUODQGHH[*RUQ\ 0RVFK$XNWLRQ /RV <RXQJLWK\SKDOOLFEURQ]H3ULDSRV5RPDQVWQGFHQWXU\$'1LFHEURZQ patina, feet broken.

146

146 6WDWXHWWH GHV 0HUNXU 5¤PLVFK    -K Q &KU + FP %URQ]HYROOJXVV'HWDLOVLQ.DOWDUEHLW$XIHLQHP)HOVVLW]HQGHU 0HUNXU PLW 3HWDVRV PLW )O©JHOQ *HOGE¤UVH XQG )O©JHOVFKX KHQXPGHQ+DOVWUÂ&#x201D;JWHUHLQHQVLOEHUQHQ5LQJPLWJUDYLHUWHP =LFN]DFN'HNRUXQGHLQHQ0DQWHO'HU)HOVJHKWLQHLQH3OLQWKH ©EHU'XQNHOJU©QH3DWLQDZLQ]LJHV)UDJPHQWGHU3OLQWKHIHKOW HLQ$UPJHNOHEW u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ06HU-DKUH Bronze statuette of sitting Mercury with winged petasos, mantle and purse,

112


around the neck a silver ring with engraved ]LJ]DJGHFRUDWLRQ5RPDQVWQGFHQWXU\$' Darkgreen patina, tiny fragment of plinth missing, one arm reassembled.

147 6WDWXHWWH GHV +DUSRNUDWHV 5¤PLVFK    -K Q &KU + FP %URQ]HYROOJXVV 'HWDLOV LQ .DOWDUEHLW +DUSRNUDWHV VWHKW IURQWDO XQG KDW GHQ UHFKWHQ =HLJH}QJHU ]XP 0XQG JHI©KUW ,P OLQNHQ $UP WUÂ&#x201D;JW HU HLQ )©OOKRUQ GHU 0DQWHO OLHJW ©EHU GHU OLQNHQ 6FKXOWHU $XI GHP .RSI WUÂ&#x201D;JW HU HLQHQ %O©WHQNUDQ] XQG GDU©EHUGLH'RSSHONURQHYRQ2EHUXQG 8QWHUÂ&#x201D;J\SWHQ*U©QH3DWLQDLQWDNW u 3URYHQLHQ] ([ V©GGHXWVFKH 3ULYDWVDPPOXQJ M.S., 1970er Jahre. Bronze statuette of standing Harpokrates with GRXEOH FURZQ 5RPDQ VW  QG FHQWXU\ $' Green patina, intact.

147

148 =HXV5¤P.DLVHU]HLW-KQ&KU 6LOEHUPDVVLY+FDFP$XIHLQHU~D FKHQ 3OLQWKH VWHKHQGHU *¤WWHUYDWHU JH NOHLGHW LQ HLQHQ +©IWPDQWHO GHU GHQ 2EHUN¤USHUIUHLOÂ&#x201D;VVWDEHUPLWHLQHP=LS IHODXIGHUOLQNHQ6FKXOWHUDX~LHJW,QGHU 5HFKWHQHLQH6FKDOHGLHHUKREHQH/LQNH KLHOWHKHPDOVHLQ=HSWHU/HLFKWH7¤QXQJ =HSWHUIHKOWVRQVWLQWDNW u Provenienz: Ex Sammlung D.G., in Bayern seit ca. 2000. 6LOYHUPLQLDWXUH}JXUHRI=HXV5RPDQ,PSHULDO Period, sceptre missing, otherwise intact.

148

113


149

149 =ZHLVLOEHUQH*¤WWHUE©VWHQ6SÂ&#x201D;WDQWLN-KQ&KU*HWULHEH QHV6LOEHU+MHFP'LHZHLEOLFKH%©VWHLVWOHLFKW]XLGHQWL} ]LHUHQ'DVLQGHU0LWWHJHVFKHLWHOWHXQGU©FNZÂ&#x201D;UWLJJU¤gWHQWHLOV YRQHLQHP6FKOHLHUEHGHFNWH+DDUWUÂ&#x201D;JWHLQJHPPHQYHU]LHUWHV 6WLUQEDQG XQG HLQ KRKHV 'LDGHP GDV ]ZLVFKHQ 5DQNHQ GLH VRJw,VLVNURQHw PLW 6RQQHQVFKHLEH DXI HLQHU 0RQGVLFKHO ]ZL VFKHQ.RUQÂ&#x201D;KUHQ]HLJW'LHVVLFKHUWGLH%HQHQQXQJDOV,VLVGLH Â&#x201D;J\SWLVFKH*¤WWLQGLHVLFKDXFKLPKHOOHQLVWLVFKHQ*ULHFKHQODQG XQGLPU¤PLVFKHQ.DLVHUUHLFKJURgHU%HOLHEWKHLWHUIUHXWH,KUHQ +DOVVFKP©FNWHLQH.HWWHPLW]DSIHQI¤UPLJHQ$QKÂ&#x201D;QJHUQXQG DP 1DFNHQ VLQG GLH I©U GLHVH *¤WWLQ W\SLVFKHQ .RUNHQ]LHKHU ORFNHQ]XHUNHQQHQ'LH,GHQWL}]LHUXQJGHUPÂ&#x201D;QQOLFKHQ%©VWH EHUHLWHWGDJHJHQ3UREOHPH(VKDQGHOWVLFKXPHLQHQ%Â&#x201D;UWLJHQ PLWWOHUHQ$OWHUVPLWPDUNDQWHQ*HVLFKWV]©JHQ$XIGHP.RSI WUÂ&#x201D;JW HU HLQH VSLW]H +DXEH PLW HLQHP YHUWLNDOHQ 0LWWHOIDO] DXI GHUVHLWOLFKMHHLQDFKWVWUDKOLJHU6WHUQHLQJUDYLHUWLVW(LQ6FKOLW] UHLFKWDXIEHLGHQ6HLWHQYRP+LQWHUNRSIELV]XP1DFNHQ$Q GHU6FKXOWHUVLQGQRFK5HVWHHLQHVUDQNHQYHU]LHUWHQ*HZDQGHV

114

]XHUNHQQHQ'HU.RSIHULQQHUWDQGLYHUVHRULHQWDOLVFKH*¤WWHU JHVWDOWHQ KDUUW DEHU QRFK HLQHU HLQGHXWLJHQ =XZHLVXQJ %HLGH .¤SIHZDUHQRIIHQEDUDQHLQHP*HUÂ&#x201D;WPRQWLHUWXQGVLQGDQGHQ 8QWHUVHLWHQEHVFKQLWWHQRGHUJHULVVHQ6W©FN 12.000,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ5*(%D\HUQ6HLWHU-DKUH ,PVSÂ&#x201D;WDQWLNHQ6\QNUHWLVPXVYHUELQGHQVLFKGLHYHUVFKLHGHQHQRULHQWDOLVFKHQ *¤WWHUJHVWDOWHQ]XYLHOIÂ&#x201D;OWLJHQ.RPELQDWLRQHQPLWGHUNODVVLVFKHQ*¤WWHUZHOW Jupiter Dolichenus wird etwa mit Serapis gleichgesetzt, Isis mit Iuno Regina XVZVRGDVVGLHPXOWLHWKQLVFKHQ%HZRKQHUGHVU¤PLVFKHQ5HLFKHVOHW]WOLFK ©EHUDOOLKUHHLJHQHQ*¤WWHUZLHGHU}QGHQNRQQWHQ9JO]%HLQ:HLKUHOLHI I©U-XSLWHU'ROLFKHQXV6SÂ&#x201D;WDQWLNHXQG&KULVWHQWXP$XVVWHOOXQJ)UDQNIXUW  II 7ZRVLOYHUEXVWVRIJRGV:KLOHWKHIHPDOHRQHZLWKWKHW\SLFDOFURZQDQG WKHORFNVDWQHFNLVHDVLO\LGHQWL}DEOHDV,VLVWKHPDOHKHDGZHDULQJDORQJ EHDUGDQGEURDGPRXVWDFKHDQGDÂ&#x20AC;WLDUDyDGRUQHGZLWKDQHLJKWUD\HGVWDU DWHDFKVLGH+HLVSUREDEO\DQRULHQWDOJRG/DWHDQWLTXLW\UGWKFHQWXU\ $'2 pieces!


 'LRQ\VRVE©VWH +HOOHQLVWLVFK    -KY&KU+FP%URQ]HKRKOJXVV 7HLOHLQHV)XOFUXPEHVFKODJV'HUMX JHQGOLFKH'LRQ\VRVWUÂ&#x201D;JWHLQ©EHUGHU 6FKXOWHU JHNQRWHWHV 7LHUIHOO ,Q GHU UHFKWHQ +DQG KÂ&#x201D;OW HU HLQHQ .DQWKD URVGHUOLQNHYRP*HZDQGXPZLN NHOWH$UPLVWHQWKXVLDVWLVFK©EHUGHQ .RSI JHOHJW $XI GHP .RSI WUÂ&#x201D;JW HU HLQHQ (IHX.RU\PEHQ.UDQ] *U©Q VFKZDU]H 3DWLQD 5DQGIUDJPHQWH GHV 0HGDLOORQV IHKOHQ HLQ +HQNHO GHV .DQWKDURVJHEURFKHQ u Provenienz: Ex H.D. Rauch, Wien 6RPPHUDXNWLRQ  /RV  H[ 6©GGHXWVFKH 3ULYDWVDPPOXQJ 06 VHLW 1970er Jahren. 9JO6)DXVW)XOFUD  7DI Part of a bronze fulcrum with the young Dionysos who holds a kantharos and stretches his right arm enthusiastically over his head. +HOOHQLVWLFQGVWFHQWXU\%&*UHHQEODFN patina, fragments of the medallionâ&#x20AC;&#x2DC;s edge missing.



 :DJHQDXIVDW] PLW 'LRQ\VRV 0LWWOHUH U¤PLVFKH.DLVHU]HLW+FP%URQ ]H %©VWH GHV MXJHQGOLFKHQ 'LRQ\VRV PLW ODQJHP DXI GLH 6FKXOWHUQ IDO OHQGHP +DDU PLW 0LWWHOVFKHLWHO XQG $QDVWROÂ&#x2DC; $XI GHU OLQNHQ 6FKXOWHU LVW HLQ 3DQWKHUIHOO YHUNQRWHW GHVVHQ 3XQNWH LQ DQGHUHP 0DWHULDO HLQJH OHJW ZDUHQ 'LH %©VWH VLW]W DXI HLQHU PLW~RUDOHQ0RWLYHQYHU]LHUWHQ%DVLV PLW]ZHLVHLWOLFKHQWRUGLHUWHQ6Â&#x201D;XOHQ $XJHQLQ6LOEHUHLQJHOHJW0LWGUHL)R WRVGHV/DQGHVPXVHXPV7ULHU 1U5( XQG 6FK¤QHGXQNHOJU© QH3DWLQDLQWDNW u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ   /RV  H[ 6DPPOXQJ +* 5KHLQODQG3IDO] =XP $XIVDW]W\SXV YJO : 0HOFKDUW $QWLNH .RVWEDUNHLWHQ DXV ¤VWHUUHLFKLVFKHP 3ULYDWEHVLW]  $EE



Bronze waggon attachment with the bust of a Dionysos with long hair and panther skin. (\HVLQODLGLQVLOYHUQGUGFHQWXU\$' 1LFHGDUNJUHHQSDWLQDLQWDFW

115


 6RNUDWHVE©VWH5¤PLVFK-KQ &KU / FD FP % FD FP %URQ ]HKRKOJXVVPLW%HIHVWLJXQJVQDJHODXI GHU5©FNVHLWHXQGUHFKWHFNLJHU$XV VSDUXQJ DP +LQWHUNRSI 8UVSU©QJ OLFK0¤EHOEHVFKODJ1DFNWH%©VWHGHV 3KLORVRSKHQ*U©QH3DWLQDLQWDNW 3.000,â&#x20AC;&#x201C; 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ   /RV  H[ 0©QFKQHU 3ULYDW sammlung M.S., 1970er Jahre. Bronze naked bust of Socrates, hollow cast with nail at the backside, originally of a IXUQLWXUH }WWLQJ 5RPDQ VW  QG FHQWXU\ $'*UHHQSDWLQDLQWDFW



 %DONHQDXIVDW] PLW %©VWH YRQ $OH[DQ der dem GroÃ&#x;en. 5¤PLVFK-K Q &KU %URQ]HKRKOJXVV 4XDGUDWL VFKH7©OOH [FP PLW5DQGGLH LQ GHU QDFNWHQ %©VWH YRQ $OH[DQGHU GHP*URgHQ +FP HQGHW'LH VH HUZÂ&#x201D;FKVW DXV HLQHP %ODWWNHOFK ©EHU GHQ 2EHUN¤USHU YHUOÂ&#x201D;XIW HLQ 6FKZHUWEDQG GHU PDNHGRQLVFKH .¤QLJ LVW PLW GHU I©U LKQ W\SLVFKHQ )ULVXU PLW $QDVWROÂ&#x2DC;  DXIJHZRUIH QHV +DDU  ©EHU GHU 6WLUQ GDUJHVWHOOW 'XQNHOJU©QH3DWLQDLQGHU7©OOHHLQ NRUURGLHUWHU(LVHQQDJHO u Provenienz: Ex Rauch Sommerauktion 2013, /RVH[:LHQHU3ULYDWVDPPOXQJ06 1990er Jahre. %URQ]HDSSOLTXHZLWKWKHEXVWRI$OH[DQGHU WKH *UHDW 5RPDQ VW  QG FHQWXU\ $' Green patina, corroded iron nail in the grom met.



116




 %DONHQDXIVDW]PLW.QDEHQE©VWHRömisch, -KQ&KU%URQ]HKRKOJXVV4XD GUDWLVFKH 7©OOH  [ FP  PLW 5DQG GLHLQGHUGUDSLHUWHQ%©VWHHLQHV.QDEHQ +FP PLW+DDUNQRWHQDXIGHP2EHU NRSIHQGHW*U©QVFKZDU]H3DWLQDDXIGHU 8QWHUVHLWH GHU 7©OOH NOHLQHV /RFK REHQ HLQNRUURGLHUWHU(LVHQQDJHO u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ  /RV  H[ :LHQHU 3ULYDWVDPPOXQJ M.S., 1990er Jahre. %URQ]H DSSOLTXH ZLWK WKH GUDSHG EXVW RI D ER\ 5RPDQVWQGFHQWXU\$'*UHHQSDWLQDWLQ\ hole at the underside, corroded iron nail on the upper side.

 *URWHVNHQNRSI5¤PLVFK-KQ&KU +FP%URQ]HKRKOJXVVGHU+DDUNUDQ] DP +LQWHUNRSI LQ .DOWDUEHLW DQJHJHEHQ $XVGUXFNVVWDUNHU PÂ&#x201D;QQOLFKHU .RSI PLW DXVJHSUÂ&#x201D;JWHP+LQWHUNRSIKRKHU~LHKHQ GHU 6WLUQ DEVWHKHQGHQ 2KUHQ XQG JUR gHU VSLW]HU 1DVH *U©QVFKZDU]H 3DWLQD LP+DOVJHEURFKHQ u



3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ /RVH[6©GGHXWVFKH3ULYDWVDPPOXQJ M.S., seit 1970er Jahren. *URWHVTXHEURQ]HKHDG5RPDQVWQGFHQWXU\ $'1LFHJUHHQSDWLQDEURNHQDWWKHQHFN

117


 0LQLDWXUNRSIHLQHV3KLORVRSKHQ5¤PLVFK -KQ&KU+FP%URQ]HYROOJXVV%Â&#x201D;UWLJHU .RSI GHV 3KLORVRSKHQ &KU\VLSS =XP 7HLO JU©QH3DWLQDLQWDNW u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ  /RVH[V©GGHXWVFKH3ULYDWVDPPOXQJ06 1970er Jahre. 'HU JULHFKLVFKH 3KLORVRSK &KU\VLSSRV    Y &KU  VWDPPW DXV 6RORL LQ .LOLNLHQ XQG ZXUGHQDFKGHP7RGVHLQHV/HKUHUV.OHDQWKHV2EHU KDXSWGHU3KLORVRSKHQVFKXOHGHU6WRD=XVHLQHQ6FK© OHUQJHK¤UWHQ'LRJHQHVYRQ%DE\ORQXQG=HQRQYRQ 7DUVRV&KU\VLSSRVKDWGLHVWRLVFKH/HKUHLQ(WKLN/R gik und Physik systematisiert. Die Stoa ist eine der be GHXWHQGVWHQSKLORVSKLVFKHQ6FKXOHGHV$EHQGODQGHV 'HU1DPHJHKWDXIGLH6WRDSRLNLOH EXQWH9RUKDOOH  DXIGHU$WKHQHU$JRUD]XU©FNZR=HQRQYRQ.LWLRQ XPY&KUVHLQH/HKUWÂ&#x201D;WLJNHLWDXIQDKP1DFK$XI IDVVXQJGHUVWRLVFKHQ/HKUHHUJLEWVLFKDXVGHP.RV PRVHLQLQDOOHQ1DWXUHUVFKHLQXQJHQXQGQDW©UOLFKHQ =XVDPPHQKÂ&#x201D;QJHQZDOWHQGHVXQLYHUVHOOHV3ULQ]LS)©U GDVGHUVWRLVFKH/HKUHIROJHQGH,QGLYLGXXPJLOWHVVHL nen Platz in dieser Ordnung zu erkennen und einzu nehmen, indem es durch das Praktizieren emotionaler Selbstbeherrschung lernt, sein Schicksal zu akzeptieren und mit Hilfe von Gelassenheit und Seelenruhe nach :HLVKHLW]XVWUHEHQ'LHEHNDQQWHVWHQ9HUWUHWHUGHU M©QJHUHQ6WRDLQU¤PLVFKHU=HLWVLQGGHU6FKULIWVWHOOHU 6HQHFDXQG.DLVHU0DUF$XUHO



%URQ]H PLQLDWXUH KHDG RI WKH SKLORVRSKHU &KU\VLSS 5RPDQVWQGFHQWXU\$'3DUWLDOO\JUHHQSDWLQD intact.

 %©VWHGHVMXJHQGOLFKHQ&RPPRGXVRömisch, (QGH-KQ&KU+FP%URQ]HKRKOJXVV 'UDSLHUWH %©VWH GHV MXJHQGOLFKHQ .DLVHUV XQWHQHLQ(LQODVV]DSIHQ*U©QH3DWLQDNOHLQHV /RFKDQGHUOLQNHQ6FKOÂ&#x201D;IH u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ /RVH[6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLW 1970er Jahren. &RPPRGXV JHEQ&KU ZDUYRQQ &KUU¤PLVFKHU.DLVHU%HUHLWVLP$OWHUYRQ-DKUHQ ZXUGHLKPGHU7LWHO&DHVDUYHUOLHKHQ-DKUHYRUGHP 7RGVHLQHV9DWHUV0DUF$XUHOZXUGH&RPPRGXV Q&KU]XP$XJXVWXVXQGGDPLW]XP0LWKHUUVFKHU PLWDOOHQNDLVHUOLFKHQ9ROOPDFKWHQHUQDQQW'LH%©VWH VWHOOWHLQHQGHUIU©KHUHQ%LOGQLVW\SHQGHV.DLVHUVGDU von denen es insgesamt 8 gibt. %URQ]H KROORZ FDVW EXVW RI \RXWKIXO &RPPRGXV 5RPDQHQGRIQGFHQWXU\$'*UHHQSDWLQDWLQ\ hole at the left temple.



118






 .DLVHUE©VWH5¤PLVFK-KQ&KUkFP%URQ]HYROOJXVV 5XQGH 6FKHLEH PLW GUHL %HIHVWLJXQJVO¤FKHUQ GDUDXI GLH JHSDQ]HUWH%©VWHHLQHV.DLVHUVPLW/RUEHHUNUDQ]*U©QH3DWLQD IHKOHQGHV5DQGIUDJPHQW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[:LHQHU Privatsammlung M.S., seit 1970er Jahren. %URQ]HDSSOLTXHZLWKURXQGGLVFDQGWKHFXLUDVVHGEXVWRIDQHPSHURUZLWK ODXUHOZUHDWK5RPDQQGUGFHQWXU\$'*UHHQSDWLQDPLVVLQJIUDJPHQW of the edge.

 6DW\UNRSI5¤PLVFK-KQ&KU+FP%URQ]HYROOJXVV $SSOLN LQ )RUP HLQHV 6DW\UNRSIHV PLW EUHLW JHIÂ&#x201D;FKHUWHP %DUW XQG(IHX.RU\PEHQNUDQ]LP+DDU*U©QVFKZDU]H3DWLQDDXI GHU5©FNVHLWH5HVWHGHVNRUURGLHUWHQ(LVHQQDJHOVLQWDNW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[:LHQHU Privatsammlung M.S., seit 1990er Jahren. %URQ]HDSSOLTXHLQIRUPRIDVDW\UKHDGZLWKLY\ZUHDWK5RPDQVWQG FHQWXU\$'*UHHQEODFNSDWLQDDWWKHEDFNVLGHWUDFHVRIWKHFRUURGHGLURQ nail, intact.

160 %DFFKXVNRSI 5¤PLVFK    -K Q &KU + FP %URQ]H KRKOJXVV $SSOLNH LQ )RUP HLQHV %DFFKXVNRSIHV PLW HLQHP (IHX.RU\PEHQ.UDQ]*U©QH3DWLQDLQWDNW u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ

160

%URQ]HKROORZFDVWDSSOLTXHRID%DFFKXVKHDGZLWKLY\ZUHDWKZLWKFRU\PEHV 5RPDQVWQGFHQWXU\$'*UHHQSDWLQDLQWDFW

119


161

162

161 Büste des Serapis. 5¤PLVFKH .DLVHU]HLW    -K Q &KU + FP %URQ]HUHOLHI %©VWH HLQHU EÂ&#x201D;UWLJHQ 9DWHUJRWWKHLW PLW ORFNLJHP+DDUXQG%DUWGLHHLQHQ.DODWKRVDXIGHP.RSIXQG HLQIDOWHQUHLFKHV*HZDQGWUÂ&#x201D;JW.DODWKRVLVWJHEURFKHQ u

3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ:HVWIDOHQHUZRUEHQLQGHQ HUQ DXV GHU 6DPPOXQJ 3DXO :HEHU 3DGHUERUQ HU ELV HU -DKUH  %URQ]HDSSOLTXHGHSLFWLQJWKHEXVWRIEHDUGHG6HUDSLVZLWKNDODWKRVRQKLV KHDG5RPDQ,PSHULDO3HULRGQGUGFHQWXU\$'.DODWKRVLVEURNHQ

162 6DW\U$SSOLN5¤PLVFK-K Q&KU+FP%URQ]HKRKOJXVV +DOESODVWLVFKHU.RSIHLQHV6DW\UQ PLW:HLQODXENUDQ]XQG+¤UQHUQ $XI GHU 5©FNVHLWH UHFKWHFNLJH $XVVSDUXQJ 6FKZDU]JU©QH 3DWL QDLQWDNW u 3URYHQLHQ] ([ V©GGHXWVFKH 3ULYDW sammlung M.S., 1970er Jahre. %URQ]HDSSOLTXHZLWK6DW\UKHDGZLWKYLQH OHDYHVZUHDWK5RPDQVWUGFHQWXU\ $'*UHHQSDWLQDLQWDFW

163 (EHU5RPDQRNHOWLVFK-K Q &KU %URQ]HYROOJXVV / FP + FP +HUUOLFKH ROLYJU©QH 3DWLQDLQWDNW u Provenienz: Ex Besitz S.K., Paris. Ex $XNWLRQ1HUHW0LQHW

163

120

5RPDQR&HOWLFPLQLDWXUHEURQ]H}JXUH RIDERDU$WWUDFWLYHROLYHJUHHQSDWLQD intact.


164



164 %URQ]H3IHUGFKHQ *HRPHWULVFK    -K Y &KU /FP+HOOJU©QH3DWLQD2EHU~Â&#x201D;FKHEHVWRgHQ 600,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 3ULYDWVDPPOXQJ 0( &KLHPJDX LQ GHQ HU-DKUHQHUZRUEHQ %URQ]HPLQLDWXUHKRUVH*HRPHWULFWKWKFHQWXU\%&/LJKW green patina, surface partially worn.

 $GOHU5¤PLVFK-KQ&KU+FP%URQ ]HYROOJXVV GDV *H}HGHU LQ .DOWDUEHLW DQJHJHEHQ %UDXQH3DWLQDLQWDNW u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH 3ULYDWVDPPOXQJ 06 VHLW HU Jahren. %URQ]HVLWWLQJHDJOH5RPDQQGUGFHQWXU\$'%URZQ patina, intact.

166 %XNHSKDORV5¤PLVFK-KQ&KU+FP/ FP %URQ]HYROOJXVV 'HWDLOV LQ .DOWDUEHLW 6WDWX HWWHHLQHV3IHUGHVPLWHUKREHQHPOLQNHQ9RUGHUODXI 'HQ .¤USHU EHGHFNW HLQ /¤ZHQVNDOS GHVVHQ .RSI GLH%UXVWGHV3IHUGHV]LHUW(VVWHKWDXIHLQHUVFKPD OHQUHFKWHFNLJHQ6WDQGSODWWH'HU6FKZDQ]ZDUYHU PXWOLFKHLQJHVHW]WGLH0Â&#x201D;KQHUHLFKJHORFNW6FK¤QH JU©QH3DWLQD6FKZDQ]IHKOW u

166

Provenienz: Ex Wiener Privatsammlung M.S., 1990er Jahre. %XNHSKDORVZDUGDV3IHUGYRQ$OH[DQGHUGHP*URgHQGDVYRQ FDELV-XQLY&KUOHEWH3OXWDUFKEHULFKWHWGDVVGDV 3IHUG$OH[DQGHUV9DWHU3KLOLSS,,]XP.DXIDQJHERWHQZXUGH XQGQLHPDQGLQGHU/DJHZDUHV]XUHLWHQ(UVW$OH[DQGHUVWHOOWH fest, dass das Pferd vor dem Schatten von sich und dem Reiter $QJVWKDWWHXQGVWHOOWVLFKVRGDVVGDV3IHUGVHLQHQ6FKDWWHQ nicht sehen konnte, wodurch er das Pferd reiten konnte. Die ,QWHUSUHWDWLRQDOV%XNHSKDORVJU©QGHWVLFKDXIGHP/¤ZHQVNDOS GHQ$OH[DQGHUGHU*URgHDXI0©Q]SRUWUÂ&#x201D;WVWUÂ&#x201D;JW Bukephalos with a lion scalp on the body standing on a UHFWDQJXODUVWDQGSODWH5RPDQQGUGFHQWXU\$'*UHHQ patina, tail missing.

121


167 168

167 Widder. 5¤PLVFK-KQ&KU+FP/FP%URQ]H YROOJXVV 'HWDLOV LQ .DOWDUEHLW 6WDWXHWWH HLQHV VWHKHQGHQ :LG GHUV GDV )HOO LQ .DOWDUEHLW DQJHJHEHQ 6FKZDU]JU©QH 3DWLQD LQWDNW u

Provenienz: Ex Wiener Privatsammlung M.S., 1990er Jahre. %URQ]HPLQLDWXUHKRUVHRQDUHFWDQJXODUEDVH5RPDQVWUGFHQWXU\$' Green patina, tiny damage at the right foreleg.

169 3DQWKHUNRSI 5¤PLVFKH .DLVHU]HLW    -K Q &KU %URQ]HKRKOJXVV + FP 3DQWKHU PLW DXIJHULVVHQHP 0DXO DXI HLQHPPRGHUQHQ6RFNHOPRQWLHUW'XQNHOJU©QH3DWLQDDP+DOV JHEURFKHQ u

3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[V©GGHXWVFKH Privatsammlung M.S., 1970er Jahre. %URQ]HPLQLDWXUHUDPRQDUHFWDQJXODUVWDQGSODWH5RPDQVWUGFHQWXU\ $'%ODFNJUHHQSDWLQDLQWDFW

3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ zwischen 1975 bis 1998.

168 3IHUGHVWDWXHWWH DXI 6WDQGSODWWH 5¤PLVFK    -K Q &KU + FP/FP%URQ]HYROOJXVV6WDWXHWWHHLQHV3IHUGHVPLWHUKR EHQHPUHFKWHQ9RUGHUODXI,QGHUUHFKWHFNLJHQ6WDQGSODWWHHLQH WUDSH]I¤UPLJH $XVVSDUXQJ 6FK¤QH JU©QH 3DWLQD NOHLQH )HKO VWHOOHDP$QVDW]GHVUHFKWHQ9RUGHUODXIV u

5RPDQEURQ]HSDQWKHUVWUGFHQWXU\$'3DQWKHUZLWKRSHQPRXWK installed on a modern base. Green patina, broken at the neck.

169

170

122


171

170 Widder. 5¤PLVFK    -K Q &KU + FP / FP %URQ]HYROOJXVV'HWDLOVLQ.DOWDUEHLW6WDWXHWWHHLQHV:LGGHUVDXI HLQHUUHFKWHFNLJHQ6WDQGSODWWHGDV)HOOLQ.DOWDUEHLWDQJHJHEHQ GHU.RSIQDFKUHFKWVJHZDQGW*U©QH3DWLQDLQWDNW u

LKUHP2EHUVFKHQNHOVLW]W'DV.LQGKDWGHQUHFKWHQ$UPDXV JHVWUHFNW'DV*HZDQGGHU)HFXQGLWDVOÂ&#x201D;VVWGLHUHFKWH%UXVWIUHL $PXQWHUHQ5DQG]ZHL%HIHVWLJXQJVO¤FKHU:DKUVFKHLQOLFKHLQ 0¤EHOEHVFKODJ4XDOLWÂ&#x201D;WYROOH$UEHLW*U©QH3DWLQDLQWDNW u

3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ06HU-DKUH

3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06HU-DKUH 'HUU¤PLVFKH*HVFKLFKWVVFKUHLEHU7DFLWXV $QQDOHV EHULFKWHWGDVV GHU )HFXQGLWDV DXI 6HQDWVEHVFKOXVV KLQ  Q &KU LQ 5RP HLQ 7HPSHO JHZHLKWZXUGHQDFKGHP3RSSHD6DELQD.DLVHU1HURHLQH7RFKWHUJHERUHQ KDWWH)HFXQGLWDVPLW=HSWHUXQG.OHLQNLQGLVWDXFKHLQEHOLHEWHV0RWLYGHU U¤PLVFKHQ0©Q]SUÂ&#x201D;JXQJYRQ$QWRQLQXV3LXVELV&ODXGLXV*RWKLFXV

%URQ]HPLQLDWXUHUDPRQDUHFWDQJXODUVWDQGSODWH5RPDQVWUGFHQWXU\ $'*UHHQSDWLQDLQWDFW

171 )HFXQGLWDV5¤PLVFK-KQ&KU/FP+FDFP %URQ]HKRKOJXVV 5HOLHI PLW QDFK OLQNV KLQ ODJHUQGHU 3HUVRQL }NDWLRQ GHU )UXFKWEDUNHLW GLH LP UHFKWHQ $UP HLQ )©OOKRUQ XQG PLW GHP OLQNHQ $UP HLQ QDFNWHV .OHLQNLQG KÂ&#x201D;OW GDV DXI

+ROORZFDVWEURQ]HUHOLHIZLWKWKHSHUVRQL}FDWLRQRI)HFXQGLWDVZLWKFRUQXFRSLD DQGFKLOGWZRKROHVDWWKHORZHUERWWRP5RPDQVWQGFHQWXU\$'*UHHQ SDWLQDLQWDFW3UREDEO\DIXUQLWXUH}WWLQJHigh quality!

123


172 1HUHLGH DXI 6HHSDQWKHU Römi VFKH.DLVHU]HLW-KQ&KU)OD FKHV %URQ]HUHOLHI / FP 1DFK UHFKWV JHULFKWHWHV 0LVFKZHVHQ DXV 3DQWKHUYRUGHUWHLO XQG JHULQ JHOWHP )LVFKVFKZDQ] DXI GHV VHQ 5©FNHQ HLQH QXU PLW HLQHP 6FKXOWHUP”QWHOFKHQ EHNOHLGHWH 1HUHLGHVLW]WGLHEHLGH$UPHHU KREHQ KDW 6FK¤QH GXQNHOJU©QH 3DWLQDLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ 1LFKRODV :ULJKW/RQGRQYRU 6KDOORZEURQ]HDSSOLTXHVKRZLQJD1H UHLGULGLQJDVHDSDQWKHU5RPDQ,PSH ULDO3HULRGUGFHQWXU\$'$WWUDFWLYH darkgreen patina, intact.

173 'UHLIXgDXIVDW] PLW 'LRQ\VRVE© ste. 5¤PLVFK-KQ&KU+ FP%URQ]HYROOJXVV9ROOSODVWL VFKH%©VWHPLWLQ6LOEHUHLQJHOHJ WHQ $XJHQ LQ HLQHP %O”WWHUNHOFK DXI HLQHU SUR}OLHUWHQ %DVLV EHU GHU6FKXOWHUOLHJWHLQ5HKIHOO QH EULV  GDV PLW HLQHP HLQJHOHJWHP 6WUHLIHQ %XQWPHWDOO ]XU QDFNWHQ

172

173

124

H[


6FKXOWHUKLQDEJHJUHQ]WLVW,P+DDUOLHJW HLQ DXVODGHQGHU :HLQNUDQ] 5©FNZÂ&#x201D;UWLJ +DNHQ (LQGUXFNVYROOHU 6WLO 6FK¤QH ND VWDQLHQEUDXQH3DWLQDLQWDNW u 3URYHQLHQ] ([ 3ULYDWEHVLW] '* H[ 7LPHOLQH /RQGRQ$XFWLRQ$XV3ULYDWEHVLW] .HQW(UEVFKDIWHUZRUEHQLQ'HXWVFKODQG nach 1945. 7ULSRG}QLDOLQIRUPRIWKHEXVWRIWKH\RXWKIXO wreathed Dionysos wearing a nebris across his VKRXOGHU 5RPDQ ,PSHULDO 3HULRG VW  QG FHQWXU\ $' $WWUDFWLYH ROLYH JUHHQ SDWLQD H\HV inlaid in silver. Impressive style!

174 )UDJPHQWH HLQHV %HVFKODJV PLW *LJDQW 5¤PLVFK-KQ&KU*U¤gWHV)UDJ PHQW/FDFP%FDFP%URQ]H KRKOJXVVPLW%HIHVWLJXQJVORFK5HOLHIPLW HLQHPEÂ&#x201D;UWLJHQ*LJDQWHQGHUGHQUHFKWHQ $UPHUKREHQKDW(LQ)UDJPHQWPLW]ZHL 8QWHUVFKHQNHOQ HLQ 5DQGIUDJPHQW  6W©FN6FKZDU]JU©QH3DWLQD u



3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ  /RV  H[ 0©QFKQHU 3ULYDWVDPPOXQJ M.S., 1970er Jahre. )UDJPHQWVRIDEURQ]H}WWLQJZLWKDJLDQW5RPDQ VWQGFHQWXU\$'*UHHQSDWLQD3 pieces!

 0¤EHOEHVFKOÂ&#x201D;JH PLW %©VWHQ Römisch,    -K Q &KU k FP =ZHL %URQ ]HVFKHLEHQ PLW NRQ]HQWULVFKHQ 5LOOHQ XQG YHUWLHIWHP =HQWUXP 'DUDXI MHZHLOV HLQ QDFNWH PÂ&#x201D;QQOLFKH %©VWH LP %URQ]H KRKOJXVV6W©FN*U©QH3DWLQDZLQ]LJH 5DQGIUDJPHQWH IHKOHQ 5DQG HWZDV HLQ JHULVVHQXQGDXIJHERJHQHLQH%©VWHORVH DXI6W\URSRUPRQWLHUW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ /RVH[6©GGHXWVFKH3ULYDWVDPPOXQJ M.S., 1970er Jahre. 7ZR EURQ]H DSSOLTXHV ZLWK QDNHG PDOH EXVWV RULJLQDOO\ IXUQLWXUH }WWLQJV 5RPDQ VW  QG FHQWXU\ $' *UHHQ SDWLQD WLQ\ IUDJPHQWV RI HGJHPLVVLQJHGJHSDUWLDOO\EHQWDQGZLWK}VVXUHV mounted on styropor.

$ 0DXOWLHUNRSI 6SÂ&#x201D;WKHOOHQLVWLVFK  IU©KH U¤PLVFKH .DLVHU]HLW  -K Y &KU   -KQ&KU[FP.OLQHQEHVFKODJ 6FK¤QH3DWLQDLQWDNW u Provenienz: Ex Sammlung M.S., Wien. Erworben EHL'U$$0©QFKHQ(QGHGHUHUHU Jahre. $WWDFKPHQWRIDNOLQHLQIRUPRIDPXOHyVKHDG WXUQLQJ EDFN /DWH KHOOHQLVWLF  (DUO\ 5RPDQ ,PSHULDO 3HULRG VW FHQWXU\ %&  VW FHQWXU\ $'*UHHQSDWLQDLQWDFW

$

125


176 $FKVHQVFKOXVV PLW /¤ZHQNRSI Rö PLVFK    -K Q &KU k FP )URQWDOHU/¤ZHQNRSILQPHKUIDFKRU QDPHQWLHUWHU5DKPXQJ,P0DXOGHV /¤ZHQ ZDU GLH KHXWH IHKOHQGH =XQ JH VHSDUDW JHDUEHLWHW XQG HLQJHVHW]W (EHQVR ZDUHQ GLH KHXWH IHKOHQGHQ 5HLg]Â&#x201D;KQHDXVDQGHUHP0DWHULDOHLQ JHVHW]W+HUUOLFKHGXQNHOJU©QH3DWLQD VHLWOLFKH.UDW]HU u 3URYHQLHQ]([6DPPOXQJ$/(UZRUEHQLQ /RQGRQ 9JO+0HQ]HO'LHU¤PLVFKHQ%URQ]HQDXV 'HXWVFKODQG,,7ULHU  1UI $ EURQ]H D[OH FDS ZLWK WKH KHDG RI D OLRQ 5RPDQ ,PSHULDO 3HULRG QG  UG FHQWXU\ $' 6HSDUDWHO\ ZRUNHG IDQJV DQG WRQJXH missing, lateral scratches. 176

177 6FKO©VVHOJULII PLW /¤ZHQSURWRPH 5¤PLVFK-KQ&KU/FP %URQ]H XQG (LVHQ 6FKO©VVHO PLW 6FKDIWXQG%DUWDXV(LVHQXQGHLQHP *ULII LQ )RUP GHV 9RUGHUWHLOV HLQHV OLHJHQGHQ /¤ZHQ PLW DXVJHVWUHFNWHQ 9RUGHUOÂ&#x201D;XIHQ GDV HLQHP %ODWWNHOFK HQWVSULQJW*U©QH3DWLQDLQWDNW 600,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ.7)UDQNUHLFK Deutschland, seit ca. 1980er Jahre. Key with shank and bit of iron and a bronze handle in form of the forepart of a lying lion ZLWKRXWVWUHWFKHGIRUHOHJV5RPDQVWQG FHQWXU\$'*UHHQSDWLQDLQWDFW

178 6FKO©VVHOJULIIPLW/¤ZHQSURWRPHRö PLVFK    -K Q &KU / FP %URQ]H XQG (LVHQ 6FKO©VVHO PLW 6FKDIWXQG%DUWDXV(LVHQXQGHLQHP *ULIILQ)RUPHLQHVOLHJHQGHQ/¤ZHQ PLW DXVJHWUHFNWHQ 9RUGHUOÂ&#x201D;XIHQ GD ]ZLVFKHQ HLQH %HXWH LQ )RUP HLQHV :LGGHUNRSIHV $Q GHU 8QWHUVHLWH HLQHNXU]H.HWWHPLW5LQJ*U©QH3D WLQDLQWDNW u

177

Provenienz: Ex Hermann Historica $XNWLRQ   /RV  H[ 0©QFKQHU Privatsammlung, seit 1970er Jahren. $Q HLQHP 3DUDOOHOVW©FN DXV 7ULHU LVW GLH Beute als Frischling zu erkennen: s. S. Faust, )LJ©UOLFKH %URQ]HQ XQG *HJHQVWÂ&#x201D;QGH DXV DQGHUHQ0HWDOOHQDXV6WDGWXQG%H]LUN7ULHU LQ3ULYDWEHVLW],97ULHUHU=HLWVFKULIW 6I1U

178

126

Key with shank and bit of iron and a bronze handle in form of the forepart of a lying lion ZLWK RXWVWUHFKWHG IRUHOHJV KROGLQJ SUH\ $W the underside a short chain ending in a ring. 5RPDQVWQGFHQWXU\$'*UHHQSDWLQD intact.


179

180

179 6LOEHUUHOLHI PLW *¤WWLQ 5¤PLVFK    -K Q &KU + FP %FP 5HFKWHFNLJHV JHWULHEHQHV 6LOEHUEOHFK PLW OHLFKW QDFK LQQHQ JHZ¤OEWHP 5DQG 'DUJHVWHOOW LVW HLQH IURQWDO VWHKHQGH ZHLEOLFKH*¤WWLQFDSLWHYHODWRPLW3DWHUDLQGHUUHFKWHQ+DQG Provinzieller Stil! =ZHL 5LVVH ]ZHL NOHLQH /¤FKHU 5HVWH YRQ 9HUJROGXQJLP*HVLFKW u

180 $SSOLNH PLW &HUHV 5¤PLVFKH .DLVHU]HLW    -K Q &KU + FP'UDSLHUWH%©VWHGHU*¤WWLQ&HUHVPLW3RORVDXIGHP.RSI UHFKWVXQGOLQNVQHEHQLKU.RUQÂ&#x201D;KUHXQG)DFNHO,QWDNW u

3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ

$SSOLTXHZLWKWKHSRUWUDLWRI&HUHV5RPDQVWUGFHQWXU\$'%XVWRI WKHJRGGHVV&HUHVZLWKSRORVRQWKHKHDGHDURIFRUQDQGWRUFKRQWKHULJKW and left side next to her. Intact.

Silver rectangular driven relief depicting a standing female goddess capite YHODWRZLWKDSDWHUD5RPDQQGUGFHQWXU\$'7ZR}VVXUHVWZRWLQ\ holes, traces of gilding in the face. Provincial style!

3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ zwischen 1975 bis 1998.

180A %HUJ$UJDLRV5¤PLVFKH.DLVHU]HLW-KQ&KU+FP %DVLV  [ FP %DVLV XQG %HUJ VHSDUDW JHIHUWLJW $XI GHU

180A

127


180A

2EHUVHLWH3ODWWIRUPHQI©UZHLWHUHVHSDUDWH)LJXUHQ $GOHUXQG %HUJVSLW]H 5HFKWHFNLJH%DVLVPLW)©gFKHQGDUDXI'DUVWHOOXQJ HLQHV%HUJHVDXIGHPLP9RUGHUJUXQGDXIMHGHU6HLWHHLQHLQHQ +LUVFKHQDQJUHLIHQGHU/¤ZH]XVHKHQLVW6FK¤QHJU©QH3DWLQD LQWDNW u 3URYHQLHQ]([6DPPOXQJ06:LHQ(UZRUEHQEHL'U$$0©QFKHQ Ende der 1970er / 1980er Jahre. 'HU %HUJ $UJDLRV HUKHEW VLFK DXV GHU ]HQWUDODQDWROLVFKHQ +RFKHEHQH DOV K¤FKVWHU%HUJ.OHLQDVLHQVDXIVWDWWOLFKHP'HUHUORVFKHQH9XONDQE]Z der dort wohnende Gott erfuhr besonders in der Kaiserzeit umfangreiche NXOWLVFKH 9HUHKUXQJ YRQ GHU XQWHU DQGHUHP HLQLJH VHOWHQH UXQGSODVWLVFKH 9RWLYELOGHU=HXJQLVDEOHJHQ$%&RRNKDWZHJHQGHVKÂ&#x201D;X}JHQ$XIWUHWHQVYRQ $GOHUELOGHUQLQQHUKDOEGHUNXOWLVFKHQ%LOGHUZHOWGHQ*RWWDOVHLQH9DULDQWH GHV=HXVNXOWHVEHWUDFKWHWGRFKPDJGHUNDSSDGRNLVFKH%HUJNXOWXQDEKÂ&#x201D;Q JLJ VHLQ XQG P¤JOLFKHUZHLVH DXI KHWKLWLVFKH 8UVSU©QJH ]XU©FNJHKHQ /LW 3:HLg$UJDLRV(UFL\DV'DJL+HLOLJHU%HUJ.DSSDGRNLHQV0RQXPHQWH XQG,NRQRJUDSKLH-1*IIEHVIPLW7DI'LH8QVWHUEOLFKHQ *¤WWHU*ULHFKHQODQGV$XVVWHOOXQJ0©QFKHQIPLW$EEDE (EHQIDOOVPLW7LHUHQ+%RVVHUW$OWDQDWROLHQ  $EE %URQ]H YRWLYH DJDOPD RI 0RXQW $UJDLRV WRGD\ (UF\DV 'DJL LQ &HQWUDO $QDWROLD ZLWK VHSDUDWHO\ ZRUNHG EDVH DQG D OLRQ DWWDFNLQJ D GHHU DW WKH VORSHV5RPDQ,PSHULDOSHULRGQGUGFHQWXU\$'*UHHQSDWLQDLQWDFW

181 Sirene. *ULHFKLVFK-KY&KU+FP%URQ]HYROOJXVVPLW 6LOEHUHLQODJHQ+HQNHODWWDVFKHLQ)RUPHLQHUVWHKHQGHQ6LUHQH PLW DXVJHEUHLWHWHQ )O©JHOQ +DDUEDQG XQG $XJHQ LQ 6LOEHU HLQJHOHJW*U©QEUDXQH3DWLQDZLQ]LJH)UDJPHQWHIHKOHQ u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ Ã&#x2013;sterreichische Privatsammlung M.S., seit 1980er Jahren. 181 Bronze handle attachement in form of a siren with silver inlaid eyes and ULEERQ*UHHNWKFHQWXU\%&*UHHQEURZQSDWLQDWLQ\IUDJPHQWVPLVVLQJ

128


183

182

182 Bronzener Zierbeschlag in Durchbruchstechnik. RÜmisch, 2. Jh. Q&KUkFP5LQJPLW3HOWHQXQG%ODWWGHNRULP=HQWUXP HLQH7ULVNHOH$QGHQ6HLWHQ]ZHLKDOENUHLVI¤UPLJH�VHQ7HLO HLQHV3IHUGHJHVFKLUUV,QWDNW u Provenienz: Ex Sßddeutsche Privatsammlung M.S., seit 1970er Jahren. %URQ]HRSHQZRUNURXQGHOZLWKODYLVK~RUDOGHFRUDQGWULVNHOHLQWKHFHQWHUDW HDFKVLGHDQH\HOHWSDUWRIDQHTXLQH}WWLQJ5RPDQQGFHQWXU\$',QWDFW

183 Bronzener Zierbeschlag in Durchbruchstechnik. RĂśmisch, 2. Jh. Q&KUkFP9HU]LQQW5LQJPLW9ROXWHQXQG6ZDVWLND7HLO HLQHV3IHUGHJHVFKLUUV(WZDVYHUIRUPW u Provenienz: Ex SĂźddeutsche Privatsammlung M.S., seit 1970er Jahren. %URQ]HWLQWHGRSHQZRUNURXQGHOZLWKODYLVK~RUDOGHFRUDQGVZDVWLNDSDUWRI DQHTXLQH}WWLQJ5RPDQQGFHQWXU\$'6OLJKWO\GHIRUPHG

184 SpätrÜmischer Bronzebeschlag.    -K Q &KU + FP 5HFKWHFNLJHU %URQ]HEHVFKODJ LQ GHU 0LWWH 'XUFKEUXFKVDUEHLW

184

PLW]ZHLYHUVFKOXQJHQHQ'UDFKHQ5HFKWVXQGOLQNV(LVHQIDVVXQJ XQG(LVHQVWLIWH*U©QH3DWLQD u 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV %URQ]H}WWLQJZLWKFXWZRUNLQWKHIRUPRIWZRGUDJRQV,URQPRXQWLQJ/DWH 5RPDQWKWKFHQWXU\$'*UHHQSDWLQD

185 Donauländische Mysterienplakette. 5¤PLVFKH.DLVHU]HLW -KQ&KU5HFKWHFNLJH%OHLSODWWH [FP PLWJHZHOOWHP *LHEHO GDULQ 6RO LQ 4XDGULJD XQG (FNDNURWHUHQ PLW 6RO XQG /XQD'DUXQWHUGUHL5HJLVWHULPREHUHQ+HOHQD]ZLVFKHQGHQ YRQMHZHLOVHLQHUZHLWHUHQ)LJXUEHJOHLWHWHQ'LRVNXUHQYRQGH QHQHLQHUŠEHUHLQHDP%RGHQOLHJHQGH)LJXUGHUDQGHUHŠEHU HLQHQ )LVFK KLQZHJUHLWHW 'DUXQWHU VLQG 2SIHUV]HQHQ *HUÂ&#x201D;W VFKDIWHQXQG7LHUH]XVHKHQBesonders groĂ&#x;es, gut ausgeprägtes Exemplar!%HLJH%OHLSDWLQDOLQNV)HKOVWHOOH u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ/RQGRQ 'DQXELDQP\VWHU\SODTXH5RPDQ,PSHULDO3HULRGQGUGFHQWXU\$' Beige patina, part at the left edge missing. Large example of good quality!

185

129


:$1'0$/(5(,



 Wandmalereifragment.  -K Q &KU % FP + FP $XI ZHLgHP*UXQGDXVJHI©KUWH~©FKWLJH0DOHUHLPLWHLQLJHQQDFK UHFKWV ODXIHQGHQ *HVWDOWHQ XQG HLQHU ]XVDPPHQJHEURFKHQHQ )LJXULP9LHUI©gOHUVWDQGw'DUXQWHUIUDJPHQWDULVFKH,QVFKULIW [...]HS BOUS[...]... $XV ]ZHL 7HLOHQ JHNOHEW XQG U©FNZ”UWLJ VWDELOLVLHUWPLW=HPHQWXQGGUHLHLQJHVHW]WHQ1”JHOQ u 3URYHQLHQ]([1DFKODVV'U:LHGHPDQQ.ORVWHU1HXEXUJHU Jahre.

130

'LH~©FKWLJH0DOHUHLHULQQHUWDQGLH)LJXUHQGHULG\OOLVFKHQ/DQGVFKDIWVELOGHU ZLHVLHYRQ3LQDNHVDXV3RPSHMLXQG+HUFXODQHXPEHNDQQWVLQG$OOHUGLQJVLVW KLHURIIHQEDUHLQGUDPDWLVFKHV.DPSIJHVFKHKHQLP*DQJHGDVGHU.©QVWOHU ]XP EHVVHUHQ 9HUVW”QGQLV LQVFKULIWOLFK EHQDQQW KDW 'DVV GLH ,QVFKULIW LQ *ULHFKLVFKYHUIDVVWLVWVSULFKWYLHOOHLFKWHKHUI©UHLQH¤VWOLFKH+HUNXQIWGHV )UDJPHQWV )UDJPHQWRID5RPDQZDOOSDLQWLQJLQDVFHWFK\VW\OHVKRZLQJVHYHUDOUXQQLQJ DQGNQHHOLQJ}JXUHVEHORZ*UHHNLQVFULSWLRQVVWFHQWXU\$')UDJPHQWDU\ UHDVVHPEOHGIURPWZRSLHFHVVWDELOL]HGDWWKHEDFNVLGHZLWKWKUHHDGGLWLRQDO nails.


*(5Â&#x160;7(



 Paar silberne Ligulae. 6SÂ&#x201D;WU¤PLVFKFD-KQ&KU/FP 0DVVLY JHJRVVHQHV 6LOEHU J  PLW *UDYXU 0LW JURgHU RYRLGHU /DIIH GDUDQ 6WLHO PLW ]ZHL 'HO}QHQ LP )ODFKUHOLHI VRZLHDP(QGHHLQYROOSODVWLVFKDXVJHDUEHLWHWHU'HO}Q$XIGHU 8QWHUVHLWHGHU/DIIH*UDYXULQ)RUPYRQ=ZHLJHQXQG3DOPHWWH ,QWDNW u

Pair of ligulae made of massive cast silver with plastic and engraved decor. /DWH5RPDQDERXWWKFHQWXU\$':LWKODUJHRYRLGKHDGDQGHQGLQJLQ form of three dolphins. Underneath of the head engraved decor in form of EUDQFKHVDQGSDOPHWWH,QWDFW

3URYHQLHQ]$XVGHU6DPPOXQJ&60©QFKHQHUZRUEHQLP0©QFKQHU .XQVWKDQGHO

131


188



132


188 Trinkbecher aus Marmor. 5¤PLVFK    -K Q &KU +FPkREHQFP$XVJUDXPDUPRULHUWHP0DU PRU .RQLVFKHU %HFKHU PLW 5HOLHI DXI GHU $XgHQVHLWH GDVGUHLWDQ]HQGH(URWHQPLW0XVLNLQVWUXPHQWHQ]HLJW GLHGXUFKNRULQWKLVFKH6”XOHQJHWUHQQWVLQG$PXQWHUHQ 5DQGHLQH$UW:HOOHQEDQG5HVWHYRQ6LQWHUREHUKDOE GHV%RGHQVJHEURFKHQXQGJHNOHEW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RV ex Süddeutsche Privatsammlung M.S.,1970er Jahre. &RQLFDOEHDNHURIJUH\VWULDWHGPDUEOHZLWKDUHOLHIRXWVLGHGHSLFWLQJ WKUHHGDQFLQJFXSLGVZLWKLQVWUXPHQWVVHSDUDWHGE\FROXPQVZLWK FRULQWKLDQFDSLWHOV5RPDQVWQGFHQWXU\$'7UDFHVRIVLQWHU EURNHQDERYHWKHERWWRPDQGUHDVVHPEOHG

 Omphalosschale aus Achat. +HOOHQLVWLVFK    -K Y &KU k FP + FP 6FKDOH PLW 2PSKDORV $XgHQ DXIGHP%RGHQ]ZHL5LOOHQXQG]ZHL5LSSHQDXIKDOEHU +¤KH GHQHQ HLQ NOHLQHU $EVDW] LQQHQ JHJHQ©EHU OLHJW 0LQ6SUXQJDXIGHU8QWHUVHLWH u 3URYHQLHQ]([6DPPOXQJ-&ODHVVHQ+ROODQGYRU +HOOHQLVWLFDJDWHERZO}QHO\GHFRUDWHGZLWKULEVDQGJURRYHVUG VWFHQWXU\%&:LWKFUDFNDWWKHEDFNVLGH



 Balsamarium in Büstenform. 5¤PLVFK-KQ&KU + FP %URQ]H %©VWH HLQHV QDFNWHQ $IULNDQHUV PLW ©SSLJHQ%XFNHOORFNHQGLHDXIHLQHP%ODWWNHOFKDXIHLQHU UXQGHQ %DVLV VLW]W 2EHQ XUVSU©QJOLFK DXINODSSEDUHU 'HFNHO.OHLQHV/RFKLP)XgHLQHVHDXVJHEURFKHQ HLQ NOHLQHU 5DQGDXVEUXFK 'HFNHO QLFKW ]X ¤IIQHQ +HQNHOIHKOW u Provenienz: Ex süddeutsche Privatsammlung M.S., 1970er Jahre. %URQ]HEDOVDPDULXPLQIRUPRIWKHQDNHGEXVWRID\RXQJ$IULFDQ ZLWKFXUO\KDLU5RPDQQGUGFHQWXU\$'7LQ\KROHLQWKHEDVH RQHH\HOHWEURNHQFKLSDWWKHULPOLGQRWWRRSHQKDQGOHPLVVLQJ

 %URQ]H%DOVDPDULXP 5¤PLVFK    -K Q &KU + FP$U\EDOORVPLW=XQJHQEODWWGHNRUDP+DOVLVWHLQH .HWWHEHIHVWLJWDQGHUHQ(QGHHLQ'HFNHOK”QJW*U©QH 3DWLQD9HUVLQWHUXQJHQLQWDNW u Provenienz: Ex Süddeutsche Privatsammlung M.S., seit 1970er Jahren.



%URQ]HEDOVDPDULXPLQVKDSHRIDQDU\EDOORVZLWKWRQJXHVDQGDOLG 5RPDQVWUGFHQWXU\$'*UHHQSDWLQDWUDFHVRIVLQWHULQWDFW

133






 $ODEDVWHU.HOFK%DNWULHQ-WY&KUkFP+FP.HOFK PLWVHQNUHFKWHUSUR}OLHUWHU:DQGXQJXQG7URPSHWHQIXg5HVWH YRQ6LQWHULQWDNW u Provenienz: Ex Süddeutsche Privatsammlung M.S., seit 1970er Jahren. $ODEDVWHUJREOHWZLWKDWUXPSHWVKDSHGIRRWDQGFXSZLWKDSUR}OHGZDOO %DFWULDQGPLOOHQLXP%&

e Tintenfass aus Bronze. 5¤PLVFK-KQ&KU+FP RKQH %©JHO FDFP PLW%©JHO kFP%URQ]HJXVV.RQLVFKHU 6WDQGIXgHLQIDVW]\OLQGULVFKHU&RUSXVPLWHLQJH]RJHQHU6FKXO WHUGDU©EHUHLQSUR}OLHUWHUJHUDGHU5DQG'HFNHODEJHVWXIWPLW HLQHP /RFK LQ GHU 0LWWH ]ZHL KDOENUHLVI¤UPLJH %DQGKHQNHO *U©QH3DWLQD5HVWHYRQ6LQWHUHLQ%©JHODQGHU$WWDVFKHJH EURFKHQGHUDQGHUHIHKOW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\ 



134

0RVFK$XNWLRQ/RV %URQ]HLQNZHOOZLWKWZRIROGLQJKDQGOHV5RPDQVWQGFHQWXU\$'*UHHQ SDWLQDRQHKDQGOHEURNHQDERYHWKHDWWDFKPHQWWKHRWKHUKDQGOHPLVVLQJ

 Silberne Omphalosschale. 7KUDNLVFK    -K Y &KU k FD FP+FDFP$XVJHWULHEHQHP6LOEHUEOHFK)ODFKHU%RGHQ PLWNXU]HUVHQNUHFKWHU:DQGXQJGDYRQDEJHVHW]WGHUQDFKDX gHQNUDJHQGH5DQG$XIGHP%RGHQLP=HQWUXPHLQ2PSKDORV GHUYRQHLQHP'UHLHFNVEDQGJHUDKPWZLUG$XIGHU:DQGXQJ HLQ=XQJHQEDQGPXVWHU(WZDVYHUIRUPW5LVVHDQYHUVFKLHGHQHQ 6WHOOHQHLQZLQ]LJHV)UDJPHQWIHKOW u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ Süddeutsche Privatsammlung M.S., seit 1970er Jahren. 6KDOORZVLOYHUERZOZLWKHPERVVHGGHFRUDWLRQVKRZLQJDFHQWUDORPSKDORV DQGUDGLDWLQJWRQJXHVDWWKHZDOO7KUDFLDQWKUGFHQWXU\%&6OLJKWO\ GHIRUPHG}VVXUHVDWVHYHUDOVSRWVWLQ\IUDJPHQWPLVVLQJ






 %URQ]H6FKDOHPLW*RUJR(WUXVNLVFK-KY&KUkFP +FP$XVJHWULHEHQHU%URQ]H)ODFKHU%RGHQPLWEDXFKLJHU :DQGXQJ$XIGHP%RGHQLQQHQHLQ7RQGRDXIJHO¤WHWGHUHLQ *RUJRKDXSWXPJHEHQYRQHLQHP6FKPXFNEDQGPLW'UHLHFNHQ .UHLVHQXQG3XQNWHQ]HLJW*U©QEUDXQH3DWLQD6LQWHUUHVWHZLQ ]LJHV/RFKLQ1DVHGHU*RUJR u 3URYHQLHQ] ([ 6DPPOXQJ :6 0©QFKHQ XP  LP .XQVWKDQGHO HUZRUEHQ %URQ]HERZOZLWKHPERVVHGFHQWUDOGHFRUDWLRQLQVLGHVKRZLQJDJRUJRDQG FLUFOHVWULDQJOHVDQGSRLQWVDURXQGKHUKHDG(WUXVFDQWKFHQWXU\%&*UHHQ patina, remains of sinter, tiny hole in the nose of the gorgo.

 BronzegefäÃ&#x;. 6N\WLVFKVDUPDWLVFK-KY&KU+FP% FDFP+6WDQGIXgFDFP.RQLVFKHU6WDQGIXgGDUDXI HLQRYDOHV%HFNHQPLW]ZHL+HQNHOQPLWMHZHLOVGUHL1RSSHQ 6FKZDU]JU©QH 3DWLQD 5LVV QHEHQ DQWLNHU )OLFNXQJ EHL HLQHP +HQNHOZLQ]LJHV/RFKLQ6WDQGIXg)XgHYHQWODQWLNUHSDULHUW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[*RUQ\  0RVFK $XNWLRQ   /RV  H[ 6©GGHXWVFKH 3ULYDWVDPPOXQJ M.S., seit 1970er Jahren. 9JO 'LH .ULP *ROGHQH ,QVHO LP 6FKZDU]HQ 0HHU *ULHFKHQ  6N\WKHQ  *RWHQ$XVVWHOOXQJ%RQQ  6.DW,,, 7DYULGD=HQWUDOPXVHXP 6LPIHURSRO,QY'+%  %URQ]HYHVVHOZLWKKLJKIRRWDQGRYDOEDVLQ6F\WKRVDUPDWLDQUGQG FHQWXU\%&%ODFNJUHHQSDWLQDDQFLHQWUHSDLUDQG}VVXUHEHVLGHRQHKDQGOH WLQ\KROHLQWKHIRRWIRRWSUREDEO\ZLWKDQFLHQWUHSDLU

 .OLQHQEHLQ*ULHFKHQODQG-KY&KU%URQ]HKRKOJXVV+ 8QWHUWHLOFP2EHUWHLOFP.RPSOH[SUR}OLHUWHUGUHLWHLOLJHU %URQ]HEHVFKODJ HLQHV %HLQHV HLQHU KHOOHQLVWLVFKHQ 6SHLVHOLHJH 6FK¤QHVDPWJU©QH3DWLQDPLQLPDOH$XVEU©FKH u



3URYHQLHQ] ([ 3ULYDWEHVLW] '3 %HUOLQ GDYRU )DPLOLHQVDPPOXQJ 'HXWVFKODQGVHLW$QIDQJGHUHU-DKUH 3UR}OHGWULSDUWLWHEURQ]HPRXQWLQJRIDKHOOHQLVWLFNOLQÂ&#x2DC;QGVWFHQWXU\ %&$WWUDFWLYHGDUNJUHHQSDWLQDVPDOOIUDJPHQWVPLVVLQJ

135




136




e 6FKXSSHQSDQ]HUHLQHV.DWDSKUDNWHQDXV%URQ]H3DUWKLVFKFD -KQ&KU&D6FKXSSHQGLHDXIHLQHPRGHUQH/HGHU ZHVWHDXIJHQÂ&#x201D;KWVLQGVRZLHHLQLJHEHLOLHJHQGH)UDJPHQWH/GHU 6FKXSSHQFDFP,QVJHVDPWYLHUYHUVFKLHGHQH6FKXSSHQ DUWHQD PLWJHUDGHP0LWWHOZXOVWE PLWKDNHQI¤UPLJHP:XOVW QUJHERJHQF PLWKDNHQI¤UPLJHP:XOVWQOJHERJHQG PLW 3DDUHQUHFKWHFNLJHU%HIHVWLJXQJVO¤FKHUD F PLW3DDUHQ UXQGHU /¤FKHU 'LH PHLVWHQ 6FKXSSHQ VLQG UHFKWHFNLJ PLW HL QHP DEJHUXQGHWHQ (QGH (LQLJH 6FKXSSHQ VLQG ]XQJHQI¤UPLJ XQGQDFKREHQVFKPDOHUZHUGHQG7HLOYRQHLQHP5HLWHUSDQ]HU *U©QH3DWLQDWHLOVIUDJPHQWDULVFK u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK$XNWLRQ/RV

Â&#x20AC;.DWDSKUDNWy JU  LVW GLH %H]HLFKXQJ I©U HLQHQ VFKZHU EHZDIIQHWHQ 5HLWHU GHU DQWLNHQ .DYDOOHULH GHU LQ SHUVLVFKHQ U¤PLVFKHQ XQG E\]DQWLQLVFKHQ $UPHHQHLQJHVHW]WZXUGH'HU%HJULIIWDXFKWHUVWPDOVDXIHLQHPÂ&#x201D;J\SWLVFKHQ 3DS\UXV DXV GHP  -K Y &KU DXI 'LH *ULHFKHQ WUDIHQ ]XP HUVWHQ 0DO DXI.DWDSKUDNWHQLQGHQ3HUVHUNULHJHQLP-KY&KU'LH5¤PHUOHUQWHQ GLHJHSDQ]HUWHQ5HLWHULQGHU6FKODFKWYRQ&DUUKDHXQGLP.DPSIJHJHQ 7LJUDQHVGHQ*URgHQLQ7LJUDQRFHUWDY&KUNHQQHQ'LHHUVWHU¤PLVFKH .DWDSKUDNW(LQKHLW ZXUGH XQWHU .DLVHU +DGULDQ u Q &KU  QDFK .RQ~LNWHQPLWVDUPDWLVFKHQ6WÂ&#x201D;PPHQDXIJHVWHOOW'DGLH$XVU©VWXQJXQG $XVELOGXQJGHU.DWDSKUDNWHQVHKUNRVWVSLHOLJZDUZDUHQVLHQLFKW]DKOUHLFK YHUWUHWHQ(UVWXQWHU.DLVHU*DOOLHQXVZXUGHLQHLQHU0LOLWÂ&#x201D;UUHIRUPXPQ &KUHLQHVFKZHUH5HLWHUHLQDFKSHUVLVFKHP9RUELOGJHELOGHWGLHGDV5©FNJUDW GHUVSÂ&#x201D;WDQWLNHQU¤PLVFKHQ$UPHHZXUGH %URQ]HFXLUDVVRIDFDWDSKUDFWZLWKDERXWVFDOHVRIIRXUGLIIHUHQWW\SHV VHZQRQDPRGHUQOHDWKHUYHVW3DUWKLDQDERXWVWUGFHQWXU\$'*UHHQ patina, some fragments missing, enclosed several loose scales.

137




 Wangenschutz mit Dekor. 5¤PLVFK  -K Q &KU + FP % FP/LQNH:DQJHQNODSSHHLQHV,QIDQWHULHKHOPHVPLWJUDYLHU WHP'HNRU,QHLQHPUHFKWHFNLJHQ%LOGIHOGHLQ6LOHQ'LRQ\VRV XQG $ULDGQH OLQNV GDYRQ (URV 'DQHEHQ 9LHUSDVVRUQDPHQW 6FKXSSHQ XQG JHRPHWULVFKHV 0XVWHU VRZLH 9ROXWHQ XQG (IHXUDQNHQ*U©QH3DWLQDHLQNOHLQHV/RFKREHUH%HIHVWLJXQJV ODVFKHQZLHGHUDQJHVHW]W u Provenienz: Ex Süddeutsche Privatsammlung M.S., seit 1970er Jahren. 5RPDQEURQ]HOHIWFKHHNSLHFHRIDQLQIDQWU\KHOPHWZLWKHQJUDYHGGHFRUDWLRQ GHSLFWLQJ (URV D VLOHQRV 'LRQ\VRV DQG $ULDGQH DQG TXDWUHIRLO VFDOH DQG JHRPHWULFDO SDWWHUQ UG FHQWXU\ $' *UHHQ SDWLQD D WLQ\ KROH XSSHU PRXQWLQJEUDFNHWVUHDWWDFKHG

 Beinschiene aus Bronze. 5¤PLVFK-KQ&KU+FP %FP0LW0LWWHOJUDWXQGXUVSU©QJOLFKVHLWOLFKHQVHQEH IHVWLJWGXUFK1LHWHQ8QWHQHLQQDFKREHQXPJHERJHQHU5DQG 6HLWOLFKMHZHLOVHLQH3UR}OLHUXQJ$PVHLWOLFKHQ5DQGHLQJHSXQ] WH ,QVFKULIW 597,/,96 5(',&96 $XVU©VWXQJVJHJHQVWDQG HLQHV,QIDQWHULVWHQRGHU.DYDOOHULVWHQ*U©QH3DWLQDVHQDXV JHEURFKHQDPREHUHQ5DQGUHVWDXULHUW u Provenienz: Ex Süddeutsche Privatsammlung M.S., seit 1970er Jahren. 5RPDQEURQ]HJUHDYHZLWKSXQFKHGLQVFULSWLRQSDUWRIDQHTXLSPHQWRIDQ LQIDQWU\PDQRUWURRSHUQGUGFHQWXU\$'*UHHQSDWLQDH\HOHWVEURNHQ upper rim partially replaced and restored.

138

 Fragmente eines Schuppenpanzers. 5¤PLVFK  -K Q &KU D  % FP / FP E  % FP / FP F  % FP / FP =XQJHQI¤UPLJH %URQ]HEOHFKH GLH PLW %URQ]HGUDKW KDOEVWDUU PLWHLQDQGHUYHUEXQGHQVLQG3 Stück! u Provenienz: Ex Süddeutsche Privatsammlung M.S., seit 1970er Jahren. 9JO0&%LVKRS-&1&RXOVWRQ5RPDQ0LOLWDU\(TXLSPHQWIRUPWKH 3XQLF:DUWRWKHIDOORI5RPH  6$EE )UDJPHQWVRIDEURQ]HVHPLULJLGVFDOHDUPRXUZLWKWRQJXHVKDSHGVFDOHVMRLQW ZLWKEURQ]HZLUH5RPDQQGFHQWXU\$'3 pieces!

 Römischer Dolch. 5¤PLVFK-KQ&KU/FP(LVHQ 6RJ 3XJLR 7\S .©Q]LQJ /DQ]HWWI¤UPLJHV %ODWW PLW VWDUN JH VFKZXQJHQHU6FKQHLGHXQGDXVJHSU”JWHU0LWWHOULSSHVFKPDOHU ODQJHU*ULIIPLW.QDXI2EHU~”FKHNRUURGLHUWLQWDNW u 3URYHQLHQ]([1DFKODVV('VWHUUHLFKHU-DKUH 7K)LVFKHU'LH$UPHHGHU&DHVDUHQ$UFK”RORJLHXQG*HVFKLFKWH   6$EE 'HU3XJLRJHK¤UWH]XU%HZDIIQXQJGHUU¤PLVFKHQ,QIDQWHULHVROGDWHQXQGLVW I©UGLH=HLWDE&DHVDUDOV%HVWDQGWHLOGHU%HZDIIQXQJVLFKHUEHOHJW ,URQGDJJHUVRFDOOHG3XJLRRIWKHW\SH.©Q]LQJZLWKODQFHRODWHEODGHDQG FHQWUDOULEDQGORQJKDQGOHZLWKSRPPHO5RPDQQGUGFHQWXU\$' Surface corroded, intact.








139










140


 Römisches Bronzemesser. -KQ&KU(LVHQXQG%URQ]H/FP'HUNDQ WLJH*ULIIOHLFKWJHERJHQXQWHQPLWHLQHU9ROXWHYHU]LHUWXQGDP5DQGSXQ]LHUW $P*ULIIHQGHNXJHOI¤UPLJHU$XIVDW]XQGDXIGHP*ULII]ZHL$XVEXFKWXQJHQ I©U(LQODJHQ'LH6FKQHLGHPLWOHLFKWJHZ¤OEWHP5©FNHQXQGDP5DQGVW”UNHU NRUURGLHUW+HUUOLFKHJU©QH3DWLQD.OLQJHVWDUNNRUURGLHUW u 3URYHQLHQ](UZRUEHQDXVGHP1DFKODVVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ%-VHLWHU -DKUHQLQ)DPLOLHQEHVLW] 5RPDQNQLIHZLWKEURQ]HKDQGOHUGWKFHQWXU\$'7KHEODGHVKRZVVWURQJFRUURVLRQ 1LFHJUHHQSDWLQD

 5¤PLVFKHV.ODSSPHVVHU-KQ&KU RGHUIU©KHU (LVHQXQG%URQ]H/FP 'HU*ULIILQ)RUPHLQHVJH~©JHOWHQ3DQWKHUVPLWDXIJHULFKWHWHP.¤USHURKQH 9RUGHUEHLQHDEHUPLWKRFKJHUHFNWHQ)O©JHOQ,P0DXOHLQNOHLQHU%URQ]HULQJ 'LH6FKQHLGHPLWOHLFKWJHZ¤OEWHP5©FNHQPrachtexemplar!+HUUOLFKHJU©QH 3DWLQDDXFKLP(LVHQWHLOH[]HOOHQWH(UKDOWXQJ u 3URYHQLHQ]([:60©QFKHQ6HLWGHQIU©KHQHU-DKUHQLQGHXWVFKHP3ULYDWEHVLW] 5RPDQRUKHOOHQLVWLFIROGLQJNQLIHZLWKEURQ]HKDQGOHLQIRUPRIDQXSULJKWZLQJHGSDQWKHU VWFHQWXU\$'RUHDUOLHU

 Messergriff in Form eines Miniaturgerätefußes. 5¤PLVFK    -K Q &KU / FP %URQ]HJXVV *ULII HLQHV .ODSSPHVVHUV $XI HLQHU UXQGHQ SUR}OLHUWHQ %DVLVVWHKWHLQH/¤ZHQWDW]HGHUHQ%HLQLQHLQHQ/¤ZHQNRSI©EHUJHKW$P+LQ WHUNRSIVHW]WHLQHUHFKWHFNLJHSUR}OLHUWH%DVLVDQ$XIGHU5©FNVHLWHGHU6FKOLW] I©UGLH$XIQDKPHGHU.OLQJH*U©QH3DWLQDLQWDNW u



3URYHQLHQ] ([ 3ULYDWVDPPOXQJ 6: &KLHPJDX LQ GHQ HU -DKUHQ LP 0©QFKQHU .XQVWKDQGHOHUZRUEHQ %URQ]HIROGLQJNQLIHKDQGOHLQVKDSHRIDPLQLDWXUHGHYLFHEDVHZLWKOLRQSDZDQGKHDG5RPDQ QGUGFHQWXU\$'*UHHQSDWLQDLQWDFW

 Messergriff in Form einer Hundeprotome. 5¤PLVFK-KQ&KU/FP %URQ]HJXVV*ULIIPLWHLQHP+XQGHYRUGHUWHLOPLWDXVJHVWUHFNWHQ9RUGHUO”XIHQ DXIGHQHQGLH6FKQDX]HOLHJW%UDXQJU©QH3DWLQDZLQ]LJHV/RFK.UDW]HU u 3URYHQLHQ] ([ 3ULYDWVDPPOXQJ 6: &KLHPJDX LQ GHQ HU -DKUHQ LP 0©QFKQHU .XQVWKDQGHOHUZRUEHQ %URQ]HNQLIHKDQGOHLQVKDSHRIDGRJyVSURWRPH5RPDQVWQGFHQWXU\$'%URZQJUHHQ patina, tiny hole, scratches.

 Henkelattasche mit Schauspieler. 5¤PLVFK-KQ&KU/FP%URQ ]HYROOJXVV 6LW]HQGHU 6FKDXVSLHOHU PLW HLQHU 7KHDWHUPDVNH 5RWEUDXQJU©QH 3DWLQD)UDJPHQW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[6©GGHXWVFKH3ULYDWVDPPOXQJ M.S., seit 1970er Jahren. 3DUWRIDEURQ]HKDQGOHDWWDFKPHQWZLWKDVLWWLQJDFWRUZLWKWKHDWUHPDVN5RPDQQGUG FHQWXU\$'5HGEURZQDQGJUHHQSDWLQDIUDJPHQW

 Lampenhenkel mit Silenskopf. 5¤PLVFK-KQ&KU+FP%URQ]H YROOJXVV5XQGVWDELJHU*ULIIGHULQHLQHUDXVHLQHP%ODWWNHOFKZDFKVHQGHQ6L OHQVPDVNHPLWVSLW]HQ2KUHQHQGHW©EHUGHP.RSI]ZHL9ROXWHQ+LQWHUGHP .LQQVHI©UGLH%HIHVWLJXQJGHV/DPSHQGHFNHOVSehr schönes Exemplar!*U© QH3DWLQD6SLW]HHLQHU9ROXWHIHKOW u Provenienz: Ex süddeutsche Privatsammlung M.S., 1970er Jahre.



%URQ]HODPSKDQGOHHQGLQJLQD6LOHQVPDVNFRPLQJRXWRIDFKDOLFH5RPDQVWUGFHQWXU\ $'*UHHQSDWLQDWLSRIRQHYROXWHPLVVLQJAttractive exemplar!

141




 7HLOHHLQHV.Â&#x201D;VWFKHQEHVFKODJVDXV%URQ]H6SÂ&#x201D;WDQWLN +Â&#x201D;OIWH-KQ&KU/FDXFDFP+FP*H WULHEHQ 'DUJHVWHOOW VLQG DXI GHP %URQ]HEOHFKEDQG VHFKV 0HGDLOORQV PLW GUHL XQWHUVFKLHGOLFKHQ 0RWL YHQGLHVLFKDEZHFKVHOQD 5HLWHUGDU©EHU6WHUQE  0HGXVHQKDXSWF 3DQ]HUE©VWHGDYRU/DQ]HGDKLQ WHU,QVFKULIW=,,=ZLVFKHQGHQJURgHQ0HGDLOORQV NOHLQHUHPLW6WHUQHQXQGPÂ&#x201D;QQOLFKHQ%©VWHQLQGHU 0LWWHREHQ(LGHFKVHXQG'HO}QXQGXQWHQ(LGHFK VHXQG%LHQH$P5DQGZLUGGHU%OHFKVWUHLIHQYRQ HLQHU %XFNHOUHLKH JHUDKPW %HLGH 7HLOH PLW 5LVVHQ XQG NOHLQHQ /¤FKHUQ VRZLH IHKOHQGHQ )UDJPHQWHQ JU¤gHUHV7HLODP5DQGJH~LFNW u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06HU Jahre. 9JO 6SÂ&#x201D;WDQWLNH ]ZLVFKHQ +HLGHQWXP XQG &KULVWHQWXP $XVVWHOOXQJ0©QFKHQ  61U 3DUWVRIDEURQ]HER[}WWLQJGHSLFWLQJVL[PHGDOOLRQVZLWKWKUHH GLIIHUHQWPRWLYHVD 5LGHUZLWKVWDUE 0HGXVDF &XLUDVVHG EXVWLQIURQWRILWDODQFHEHKLQGWKHOHWWHU=,,,QEHWZHHQ VPDOOHUPHGDOOLRQVZLWKVWDUVDQGPDOHEXVWVLQWKHFHQWHURQ WRSDOL]DUGDQGDGROSKLQEHORZDOL]DUGDQGDEHH$WWKHHGJHV DURZRIEXFNOHV/DWH$QWLTXHQGKDOIWKFHQWXU\$'%RWK SDUWVZLWK}VVXUHVDQGWLQ\KROHVDQGPLVVLQJIUDJPHQWVWKH ELJJHURQHZLWKRQHUHSDLUDWWKHHGJH

 Beschlag von einem Sattelriemen mit Inschrift. Rö PLVFK  -K Q &KU  [ FP 5HFKWHFNLJHV YHU]LQQWHV%URQ]HEOHFKPLWUXQGHUEXFNHODUWLJHU(U

142




KHEXQJ DQ ]ZHL 6HLWHQ MHZHLOV GUHL %HIHVWLJXQJVO¤FKHU LQ GHU 0LWWH HLQH 9HUWLHIXQJ PLW HLQHP %HIHVWLJXQJVORFK $P LQQH UHQ5DQGGHV%XFNHOVJHSXQ]WH,QVFKULIW&2+9,75+795 (49(675,(LQH(FNHIHKOWZLQ]LJHV)UDJPHQWDQHLQHP5DQG DXVJHEURFKHQUHFKWHREHUH(FNHZLHGHUDQJHVHW]W5HVWHYRQ 9HU]LQQXQJ u Provenienz: Ex Süddeutsche Privatsammlung M.S., seit 1970er Jahren. %URQ]H}WWLQJRIDVDGGOHVWUDSZLWKSXQFKHGLQVFULSWLRQ&2+9,75+795 (49(675,5RPDQVWFHQWXU\$'2QHFRUQHUDQGRQHIUDJPHQWRIWKH XSSHUHGJHEURNHQULJKWXSSHUFRUQHUUHDWWDFKHGWUDFHVRIWLQQLQJ

211 Teil eines Pferdegeschirrs. 7KUDNLVFKFD-KY&KU/FP %URQ]HJXVV ,Q )RUP HLQHV VWLOLVLHUWHQ ,JHOV PLW QDFK YRUQH JHVWUHFNWHQ9RUGHUEHLQHQDXIGHU5©FNVHLWHVH*U©QVFKZDU]H 3DWLQDLQWDNW u 3URYHQLHQ]([3ULYDWVDPPOXQJ6:&KLHPJDXLQGHQHU-DKUHQLP 0©QFKQHU.XQVWKDQGHOHUZRUEHQ 3DUWRIDEURQ]HKRUVHKDUQHVVLQVKDSHRIDKHGJHKRJZLWKH\HOHWDWWKHEDFNVLGH 7KUDFLDQDERXWWKFHQWXU\%&*UHHQEODFNSDWLQDLQWDFW

212 Balkenwaage. 5¤PLVFKH.DLVHU]HLW0LWWHODOWHU(LVHQ'HU%DO NHQ /FP PLWLQVNULELHUWHU6NDODXQGGUHL+DNHQ$XgHU GHPHLQNRQLVFKHV*HZLFKWPLW%OHLYHUI©OOXQJ J .OHLQHU $XVEUXFKDP*HZLFKWVRQVWLQWDNW u

211

212

143


213

3URYHQLHQ]([6DPPOXQJ.95KHLQODQG'DYRU6DPPOXQJ%UÂ&#x201D;XQLQJ 5KHLQODQG ,URQVWHHO\DUGVFDOHZLWKFRQLFDOZHLJKW5RPDQ,PSHULDO3HULRG0LGGOH $JH:HLJKWZLWKVPDOOGHQWRWKHUZLVHLQWDFW

213 Pateragriff aus Alabaster. 5¤PLVFKH.DLVHU]HLW-KQ&KU /FP)UDJPHQWHLQHV6WHLQJHIÂ&#x201D;gHVPLWHLQHP7HLOGHUPLW2U QDPHQWIULHVHQYHU]LHUWHQ:DQGXQJVRZLHGHPJHULSSWHQ*ULII GHU LQ HLQHP :LGGHUNRSI HQGHW XQG DXI GHU 2EHUVHLWH HLQHQ 7K\UVRV]HLJW)UDJPHQWDULVFKHLQPDOJHNOHEW u 3URYHQLHQ]([6DPPOXQJ5:+HVVHQ)DPLOLHQEHVLW]VHLWYRU )UDJPHQWRIDQDODEDVWHUSDWHUDFRPSULVLQJSDUWRIWKHERZODQGWKHKDQGOH GHFRUDWHGZLWKDWK\UVRVDQGWHUPLQDWLQJLQDUDPhVKHDG5RPDQ,PSHULDO 3HULRGVWQGFHQWXU\$'5HDVVHPEOHGIURPWZRSLHFHVIUDJPHQWDU\

214 Fingerkunkel aus Bein. 5¤PLVFK    -K Q &KU / FP /DQJHU 6WDE PLW SUR}OLHUWHP (QGH PLW $XIVDW] LQ )RUP HLQHU )UDXGLHHLQHP.LQGGLH%UXVWJLEW=XLKUHQ)©gHQHLQH*DQV 2EHU~Â&#x201D;FKHEHVWRgHQ5LQJJHEURFKHQ.RSIIUDJPHQWHIHKOHQ u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   H[ /RV  H[ Süddeutsche Privatsammlung M.S., seit 1970er Jahren. 'LVWDIIZLWKDIHPDOHQXUVLQJKHUEDE\EHVLGHDJRRVHVWUGFHQWXU\$' 6XUIDFHZRUQORRSEURNHQIUDJPHQWVRIWKHKHDGPLVVLQJ

215

214

215 Teil einer Fingerkunkel aus Bein. 5¤PLVFK    -K Q &KU / FP $XIVDW] LQ )RUP HLQHU 9HQXV 3XGLFD Prägnant und detailreich geschnitzt!6WDEXQG5LQJVRZLH)©gHXQG+DDUNQRWHQ JHEURFKHQ u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   H[ /RV  H[ Süddeutsche Privatsammlung M.S., seit 1970er Jahren. 3DUWRIDGLVWDIISUHVHUYHGLVDVWDWXHWWHRI9HQXV3XGLFDVWUGFHQWXU\ $'/RRSURGKDLUNQRWDQGIHHWDUHEURNHQ6KDUSO\VFXOSWXUHG}JXUH

144


/$03(1



e Bronzelampe mit Lampenständer. )U©KE\]DQWLQLVFK    -K Q &KU / FP + 6W”QGHU FP /DPSH PLW RYRLGHP .¤USHU XQG ODQJHU 6FKQDX]H PLW RNWRJRQDOHP %UHQQORFK PLW NRQNDYHLQJH]RJHQHQ6HLWHQ'DVUXQGHOORFKZLUGYRQHLQHP

PLW 6FKDUQLHU EHIHVWLJWHQ JORFNHQI¤UPLJHQ 'HFNHO EHGHFNW ]X EHLGHQ6HLWHQHLQCRLP5HOLHIDXIGHP&RUSXVPLWHLQJHULW]WHP $ XQG W 6FKQDX]H XQG +HQNHO ELOGHQ DP EHUJDQJ ]XP .¤USHU .DXOHV XQG HLQHQ %ODWWNUDQ] $XI GHP ]HQWUDOHQ %ODWW

145




DXI GHU 2EHUVHLWH VLW]W HLQ 'HO}Q GHU HLQH VH ELOGHW 'HU WURPSHWHQI¤UPLJH +HQNHO GLHQW LP REHUHQ 7HLO DOV NOHLQHV %HK”OWQLV I©U :HLKUDXFK "  XP GHVVHQ 5DQG HLQ VWHUQDUWLJHU .UDQ]PLW.XJHOQDXIGHQ6SLW]HQO”XIW.XSSHODUWLJHU'HFNHO PLW GUHL 0DVNHQ XQG HLQHP $XIVDW] PLW 6FKDUQLHUJHOHQN ,P 'HFNHOPHKUHUHNOHLQH/¤FKHUVHYRUQHXQGHLQHZHLWHUHDP +HQNHO GLHQHQ ]XU $XIK”QJXQJ PLW .HWWHQ 'D]X GUHLI©gLJHU 6W”QGHU PLW NRULQWKLVFKHP .DSLWHOO Prachtexemplar! ,QWDNW 6W”QGHUXQG/DPSHQLFKW]XVDPPHQJHK¤ULJ u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ,VUDHO([SRUWLHUW DXV ,VUDHO PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL*RUQ\ 0RVFK$XNWLRQ/RVXQG/RV )©UGDV([WUDIDFKPLWGXUFKEURFKHQHP'HFNHOYJO/%RXUDV0*3DUDQL /LJKWQLQJLQ(DUO\%\]DQWLXP  6 *RUJHRXVHDUO\E\]DQWLQHEURQ]HODPSZLWKVPDOOGUDZHUIRULQFHQVHDWWRSRI KDQGOHDQGDVHSDUDWHODYLVKO\GHFRUDWHGVWDQGWKWKFHQWXU\$',QWDFW /DPSDQGVWDQGQRWEHORQJLQJ



 %URQ]HODPSH PLW .DQGHODEHU )U©KE\]DQWLQLVFK    -K Q &KU + 6W”QGHU FP / /DPSH FP %URQ]HYROOJXVV /DPSHPLWRYRLGHP&RUSXVXQGNXU]HU6FKQDX]HPLWUXQGHP %UHQQORFKEHUGHPUXQGHQOORFKHLQPLW6FKDUQLHUEHIHVWLJ WHU 'HFNHO GHU YRQ HLQHU 7DXEH EHNU¤QW ZLUG 'HU JHERJHQH +HQNHOJULIIHQGHWLQHLQHP*UHLIHQNRSIXQWHUGHP+HQNHOHLQH 5LQJ¤VH.DQGHODEHUPLWGUHL3DQWKHUI©gHQHLQHU%ODWWVFK©U]H PLWVWLOLVLHUWHQ5RVHWWHQXQG9ROXWHQHLQHPPHKUIDFKSUR}OLHU WHP6FKDIWVRZLHHLQHPUXQGHQ7HOOHUPLW'RUQ*U©QH3DWLQD .RUURVLRQVVSXUHQLP)XgGHV/DPSHQVW”QGHUV5LVV'HFNHO¤VH GHU/DPSHJHEURFKHQ u Provenienz: Ex süddeutsche Privatsammlung M.S., 1970er Jahre. %URQ]HODPSZLWKOLGFURZQHGE\DGRYHDQGDKDQGOHHQGLQJLQDJULI}QKHDG DQGVWDQGZLWKSDQWKHUIHHW(DUO\%\]DQWLQHWKWKFHQWXU\$'*UHHQ SDWLQD}VVXUHLQWKHIRRWRIWKHVWDQGH\HOHWRIOLGEURNHQ

146


e *URgH %URQ]HODPSH PLW KRKHP +HQNHO 5¤PLVFK ZRKO 1RUGDIULND  -K Q &KU / FP + FP 7\S /RHVFKFNH ,9 )ODFKHU UXQGHU .¤USHU PLW YLHU NRQ ]HQWULVFKHQ .UHLVULOOHQ 6FKQDX]H PLW 9ROXWHQ DXI GHU 6FKQDX]HQGHFNSODWWH 8QWHUVHLWH DOV 0XVFKHO JHIRUPW +RFK XQG QDFK YRUQH JH]RJHQHU +HQNHO LQ )RUP HL QHV%O©WHQVWDPPVDXVGLHVHPZDFKVHQNOHHEODWWI¤UPLJ GUHL$NDQWKXVEOÂ&#x201D;WWHUDQGHUHQ9RUGHUVHLWHHLQH/HRSDU GHQSURWRPH /DPSH VLW]W DXI HLQHP JORFNHQI¤UPLJHQ 6WÂ&#x201D;QGHU *U©QH 3DWLQD $NDQWKXVEOÂ&#x201D;WWHU XQG 7HLO GHV 6WÂ&#x201D;QGHUVUHVWDXULHUWNOHLQHV/RFKXQG5LVVLP&RUSXV +HQNHOZLHGHUDQJHVHW]W u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ  7HO $YLY ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ/RV XQG$XNWLRQ/RV /DUJHEURQ]HODPS5RPDQVWFHQWXU\$'7\SH/RHVFKFNH,9 ZLWKEHOOVKDSHGVWDQGDQGKLJKKDQGOHZLWKDFDQWKXVOHDYHVDQG SURWRPHRIDSDQWKHU/HDYHVDQGVWDQGSDUWLDOO\UHVWRUHGVPDOOKROH in corpus, handle reattached.



218

147




e Bronzelampe mit Weihrauchbrenner. )U©KE\]DQWLQLVFK    -K Q &KU / FP/DPSHPLWRYRLGHP.¤USHUXQG ODQJHU6FKQDX]HPLWRNWRJRQDOHP%UHQQ ORFK PLW NRQNDYHQ 6HLWHQ 'DV UXQGH OORFKZLUGYRQHLQHPPLW6FKDUQLHUEH IHVWLJWHQ'HFNHOJHVFKORVVHQGHUPLWHL QHU0DVNHPLW]ZHL+¤UQHUQYHU]LHUWLVW 6FKQDX]H XQG +HQNHO ELOGHQ DP EHU JDQJ]XP.¤USHU.DXOHVXQGHLQHQ%ODWW NUDQ] 'HU QDFK REHQ JH]RJHQH +HQNHO JHKWLQHLQHNOHLQH6FKDOH©EHUHLQ%ODWW GHV %ODWWNUDQ]HV DP +HQNHODQVDW] LVW HEHQIDOOV KRFKJH]RJHQ VRGDVV HV GLH 6FKDOH YRQ GHU DQGHUHQ 6HLWH VW©W]W ,KU 5DQG ZLUG YRQ HLQHP .UDQ] DXV DOWHU QLHUHQGHQ NOHLQHQ XQG JU¤gHUHQ =DFNHQ PLW%O©WHQPRWLYDXIGHU6SLW]HXPJHEHQ 5©FNVHLWLJ EH}QGHW VLFK HLQ 6FKDUQLHU I©U GLH $XIQDKPH HLQHV GXUFKO¤FKHUWHQ NXSSHODUWLJHQ 'HFNHOV PLW %O©WHQNU¤ QXQJ GHU GLH 6FKDOH YHUVFKOLHgHQ NDQQ ,Q]ZHLVHQHLQHDP6FKQDX]HQDQVDW] GLHDQGHUHDQGHU9RUGHUVHLWHGHU6FKDOH VLQG .HWWHQ JHK”QJW GLH JHPHLQVDP DQ HLQHU.HWWHPLW+DNHQK”QJHQ+HOOJU©QH 3DWLQD DQWLNH )OLFNXQJ XQG ]ZHL NOHLQH /¤FKHUDXIGHU8QWHUVHLWH u Provenienz: Ex Shlomo Moussaieff Collection, 7HO$YLY([SRUWLHUWPLWGHU$XVIXKU JHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL*RUQ\ 0RVFK$XNWLRQ/RV XQG/RV 'LH'RSSHOIXQNWLRQDOV/DPSHXQG:HLKUDXFK EUHQQHU }QGHW VLFK YHUPXWOLFK DXFK EHL HLQHU /DPSH LP 0HWURSROLWDQ 0XVHXP /%RXUDV  03DUDQL /LJKWLQJ LQ (DUO\ %\]DQWLXP    II GRUW DOOHUGLQJV QXU DXV GHP )RWR ]X HU VFKOLHgHQ  (DUO\E\]DQWLQHEURQ]HODPSZLWKVPDOOGUDZHU for incense at top of handle, hinged mask lid for SRXULQJKROHDQGKLQJHGGRPHOLNHOLGIRUGUDZHU WKWKFHQWXU\$'$QFLHQWPHQGLQJDQGWZR WLQ\KROHVDWERWWRPJUHHQSDWLQD

e 6WLHUNRS~DPSH5¤PLVFKH.DLVHU]HLW -KQ&KU/FP%URQ]HODPSHLQ )RUPHLQHV6WLHUNRSIHVGDV0DXOLVWDOV /DPSHQVFKQDX]H JHVWDOWHW $XI GHU .D ORWWHHLQUXQGHV(LQI©OOORFKGDVGXUFKHL QHQNOHLQHQPLW6FKDUQLHUDQJHEUDFKWHQ 'HFNHOYHUVFKOLHgEDULVW5©FNZ”UWLJHLQ VHQJULII*U©QH3DWLQD6WDEGHV6FKDU QLHUVIHKOWDQVRQVWHQLQWDNW u Provenienz: Ex Shlomo Moussaieff Collection, 7HO$YLY([SRUWLHUWPLW$XVIXKUJH QHKPLJXQJGHULVUDHOLVFKHQ$QWLNHQEHK¤UGH%HL *RUQ\ 0RVFK$XNWLRQ/RVXQG /RV 

148

5RPDQ }JXUDO EURQ]H ODPS LQ IRUP RI D EXOOyV KHDGZLWKKLQJHGOLGIRUWKH}OOLQJKROHDWWRSRI KHDGVWQGFHQWXU\$'*UHHQSDWLQDSDUW of hinge missing, intact.


221 ย1HJHUNRS~DPSHw Rรถmische .DLVHU]HLW-KQ&KU/FD FP%URQ]HODPSHLQ)RUPGHV .RSIHV HLQHV 6FKZDU]DIULNDQHUV GHVVHQ0XQGDOV/DPSHQVFKQDX ]HJHVWDOWHWLVW$XIGHU.DORWWHHLQ UXQGHV (LQIยฉOOORFK XQG HLQH JH EDOOWH )DXVW *UยฉQVFKZDU]H 3DWL QDZLQ]LJH/ยคFKHULP%RGHQXQG DXIGHP&RUSXV]ZHLWHยVHYRQ 'HFNHOVFKDUQLHUJHEURFKHQ'HN NHOIHKOW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XN WLRQ   /RV  H[ 6ยฉGGHXW sche Privatsammlung M.S., seit 1970er Jahren. 9JO $ &DWDORJXH RI WKH /DPSV LQ WKH %ULWLVK0XVHXP,9  64 PLW7DI /DPSHRKQH)DXVW  5RPDQ }JXUDO EURQ]H ODPS LQ IRUP RI WKHKHDGRIDQ$IULFDQZLWKRQ}VWRQWRS QGUGFHQWXU\$'*UHHQSDWLQDWLQ\ KROHVRQERWWRPDQGFRUSXVVHFRQGH\HOHW RIWKHPLVVLQJOLGEURNHQ

221

222 Bronzelampe mit Lรถwenkรถpfen. 5ยคPLVFKH .DLVHU]HLW  -K Q &KU + PLW +HQNHO  FP / FP /DPSH PLW EDXFKLJHP .ยคUSHU ODQJJHVWUHFNWHU UXQGHU 6FKQDX]H XQG UHOLH}HUWHP EUHL WHP 5LQJKHQNHO (LQ JURgHV (LQ IยฉOOORFK PLW HLQHP 6FKXOWHUULQJ XPUDKPW 3UR}OLHUWHU %RGHQ PLW ~DFKHP 6WDQGULQJ =X EHLGHQ 6HLWHQ GHV /DPSHQNยคUSHUV MH HLQ QDWXUDOLVWLVFK JHVWDOWHWHU /ยคZHQ NRSI 0LW *XWDFKWHQ GHV 5DWK gen Forschungslabor Berlin, 1982 .RSLH  *UยฉQH 3DWLQD %UHQQ ORFK SDUWLHOO DXVJHEURFKHQ NOHL QH%HVWRgXQJHQDP6WDQGULQJ u 3URYHQLHQ]([6DPPOXQJ96%HUOLQ HU-DKUHELV 5RPDQ EURQ]H ODPS ZLWK ORQJ VSOD\HG QR]]OH KDQGOH DQG WZR OLRQPDVNV RQ HDFK VLGH RI ERG\ 5RPDQ VW FHQWXU\ $'*UHHQSDWLQDSDUWRIKLQJHDQGWLQ\ SDUWV RI D EDVH PLVVLQJWith a report from Rathgen research laboratory, Berlin 1982 (copy)!

222

149


e *URWHVNHQNRS~DPSH 5¤PLVFKH .DL VHU]HLW  -K Q &KU / FP .RSI PLWJURgHQ2KUHQHLQHU+DXEHVSLW ]HU JURgHU 1DVH GHVVHQ 0XQG DOV /DPSHQVFKQDX]H JHVWDOWHW LVW 2KU O”SSFKHQ GXUFKERKUW $XI GHU .DORW WH HLQ UXQGHV (LQI©OOORFK VRZLH HLQH UHFKWHFNLJH $XIK”QJHYRUULFKWXQJ PLW ]ZHL/¤FKHUQGUHLQRSSHQDUWLJH)©g FKHQDXIGHU8QWHUVHLWH*U©QH3DWLQD ZLQ]LJH*XVVIHKOHU%UHQQORFKDXVJH EURFKHQVRQVWLQWDNW u

223

Provenienz: Ex Shlomo Moussaieff Collection, ,VUDHO([SRUWLHUWDXV,VUDHOPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ /RVXQG 9JO'0%DLOH\$&DWDORJXHRIWKH/DPSVLQ WKH%ULWLVK0XVHXP,9  6I4 PLW7DI 1HJHUNRS~DPSHw  5RPDQ }JXUDO EURQ]H ODPS LQ IRUP RI D JURWHVTXHKHDGVWFHQWXU\$'*UHHQSDWLQD PLQRU FDVWLQJ GHIHFWV EXUQLQJ KROH EURNHQ otherwise intact.

224 Tonlampe in Form eines Symplegma. 5¤PLVFK    -K Q &KU +HOOHU 7RQ PLW JUDXHP EHU]XJ + FP /FP)LJ©UOLFKH/DPSHPLW(LQ I©OORFKDXIGHU5©FNVHLWHX'RFKWORFK DPUHFKWHQ5DQGVRZLHHLQHU$XIK”Q JH¤VHLQ*HVWDOWHLQHV=ZHUJHQSDDUHV EHLP *HVFKOHFKWVDNW D WHUJR 6LQ WHUUHVWH ZLQ]LJH %HVWRgXQJHQ VRQVW LQWDNW u 3URYHQLHQ] ([ *RUQ\  0RVFK 0©QFKHQ $XNWLRQ/RVDXV0©QFKQHU .XQVWKDQGHOHUZRUEHQLQGHQHU-DKUHQ 3XEOL]LHUWLQ+'HMHDQ/DPSHV$QWLTXHV’ WUDYHUVOHV$JHV/H&RUSXV7DIHO 1/

224

5RPDQ FOD\ ODPS LQ IRUP D GZDUIFRXSOH PDNLQJ VH[ D WHUJR VW  QG FHQWXU\ $' 5HVWRIVLQWHULQWDFW

225 *ULHFKLVFKH7RQODPSHFD-KY &KU/FP+ PLW+HQNHO FP +HOOHU 7RQ PLW VFKZDU]HP EHU]XJ /DQJJHVWUHFNWH UXQGOLFKH 6FKQDX]H JURgHV(LQI©OOORFKXQGJURgHUULQJI¤U PLJHU*ULII0HKUHUHNOHLQH%HVWRgXQ JHQNOHLQH6SU©QJHXPGHQ*ULIIXQG DP.¤USHULQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ HU-DKUHELV 9JO+'HMHDQ/H&RUSXV/DPSHV$QWLTXHV 0

225

150

*UHHN FOD\ ODPS EODFN JOD]HG ZLWK D ORQJ QR]]OHDQGDULQJKDQGOH*UHHFHWKUG FHQWXU\%&0DQ\VPDOOEUXFHVVPDOOFUDFNV intact.






228

 Tonlampe mit Rippendekor. 5¤PLVFKFD-KQ&KU/FP + PLW +HQNHO  FP 7\S /RHVFKFNH ,9 PLW VSLUDOI¤UPLJ YHU]LHUWHP +HQNHO 5RWHU 7RQ PLW EUDXQHP EHU]XJ .¤USHU PLW 5LHIHQ YHUVHKHQ $XI GHP YHUWLHIWHQ 6SLHJHO 5RVHWWH $XV PHKUHUHQ7HLOHQ]XVDPPHQJHNOHEWSDUWLHOOVWDUNHU%HODJ u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 5RPDQFOD\ODPSRIWKHW\SH/RHVFKFNH,9ZLWKVSLUDOKDQGOHDQGULEEHGERG\ 5HGFOD\ZLWKEURZQVOLS7KHGLVFXVZLWKURVHWWH5RPDQDERXWVWFHQWXU\ $'5HDVVHPEOHGIURPVHYHUDOSLHFHVSDUWLDOO\WKLFNFRYHULQJ

 Tonlampe mit Viktoria. 5¤PLVFK(QGH$QIDQJ-KQ&KU /FP+ PLW+HQNHO FP7\S/RHVFKFNH9,,,PLW+HQNHO 6FKXOWHU 9,,D +HOOURWHU 7RQ PLW EUDXQHP EHU]XJ $XI GHP 6SLHJHO 9LNWRULD PLW 3DOP]ZHLJ XQG .UDQ] DXI HLQHP *OREXV VWHKHQG $XI GHU 8QWHUVHLWH :HUNVWDWWPDUNH 09175(37 3DUWLHOO$EODJHUXQJHQ+HQNHOPLW+HUVWHOOXQJVIHKOHULQWDNW u

3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 5RPDQFOD\ODPSRIWKHW\SH/RHVFKFNH9,,,ZLWKKDQGOH/LJKWUHGFOD\ZLWK EURZQVOLS7KHGLVFXVVKRZV9LFWRULDRQJOREH,QVFULSWLRQRQWKH%RWWRP 5RPDQHQGRIVWEHJLQQLQJRIQGFHQWXU\$'+DQGOHZLWKPDQXIDFWXULQJ defect, intact.

228 7RQODPSHPLW*ODGLDWRU5¤PLVFK-KQ&KU/FP + PLW+HQNHO FP/RHVFKFNH7\S9,,,PLWKHU]I¤UPLJHU 6FKQDX]H XQG 5LQJKHQNHO +HOOHU 7RQ PLW URWEUDXQHP EHU ]XJ $XI GHP 6SLHJHO HLQ VWHKHQGHU *ODGLDWRU PLW 6FKLOG XQG 6FKZHUW 6FKXOWHU PLW (LHUVWDE YHU]LHUW $XI GHU 8QWHUVHLWH :HUNVWDWWPDUNHEHU]XJSDUWLHOODEJHULHEHQLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 5RPDQFOD\ODPSGHSLFWLQJDVWDQGLQJ*ODGLDWRU2QWKHEDVHDZRUNVKRSPDUN 5RPDQVWQGFHQWXU\$'6OLSSDUWLDOO\UXEEHGRIILQWDFW

151


 

231

e Spätantike Lampe mit Serapis und Isis. 1RUGDIULND-KQ &KU/FP+HOOURWHU7RQ7\S+D\HV,,)ODFKHU%RGHQ]DS IHQI¤UPLJHUGXUFKERKUWHU*ULIIUXQGHU&RUSXVXQGGUHLJHUXQ GHWH 6FKQDX]HQ PLW %UHQQORFK 'UHL (LQI©OOO¤FKHU LP 6SLHJHO $XI GHP 6SLHJHO 6HUDSLV PLW =HSWHU XQG ,VLV PLW 6LVWUXP VLW ]HQGYRUHLQHP'UHLIXgGDU©EHU*LUODQGHQ8PGLH6FKQDX]HQ 6WULFKGHNRU $XI GHP %RGHQ HLQ .UHLV 0LQLPDOH 6LQWHUUHVWH LQWDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK$XNWLRQ/RV /DWH5RPDQWHUUDFRWWDODPSZLWKWKUHHQR]]OHVGHSLFWLQJ6HUDSLVDQG,VLVRQ V\PSRVLXP6KRXOGHUVZLWKGHFRUDWLRQ1RUWK$IULFDWKWKFHQWXU\$' 7UDFHVRIVLQWHULQWDFW

 Fragment einer Tonlampe. 5¤PLVFK-KQ&KUkFP %HLJHU 7RQ PLW URWHP EHU]XJ 7HLO GHV 'LVNXV HLQHU /DPSH PLWHLQHP:DJHQOHQNHUPLW.UDQ]LQ4XDGULJDUHFKWVXOLQNV 6”XOHQLP+LQWHUJUXQGGLH:HQGHPDUNHGHV&LUFXV0D[LPXV PHWD 'DUJHVWHOOWLVWGHU6LHJHUGHV:DJHQUHQQHQV)UDJPHQ WDULVFK u 152

3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   H[ /RV  H[ Münchner Privatsammlung M.S., seit 1970er Jahren. 3DUWRIDFOD\ODPSRIEHLJHFOD\ZLWKUHGVOLSGHSLFWLQJWKHYLFWRULRXVTXDGULJD LQWKH&LUFXV0D[LPXVRQWKHVLGHVFROXPQVLQWKHEDFNJURXQGWKHPHWD 5RPDQQGUGFHQWXU\$')UDJPHQWDU\

231 Spätantike Lampe mit Hase. 1RUGDIULND    -K Q &KU / FP + PLW +HQNHO  FP +HOOURWHU 7RQ 7\S +D\HV ,, )ODFKHU%RGHQ]DSIHQI¤UPLJHU*ULIIHLI¤UPLJHU&RUSXVXQGJH UXQGHWH6FKQDX]HPLW%UHQQORFK=ZHL(LQI©OOO¤FKHULP6SLHJHO $XI GHP 6SLHJHO HLQ +DVH LP 6SUXQJ YRU HLQHP NUHX]DUWLJHQ 6\PERO$XIGHU6FKXOWHUNRQ]HQWULVFKH.UHLVHXQG]ZHL'HO} QH$XIGHU8QWHUVHLWHGUHLNRQ]HQWULVFKH.UHLVH3DUWLHOONOHLQH $EVSOLWWHUXQJHQGXQNOH7¤QXQJVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPPOXQJ 6. 3DULV (UZRUEHQ LP IUDQ]¤VLVFKHQ .XQVWKDQGHO /DWH5RPDQWHUUDFRWWDODPSGHSLFWLQJDUDEELWDQGDFURVV1RUWK$IULFD WKWKFHQWXU\$'3DUWLDOO\VPDOOEUXFHVGDUNVKDGLQJRWKHUZLVHLQWDFW


232

233

234

232 6SÂ&#x201D;WDQWLNH/DPSHPLW.DQWKDURVXQG%ODWW1RUGDIULND-K Q &KU / FP + PLW +HQNHO  FP +HOOURWHU 7RQ 7\S +D\HV,,)ODFKHU%RGHQ]DSIHQI¤UPLJHU*ULIIHLI¤UPLJHU&RU SXVXQGJHUXQGHWH6FKQDX]HPLW%UHQQORFK=ZHL(LQI©OOO¤FKHU LP6SLHJHO$XIGHP6SLHJHOHLQVWLOLVLHUWHU.DQWKDURVPLWHLQHP I©QI]DFNLJHQ%ODWW$XIGHU6FKXOWHUDEZHFKVHOQG~RUDOH0RWLYH XQGSXQNWJHI©OOWH(IHXEOÂ&#x201D;WWHU:LQ]LJH$EVSOLWWHUXQJHQLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV /DWH5RPDQWHUUDFRWWDODPSGHSLFWLQJDOHDIRQDFDQWKDURV1RUWK$IULFD WKWKFHQWXU\$'7LQ\EUXFHVLQWDFW

233 6SÂ&#x201D;WDQWLNH/DPSHPLW7DXEHDXI.DSLWHOO1RUGDIULND-KQ &KU/FP+ PLW+HQNHO FP+HOOURWHU7RQ7\S+D\HV ,, )ODFKHU %RGHQ ]DSIHQI¤UPLJHU *ULII HLI¤UPLJHU &RUSXV XQGJHUXQGHWH6FKQDX]HPLW%UHQQORFK=ZHL(LQI©OOO¤FKHULP 6SLHJHO$XIGHP6SLHJHOHLQ9RJHODXIHLQHP.DSLWHOOVLW]HQG $XIGHU6FKXOWHUDEZHFKVHOQGPLW3XQNWHQXQG/LQLHQJHI©OOWH 'UHLHFNHXQG7URSIHQ.OHLQHV)UDJPHQWDQGHU6FKQDX]HIHKOW ZLQ]LJH%HVWRgXQJHQXQGHLQH$EVSOLWWHUXQJVRQVWLQWDNW u

3URYHQLHQ]([*RUQ\ 0RVFK$XNWLRQ/RVH[6OJ++ 5KHLQODQGVHLWFD /DWH 5RPDQ WHUUDFRWWD ODPS GHSLFWLQJ D GRYH VLWWLQJ RQ D FDSLWHO 1RUWK $IULFDWKWKFHQWXU\$'6PDOOIUDJPHQWDWQR]]OHPLVVLQJWLQ\EUXFHV otherwise intact.

234 Spätantike Lampe mit Oktogon. 1RUGDIULND    -K Q &KU / FP + PLW +HQNHO  FP +HOOURWHU 7RQ 7\S +D\HV ,, )ODFKHU %RGHQ ]DSIHQI¤UPLJHU *ULII HLI¤UPLJHU &RUSXV XQG JHUXQGHWH 6FKQDX]H PLW %UHQQORFK DXI GHP %RGHQ ]ZHL 5LSSHQ(LQ(LQI©OOORFK]HQWUDOLP6SLHJHO$XIGHP6SLHJHO]ZHL VLFKVWHUQI¤UPLJ©EHUVFKQHLGHQGH4XDGUDWHPLW3XQNWUDKPXQJ $XIGHU6FKXOWHUDEZHFKVHOQG5RVHWWHQXQGHLI¤UPLJH0RWLYH ,QWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV /DWH5RPDQWHUUDFRWWDODPSZLWKDQRFWDJRQ1RUWK$IULFDWKWKFHQWXU\ $',QWDFW

153


235





235 Model für eine Tonlampe mit Stierkopf.  -K Q &KU RGHU LVODPLVFK    -K  [ FP 2EHUH +Â&#x201D;OIWH HLQHV *LSVPRGHOV I©U HLQH }J©UOLFKH /DPSH PLW 6WLHUNRSI .OHLQH $EVSOLWWHUXQJHQVRQVWLQWDNW u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 8SSHUSDUWRIWKHJ\SVXPPRGHORIDOD\ODPSZLWKEXOOKHDGWKFHQWXU\$'RU LVODPLFWKWKFHQXU\7LQ\VSOLQWHUVPLVVLQJRWKHUZLVHLQWDFW

 Model für spätantike Tonlampe mit Christogramm. 1RUGDIULND    -K Q &KU  [ FP *LSVPRGHO I©U HLQH /DPSH YRP7\S+D\HV,,$XIGHP6SLHJHO&KL5R$XIGHU6FKXOWHU RUQDPHQWLHUWH3IHLOH$XV]ZHL7HLOHQZLHGHU]XVDPPHQJHVHW]W XQGUHVWDXULHUW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ

154

3DUWRIDJ\SVXPPRGHORID/DWH5RPDQWHUUDFRWWDODPSZLWK&KL5KR1RUWK $IULFDWKWKFHQWXU\$'5HDVVHPEOHGDQGUHVWRUHG

 0RGHO I©U VSÂ&#x201D;WDQWLNH 7RQODPSH PLW P\WKRORJLVFKHU "  6]HQH 1RUGDIULND    -K Q &KU  [ FP *LSVPRGHO I©U HLQH/DPSHYRP7\S+D\HV,,$XIGHP6SLHJHOHLQ%DXPKDXV DXIGHPHLQ0DQQVLW]HQG)O¤WHVSLHOWKLQWHQKÂ&#x201D;QJWHLQVFKHLQ EDUJHIHVVHOWHU0DQQKHUDEDXIGHP+DXVVLW]WHLQ9RJHOGHQ 6WDPPZLQGHWVLFKHLQH6FKODQJHKLQDEGDYRUMDJWHLQ+XQG "  HLQHQ +DVHQ DXI GHU 6FKXOWHU 5DQNH .OHLQH $EVSOLWWHUXQJHQ VRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ /DPSHDXVPRWLYJOHLFKHU0DWUL]HEHL*RUQ\ 0RVFK$XNWLRQ /RV 3DUWRIDJ\SVXPPRGHORID/DWH5RPDQWHUUDFRWWDODPSZLWKDQXQFHUWDLQ P\WKRORJLFDO VFHQH 1RUWK $IULFD WK  WK FHQWXU\ $' 6PDOO VSOLQWHUV missing, otherwise intact.


238 Model für spätantike Tonlampe mit Löwe. 1RUGDIULND-KQ &KU[FP*LSVPRGHOI©U HLQH /DPSH YRP 7\S +D\HV ,, $XIGHP6SLHJHOOLHJHQGHU/¤ZH $XI GHU 6FKXOWHU DEZHFKVHOQG 9LHUSDVVRUQDPHQWH XQG +XIHL VHQ $XV ]ZHL 7HLOHQ ZLHGHU ]X VDPPHQJHVHW]WXQGUHVWDXULHUW u Provenienz: Ex Münchner Privatsamm lung M.S., 1970er Jahre. 3DUWRIDJ\SVXPPRGHORID/DWH5RPDQ WHUUDFRWWDODPSZLWKDO\LQJOLRQ1RUWK $IULFDWKWKFHQWXU\$'5HDVVHP EOHGDQGUHVWRUHG

238

 Zwei Modelle für spätantike Ton lampen. 1RUGDIULND-KQ &KU[FPX[FP 2EHUWHLOH GHU *LSVPRGHOOH I©U /DPSHQ YRP 7\S +D\HV ,, D  $XI GHP 6SLHJHO HLQ )LVFK DXI GHU 6FKXOWHU %ODWWNUDQ] 3DUWL HOO NOHLQH $EVSOLWWHUXQJHQ VRQVW LQWDNW E  $XI GHP 6SLHJHO HLQ +XQG DXI GHU 6FKXOWHU DEZHFK VHOQG NRQ]HQWULVFKH .UHLVH XQG PLW 3XQNWHQ JHI©OOWH (IHXEOÂ&#x201D;WWHU ,QWDNW2 Stück! u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ:5JHNDXIWDXV der niederrheinischen Privatsammlung 03 YRQ GHVVHQ 9DWHU LQ GHQ HU HU-DKUHQHUZRUEHQ 7ZR SDUWV RI J\SVXP PRGHOV RI D /DWH 5RPDQ WHUUDFRWWD ODPSV ZLWK }VK DQG GRJ1RUWK$IULFDWKWKFHQWXU\$' Small splinters missing, otherwise intact. 2 pieces!



155


6&+08&.



e *ROGNHWWH 6N\WKLVFK  -K Y &KU J / FD FP $XV WURSIHQI¤UPLJHQNDQWLJHQ3HUOHQPLW*UDQXODWVSLW]HNXU]HP 6WHJXQGEUHLWHUSUR}OLHUWHUVHREHQVRZLHNOHLQHQNXJHOLJHQ Perlen. *ROG0RGHUQDXIJHI”GHOW3HUOHQWHLOZHLVHHWZDVHLQJH GU©FNWLQWDNW u

156

3URYHQLHQ]([6DPPOXQJ.%HUZRUEHQEHL9.1HZ<RUN 'DYRU3ULYDWVDPPOXQJ *ROGQHFNODFHZLWKGURSVKDSHGEHDGVZLWKDWLSRIJUDQXOHVDQGH\HOHW RQWRSLQFRPELQDWLRQZLWKVPDOOJOREXODUEHDGV6F\WKLDQWKFHQWXU\%& 0RGHUQVWULQJLQJVHYHUDOEHDGVVOLJKWO\FUDVKHGRWKHUZLVHLQWDFW


241

241 .HWWH PLW *ROG 0LOOH}RUL XQG 0RVDLNSHUOHQ 1RUGDIULND U¤ PLVFK-KY-KQ&KU/FP]HQWUDOH3HUOHkFP $XV IDFHWWLHUWHQ ]\OLQGULVFKHQ XQG NXJHOLJHQ 3HUOHQ PLW ~RUD OHQ 0RWLYHQ ]ZHL RYRLGHQ 3HUOHQ PLW RSDNHQ URWJHOEHQ $X JHQXQGWUDQVOX]HQWHP0XVWHULQ]ZHL*U©QW¤QHQVRZLHHLQHU JURgHQ ELNRQLVFKHQ 3HUOH PLW )HGHUPXVWHU 'LH *ROGSHUOHQ ZDKUVFKHLQOLFK HWZDV M©QJHU 0LW .RSLHQ GHU HQWVSUHFKHQGHQ .DWDORJVHLWHQ YRQ 6RWKHE\hV 0RGHUQ DXIJHIÂ&#x201D;GHOW PLW QHXHP 9HUVFKOXVVWUDJEDULQWDNW u

'DV6W©FNZXUGHPHKUIDFKDXVJHVWHOOWFDELVLP0HWURSROLWDQ 0XVHXPRI$UW1HZ<RUNFDELVLP0XVHXPRI)LQH$UWV %RVWRQ0XVHXPRI0DQ6DQ'LHJR 1HFNODFH ZLWK PLOOH}RUL DQG PRVDLF JODVV EHDGV &RPSRVHG RI IDFHWHG F\OLQGULFDODQGKHPLVSKHULFDOEHDGVZLWK~RUDOPRWLIVWZRRYRLGEHDGVZLWK RSDTXH\HOORZDQGUHGH\HVLQDWUDQVOXFHQWJUHHQPDWUL[DQGDODUJHELFRQLFDO EHDGZLWKIHDWKHUSDWWHUQWKHJROGVSDFHUEHDGVSUREDEO\RIODWHURULJLQ1RUWK $IULFD5RPDQVWFHQWXU\%&QGFHQWXU\$'0RGHUQVWULQJLQJZLWK PRGHUQFORVXUHVXLWDEOHIRUZHDU With corresponding pages of the Sotheby´s catalogue (copies)!

3URYHQLHQ]$XVGHU6DPPOXQJ&60©QFKHQH[6RWKHE\hV1HZ<RUNUG -XQH/RVGDYRUFROOHFWLRQ'U*RGGDUGDQG-RVHSKLQH'X%RLV6DQ 'LHJRHUZRUEHQFDELVLQÂ&#x160;J\SWHQ

157


242

243 .HWWHDXV/DSLVOD]XOLXQG*ROGSHUOHQ:HVWDVLDWLVFKFD-WY &KU/FDFP$XVXQWHUVFKLHGOLFKJURgHQELNRQLVFKHQ/D SLVOD]XOL3HUOHQXQGVHKUNOHLQHQUXQGHQ*ROGSHUOHQ]HQWUDOHLQ JROGHQHU $QKÂ&#x201D;QJHU LQ )RUP HLQHV *UDQDWDSIHOV Tragbar! 0R GHUQDXIJHIÂ&#x201D;GHOWLQWDNW u

242 .HWWHDXV.DUQHROX*ROGSHUOHQPLW$QKÂ&#x201D;QJHU1DKHU2VWHQ -KQ&KU/FDFPSOXV$QKÂ&#x201D;QJHUFP$XVYRUZLHJHQG ELNRQLVFKHQ 3HUOHQ DXV URWHP .DUQHRO GD]ZLVFKHQ ]ZHL YHUVFKLHGHQH$UWHQYRQ*ROGSHUOHQ DXVXQWHUVFKLHGOLFKYLHOHQ 5HLKHQYRQ.©JHOFKHQRGHUVFKHLEHQI¤UPLJPLW.©JHOFKHQDP 5DQG ]HQWUDOHLQGUHLHFNLJHU$QKÂ&#x201D;QJHUPLWGUHL.©JHOFKHQDP XQWHQJHZHOOWHQ5DQGLQQHQXQWHUWHLOWGXUFKKRUL]RQWDOH6WHJH HLQNOHLQHUHV'UHLHFNVRZLHUXQGH(OHPHQWHPLW*UDQXODWUDQG DXIGHU5©FNVHLWHJODWW0RGHUQDXIJHIÂ&#x201D;GHOWHLQH*ROGSHUOHGHV $QKÂ&#x201D;QJHUVIHKOW$QKÂ&#x201D;QJHUHWZDVYHUIRUPW u

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 1HFNODFHFRPSRVHGRIELFRQLFDOODSLVOD]XOLEHDGVDQGVSKHULFDOJROGEHDGVLQ WKHFHQWHUDJROGSHQGDQWLQVKDSHRIDSRPHJUDQDWH:HVWHUQ$VLDWLFDERXW QGPLOOHQLXP%&0RGHUQVWULQJLQJLQWDFWWearable!

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 1HFNODFHFRPSRVHGRIPRVWO\ELFRQLFDOUHGFRUQHOLDQEHDGVDQGWZRGLIIHUHQW VKDSHVRIJROGEHDGVLQWKHFHQWHUDWULDQJXODUJROGSHQGDQWZLWKJUDQXOHV GHFRUDWLRQ1HDU(DVWHUQQGUGFHQWXU\$'0RGHUQVWULQJLQJSHQGDQW ZLWKPLVVLQJEHDGDQGWLQ\GDPDJHV

243

158


244

245

244 .HWWH DXV $PHWK\VWSHUOHQ +HOOHQLVWLVFK    -K Y &KU / FDFP$XVXQWHUVFKLHGOLFKJURgHQELNRQLVFKHQ3HUOHQDXV $PHWK\VWTragbar!0RGHUQDXIJHIÂ&#x201D;GHOWLQWDNW u

1HFNODFHFRPSRVHGRIELFRQLFDODPHWK\VWEHDGVJUDGXDWHGLQVL]H+HOOHQLVWLF UGQGFHQWXU\%&0RGHUQVWULQJLQJLQWDFW

 .HWWHQPLW$XJHQSHUOHQ.HOWLVFKIU©KH/D7Â&#x2122;QH=HLW(QGH -KY&KU/FDFP$XVXQWHUVFKLHGOLFKJURgHQJHOEEODXHQ 6FKLFKWDXJHQSHUOHQ ]ZHL JU©QEODXHQ $XJHQSHUOHQ XQG ]ZHL 6LOEHUGUDKWHOHPHQWHQ0RGHUQDXIJHIÂ&#x201D;GHOW6LOEHUGUDKWHOHPHQWH PRGHUQ u

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 1HFNODFHFRPSRVHGRIELFRQLFDODPHWK\VWEHDGVJUDGXDWHGLQVL]H+HOOHQLVWLF UGQGFHQWXU\%&0RGHUQVWULQJLQJLQWDFWWearable!

245 .HWWH DXV $PHWK\VWSHUOHQ +HOOHQLVWLVFK    -K Y &KU / FDFP$XVXQWHUVFKLHGOLFKJURgHQELNRQLVFKHQ3HUOHQDXV $PHWK\VW0RGHUQDXIJHIÂ&#x201D;GHOWLQWDNW u

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06HU-DKUH 1HFNODFHRIEHDGVRIZRXQGJODVVZLWKVWUDWL}HGH\HVPRVWO\LQ\HOORZDQG EOXHWZREHDGVLQJUHHQDQGEOXHDQGWZRPRGHUQVLOYHUZLUHHOHPHQWV&HOWLF HDUO\/D7Â&#x2122;QHSHULRGHQGRIWKWKFHQWXU\%&0RGHUQVWULQJLQJVLOYHU wire elements modern.

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV



159




 .HWWH DXV .DUQHRO3HUOHQ 9RUGHUDVLDWLVFK  +”OIWH  -W Y &KU / FP %LNRQLVFKH XQG WURSIHQI¤UPLJH 3HUOHQ 0RGHUQ DXIJHI”GHOWZLQ]LJH$EVSOLWWHUXQJHQ u

:HFKVHOPLWI©QIJHZ¤OEWHQJHIDVVWHQEODXHQ*ODVHLQODJHQ$XI GHQ EHLGHQ XQWHUHQ 5HLKHQ JHSU”JWH 9ROXWHQHOHPHQWH ,QQHQ PLW*ROEOHFKYHUVW”UNW6FKDUQLHUNRQVWUXNWLRQ*ROG,QWDNW u

3URYHQLHQ]([*RUQ\ 0RVFK$XNWLRQ/RVVHLWGHQHU -DKUHQLQGHU6DPPOXQJ.$%U©VVHO

3URYHQLHQ]([6DPPOXQJ.%HUZRUEHQEHL9.1HZ<RUN 'DYRU3ULYDWVDPPOXQJ

1HFNODFHZLWKEHDGVPDGHRIUHGFRUQHOLDQ:HVWHUQ$VLDWLFQGKDOIUG millenium B.C. Modern stringing, tiny splinters are missing.

*ROGEUDFHOHWZLWKKLQJHORFNRIWKUHHURZVEOXHPRXQWHGJODVVLQOD\VDQG VW\OL]HGDQLPDOVLQWKH}UVWURZWKHRWKHUWZRZLWKSXQFKHGYROXWHV6DUPDWLDQ QGFHQWXU\%&QGFHQWXU\$',QWDFW

248 Silberner Torques. 'RQDXNHOWHQ    -K Y &KU k FP $XVWRUGLHUWHP6LOEHUGUDKWPLWNRQLVFKHQVSLW]HQ(QGHQMit GHU5HFKQXQJ*DOHULH6FKPLGW0©QFKHQ'XQNOH3DWLQDLQWDNW u 3URYHQLHQ](UZRUEHQEHLGHU*DOHULH:6FKPLGW0©QFKHQDP H[6DPPOXQJ0*0©QFKHQ $VLOYHUWRUTXHVZLWKDUURZHGHQGLQJV'DQXEHFHOWVQGVWFHQWXU\%& 'DUNSDWLQDLQWDFW

e *ROGDUPUHLI PLW *ODVHLQODJHQ 6DUPDWLVFK  -K Y   -K Q &KU J + FP k FP $XV GUHL 5HLKHQ *ROGEOHFK GLHGXUFKMHZHLOV]ZHL5HLIHJHWUHQQWXQGEHJUHQ]WVLQG,QGHU REHUHQ5HLKHI©QIDSSOL]LHUWHVWLOLVLHUWH7LHUHDXV*ROGEOHFKLP

 Silbernadel mit Fortuna. 5¤PLVFK-KQ&KU/1DGHOFP +)RUWXQDFP1DGHOXQG$XIVDW]VLQGJHWUHQQWYRQHLQDQGHU JHDUEHLWHWXVS”WHU]XVDPPHQJHVHW]W.RQLVFK]XODXIHQGH1DGHO GDUDXIGLH6WDWXHWWHHLQHU)RUWXQDFDSLWHYHODWRPLW0DXHUNURQH XQG)©OOKRUQGLHDXIHLQHUNHJHOI¤UPLJHQ%DVLVVWHKW'LHVHLVW PLW GLDJRQDOHQ 5LHIHQ XQG DP REHUHQ (QGH PLW HLQHU 5HLKH .©JHOFKHQ GHNRULHUW ,P %HUHLFK GHU )©gH GHU )RUWXQD HLQH NOHLQHVH0LW6DPPOHU]HWWHOXQG,QYHQWDUQXPPHUWHLOVJU©QH 3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 6LOYHU KDLUSLQ HQGLQJ LQ D VWDWXHWWH RI WXUUHWHG )RUWXQD FDSLWH YHODWR ZLWK FRUQXFRSLDQHHGOHDQGVWDWXHWWHZRUNHGVHSDUDWHO\5RPDQQGUGFHQWXU\ $':LWKFROOHFWRUyVQRWHDQGLQYHQWRU\QXPEHULQWDFWSDUWLDOO\JUHHQSDWLQD

251 Silbernadel mit Löwe. 5¤PLVFK    -K Q &KU / 1DGHO FP + /¤ZH FP .RQLVFK ]XODXIHQGH 1DGHO GLH QDFK HLQHU 3UR}OLHUXQJ ]X HLQHP QDFK REHQ DXVVFKZLQJHQGHQ 9LHUNDQWVWDEPLWDQVFKOLHgHQGHP3RGHVWDXVO”XIWDXIGHPHLQ /¤ZH PLW DXIJHULVVHQHP 0DXO VWHKW 0LW 6DPPOHU]HWWHO XQG ,QYHQWDUQXPPHULQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 6LOYHUKDLUSLQHQGLQJLQDOLRQZLWKZLGHRSHQPRXWK5RPDQQGUG FHQWXU\$':LWKFROOHFWRUyVQRWHDQGLQYHQWRU\QXPEHULQWDFW

252 Haarnadel mit Frauenbüste aus Bein. 5¤PLVFK-KQ&KU / FP .RQLVFK ]XODXIHQGH 1DGHO DP EHUJDQJ ]XU %©VWH 3UR}OLHUXQJHQ DOV %HNU¤QXQJ HLQH GUDSLHUWH )UDXHQE©VWH PLW 'XWW6SLW]HJHEURFKHQ u 248

3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   H[ /RV  H[ Süddeutsche Privatsammlung M.S., seit 1970er Jahren. %RQHKDLUSLQZLWKWKHEXVWRIDGUDSHGZRPDQ5RPDQQGUGFHQWXU\ $'7LSEURNHQ

160


249

250

251

252

161


253

253 .OHLQHU3DUI©P~DNRQDXV/DJHQDFKDW*ROGXQG*UDQDWHelleni stisch, 2. Jh. v. Chr. 23,62g, H 3,5cm. Bauchiges Miniaturgefäß PLWHLQHP&RUSXVDXV/DJHQDFKDW8QWHQHLQ~DFKHU6WDQGULQJ DXV*ROGEOHFKGHUKRKHVFKPDOH+DOVXQGGLH6FKXOWHUHEHQ IDOOV DXV *ROGEOHFK $XI GHU 6FKXOWHU %ODWW]XQJHQGHNRU DXV *ROGGUDKW GHU +DOV JHULHIHOW $XI GHP &RUSXV ]ZHL PRQGVL FKHOI¤UPLJH JHZ¤OEWH 6WHLQH XQG HLQ UXQGHU JHZ¤OEWHU 6WHLQ DXV*UDQDWLQ*ROGIDVVXQJHQPLW=DFNHQUDQGVRZLHHLQ6WHUQ PLW*UDQXODWN©JHOFKHQXQGRPSKDORVDUWLJHP=HQWUXP$XIGHU 6FKXOWHU]ZHLVHQLQGLHHLQH)XFKVVFKZDQ]NHWWHHLQJHK”QJW LVW$QGLHVHUK”QJWMHZHLOVPLWHLQHUNXU]HQ)XFKVVFKZDQ]NHWWH HLQHJROGHQH1DGHO /FP PLWHLQHP.RSIDXVHLQHPRYD

162

OHQ %DQGDFKDW GHU XPODXIHQG JHIDVVW LVW VRZLH HLQ KDOENXJH OLJJHIRUPWHU6W¤SVHO]XP9HUVFKOLHgHQGHV*HI”gHVDQGHVVHQ REHUHQ(QGHHLQ*D]HOOHQNRSIDXV*UDQDWDQJHEUDFKWLVW*ROG ,QWDNW u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 6PDOOSHUIXPH~DFRQPDGHRIOD\HUHGDJDWHZLWKWZROXQXODUVKDSHGDQGRQH URXQGPRXQWHGJDUQHWDQGDVWDURIJUDQXOHVRQWKHFRUSXVZLWKDJROGSLQ ZLWKDKHDGRIDQRYDOEDQGHGDJDWHZLWKJROGPRXQWLQJMRLQWWRWKH~DFRQ ZLWKDIR[WDLOFKDLQDQGDJDUQHWSOXJZLWKDJD]HOOHKHDG+HOOHQLVWLFQG FHQWXU\%&,QWDFW


254 • *ROGHQHU /¤ZHQNRSIDQK”QJHU Griechisch, 5. Jh. v. Chr. 8,47g, H FP%FDFP/¤ZHPLWZHLW DXIJHULVVHQHP 0DXO PLW VSLW]HQ (FN]”KQHQ VH DP 2EHUNRSI DXV HLQHU 'UDKWVSLUDOH $P +DOV JODWWH )O”FKH DOV $EVFKOXVV PLW HLQHPWRUGLHUWHQ'UDKWXPJHEHQ *ROG,QWDNW u Provenienz: Ex Shlomo Moussaieff &ROOHFWLRQ    ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ$QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ/RV *ROGSHQGDQWLQVKDSHRIDOLRQKHDGZLWK ZLGHRSHQPRXWKVXVSHQVLRQOXJRQWRS *UHHNWKFHQWXU\%&,QWDFW 254

255 *ROGURVHWWH Griechisch, 2. Hälf te 4. Jh. v. Chr. 4,09g, Ø 2,3cm. 7HLO YRQ HLQHP 2KUULQJ DXI GHU 5©FNVHLWH VH I©U HLQHQ $QK”Q JHU )ODFKH UXQGH =LHUVFKHLEH PLW NXU]HP VHQNUHFKWHQ 5DQG LQQHQ HLQH 5RVHWWH DXV GUHL 5LQ JHQYRQ%O©WHQEO”WWHUQXPJHEHQ YRQ HLQHU $UW 6WHPSHOJHI”gH DP 5DQG DXI GHP %RGHQ GHU 6FKD OH]ZLVFKHQGHU5RVHWWHXQGGHQ 6WHPSHOJHI”gHQ 6SLUDOGHNRUDWL on aus Draht. *ROG=ZHLZLQ]LJH /¤FKHUHLQ7HLOGHU6SLUDOGHNRUD WLRQIHKOW%©JHODEJHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ*-$0/ 1LHGHUODQGHVHLW 9JO]%%'HSSHUW/LSSLW]*ULHFKLVFKHU *ROGVFKPXFN  6$EE *ROGURVHWWHRULJLQDOO\SDUWRIDQHDUULQJ DWWKHEDFNVLGHORRSIRUWKHVXVSHQVLRQRI DSHQGDQW*UHHNQGKDOIRIWKFHQWXU\ %&7ZRWLQ\KROHVERZRIWKHHDUULQJ EURNHQSDUWRIWKHVSLUDOGHFRUDWLRQORVW

255

163


256

257

258

256 *HPPHPLW$WKHQDLQ*ROGDQK”QJHURömisch, 1. Jh. n. Chr. H FP*HPPHDXVURWHP-DVSLVDXIGHPKRFKRYDOHQ,QWDJOLR HLQH%©VWHGHU$WKHQDPLW+HOPXQG*RUJRQHLRQYRQHLQHP *ROGEDQGPLWVHJHIDVVW*ROG,QWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0©QFKHQ]ZLVFKHQXQG 'LH YRUOLHJHQGH *HPPH OHKQW VLFK DQ HLQ EHU©KPWHV 9RUELOG DQ GDV GHU *HPPHQVFKQHLGHU$VSDVLRVLP9LHUWHOGHV-KVY&KUVFKXI(V]HLJW GLH%©VWHGHU$WKHQD3DUWKHQRVGHV3KLGLDVDXVURWHP-DVSLVGLHVLFKKHXWH LP1DWLRQDOPXVHXPLQ5RPEH}QGHWXQGYRQ$VSDVLRVVLJQLHUWZDUV( =ZLHUOHLQ'LHKO$QWLNH*HPPHQXQGLKU1DFKOHEHQ  6I$EE 'HU*HPPHQVFKQHLGHUXQVHUHU*HPPHKDWGDV2ULJLQDOIUHLOLFKQLFKW JHQDXNRSLHUWVRQGHUQEHVWLPPWH'HWDLOVZLH]%GLH/DQ]HZHJJHODVVHQ XQGGLH%©VWHVHLWHQYHUNHKUWGDUJHVWHOOW 5HG MDVSHU JHPVWRQH ZLWK D JROG PRXQWLQJ GHSLFWLQJ WKH EXVW RI $WKHQD 3DUWKHQRV5RPDQVWFHQWXU\$',QWDFW

257 *ROGDQK”QJHUPLW*HPPH5¤PLVFK-KQ&KUJ/ FP /”QJVRYDOH *HPPH DXV /DJHQDFKDW DXI GHP ,QWDJOLR GLH%©VWHYRQ'LDQDPLW%RJHQXQGJHVFKXOWHUWHP.¤FKHU'LH *HPPH LQ HLQHU *ROGEOHFKIDVVXQJ GLH DXI GHU 5©FNVHLWH HLQ 5DXWHQPXVWHUDXIZHLVW=ZLVFKHQ)DVVXQJXQGVHI©QI5HLKHQ YRQ *UDQXODWN©JHOFKHQ XQG JU¤gHUHQ .©JHOFKHQ DXI GHU

164

EUHLWHQ VH PHKUHUH 5HLKHQ YRQ WRUGLHUWHQ 'U”KWHQ GLH VH VHOEVWJHI©OOWPLWHLQHUO”QJOLFKHQGXUFKERKUWHQ6WHLQSHUOH$P XQWHUHQ (QGH HLQ VLFKHOI¤UPLJHV (OHPHQW GDV PLW WRUGLHUWHQ 'U”KWHQ XQG NXU]HQ 5¤KUHQ JHI©OOW XQG YRQ .©JHOFKHQ XQG *UDQXODWJHUDKPWZLUG*ROG5HVWHYRQ6LQWHUHLQLJH.©JHOFKHQ GHVVLFKHOI¤UPLJHQ(OHPHQWHVIHKOHQ u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV *ROGSHQGDQWZLWKPRXQWHGWZROD\HUHGJHPVWRQHGHSLFWLQJWKHEXVWRI'LDQD ZLWKERZFDVHDQGERZ7KHPRXQWLQJGHFRUDWHGZLWKJUDQXODWLRQ5RPDQ QGUGFHQWXU\$'7UDFHVRIVLQWHUVHYHUDOJOREXOHVRIWKHOXQXODVKDSHG HOHPHQWPLVVLQJ

258 *ROGDQK”QJHUPLW&DPHRRömisch, 3. Jh. n. Chr. 4,09g, H 3cm. (OOLSVHQI¤UPLJHU$QK”QJHUPLWVHREHQXQG.HUEUDQGGDULQ HLQ &DPHR PLW GHU GUDSLHUWHQ %©VWH HLQHU )UDX PLW 'XWW DXV Lagenachat. *ROG&DPHRPLW6SU©QJHQ u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ *ROGSHQGDQWZLWKDFDPHRRIOD\HUHGDJDWHGHSLFWLQJDIHPDOHGUDSHGEXVW ZLWKDEXQ5RPDQUGFHQWXU\$'&DPHRZLWKFUDFNV


260 259

261

259 • *ROGDQK”QJHU PLW .DUQHRO*HPPH 5¤PLVFK    -K Q &KU J + FP ,Q *ROG JHIDVVWH O”QJVRYDOH *HPPH DXV RUDQJHP .DUQHRO DXI GHP ,QWDJOLR HLQ $GOHU PLW HLQHP .UDQ]LP6FKQDEHO2EHQHLQHVH*ROGVHZLHGHUDQJHVHW]W *HPPHPLW.UDW]HUQXQG6SUXQJ u 3URYHQLHQ]([6DPPOXQJ.%HUZRUEHQEHL9.1HZ<RUN 'DYRU3ULYDWVDPPOXQJ 5HGFRUQHOLDQJHPVWRQHGHSLFWLQJDQHDJOHZLWKZUHDWKLQJROGPRXQWLQJ ZLWKH\HOHW5RPDQVWQGFHQWXU\$'(\HOHWUHDWWDFKHGJHPVWRQHZLWK FUDFNDQGVFUDWFKHV

260 • (OHPHQWHLQHV*ROGSHNWRUDOVPLW(PDLO5KRGLVFKY &KUJ[FP5HFKWHFNLJH3ODWWHPLWEUHLWHU%DQG¤VH DPREHUHQ(QGHXQG]ZHL$QK”QJHUQLQ)RUPYRQVWLOLVLHUWHQ *UDQDW”SIHOQ DP XQWHUHQ (QGH ,Q HLQHP HUK¤KWHQ HWZDV NOHLQHUHQ5HFKWHFNGDUJHVWHOOWHLQHJH~©JHOWH$UWHPLVDOV+HUULQ GHU 7LHUH ~DQNLHUW YRQ ]ZHL DQ LKUHU 6HLWH KRFK VSULQJHQGHQ 3DQWKHUQ'HU5DQG]ZLVFKHQGHQ5HFKWHFNHQXQGMHZHLOVGUHL .UHLVH DXI GHP $QK”QJHU PLW JU©QHP (PDLO DXVJHI©OOW 'LH 5©FNVHLWH RKQH 'HNRU 'DV 5HOLHI DXV *ROGEOHFK JHWULHEHQ *ROG5HVWHYRQ6LQWHU u

3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU$XVIXKUJHQHKPLJXQJGHULVUDHOLVFKHQ$QWLNHQEHK¤UGH 9JO5$+LJJLQV*UHHNDQG5RPDQ-HZHOOHU\  6II7DI' (%'HSSHUW/LSSLW]*ULHFKLVFKHU*ROGVFKPXFN  6$EE =ZHLGLHVHU*ROGSHNWRUDO(OHPHQWHEHL*RUQ\ 0RVFK$XNWLRQ /RV =XVFKODJ(XUR  5HFWDQJXODUJROGSODTXHZLWKDQHQDPHOERWWRPGHFRUDWHGZLWKDZLQJHG $UWHPLV~DQNHGE\WZRSDQWKHUVRQWKHXSSHUHGJHDVXVSHQVLRQORRSRQWKH ORZHUHGJHWZRSHQGDQWVLQVKDSHRIVW\OL]HGSRPHJUDQDWHVHDFKZLWKWKUHH URXQGGLVFVRIJUHHQHQDPHO2ULJLQDOO\SDUWRIDSHFWRUDO5KRGLDQ %&7UDFHVRIVLQWHULQWDFW

261 +HU]$PXOHWW$QK”QJHU 3K¤QL]LVFK    -K Y &KU / FD FP +HU]I¤UPLJHU 6WHLQ DXV $FKDW PLW ]\OLQGULVFKHU 9HUWLNDOERKUXQJ LP ,QQHUHQ XQG ]ZHL JROGHQHQ VHQ DXV 'UDKWVFKOLQJHQGLHVHLWOLFKLQNOHLQHQ.©JHOFKHQHQGHQ:LQ]LJH )UDJPHQWHIHKOHQ u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV +HDUWVKDSHGDJDWHDPXOHWSHQGDQWZLWKJROGVXVSHQVLRQORRSVDQGYHUWLFDO GULOOLQJ LQ WKH FHQWHU 3KRHQLFLDQ WK  UG FHQWXU\ %& 7LQ\ IUDJPHQWV PLVVLQJ

165


262

262 6DPPOXQJVLOEHUQH$QK”QJHU5¤PLVFK-KQ&KU'DU XQWHUHLQ$QK”QJHU /FP2EHU~”FKHYHUULHEHQ PLW+DUSR NUDWHVPLW'RSSHONURQHDQGHQ0XQGJHOHJWHP=HLJH}QJHUXQG HLQHP NXJHOLJHP *HI”g DXI HLQHQ 3IHLOHU JHVW©W]W HLQ $QK”Q JHUPLW,VLVXQG+DUSRNUDWHV /FP2EHU~”FKHYHUULHEHQ  XQG]ZHLVHQDXIGHU5©FNVHLWHXQGHLQ$QK”QJHU +FP  PLWVWHKHQGHU.RUHDXVJHWULHEHQHP6LOEHUEOHFKPLWDP5DQG XPODXIHQGHP JHSXQ]WHP 3XQNWGHNRU XQG VH REHQ 6W©FN ,QWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0©QFKHQ]ZLVFKHQXQG &ROOHFWLRQRIVLOYHUSHQGDQWVGHSLFWLQJD 6WDQGLQJFDVW+DUSRNUDWHVZLWK GRXEOHFURZQDQGDEHOOLHGYHVVHOE VWDQGLQJFDVW,VLVDQG+DUSRNUDWHVDQG F VWDQGLQJ.RUHPDGHRIVLOYHUVKHHW5RPDQVWUGFHQWXU\$',QWDFW 3 pieces!

263

166

263 %URQ]HVLHJHOPLW$FKDW*HPPH3DUWKLVFK-KQ&KU+ FP%URQ]HNHJHOPLWVHREHQGDULQHLQJHODVVHQHLQH*HPPH DXV$FKDW$XIGHPO”QJVRYDOHQ,QWDJOLRHLQHE”UWLJHP”QQOLFKH %©VWHPLW%LQGH5HVWHYRQ6LQWHU)UDJPHQWHGHV%URQ]HNHJHOV IHKOHQ*HPPHJHEURFKHQ u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ7/6DFKVHQHUZRUEHQFDDXV DOWHU%HUOLQHU6DPPOXQJ 6HDOZLWKEURQ]HKROGHUDQGDJDWHJHPVWRQHGHSLFWLQJDEHDUGHGPDOHEXVW ZLWKWDHQLD3DUWKLDQQGUGFHQWXU\$'7UDFHVRIVLQWHUIUDJPHQWVRI WKHEURQ]HKROGHUPLVVLQJJHPVWRQHZLWKFUDFN

264 %URQ]HQHV*HZLFKW5¤PLVFK-KQ&KU+FPJ %URQ]HJXVV ,Q )RUP HLQHU .QDEHQE©VWH PLW VH DXI GHP 2EHUNRSIVFULSXOD’J*U©QH3DWLQDLQWDNW u

264


266

265

3URYHQLHQ]([:6%D\HUQ6HLWGHQIU©KHQHU-DKUHQLQGHXWVFKHP 3ULYDWEHVLW] %URQ]HZHLJKWLQVKDSHRIWKHEXVWRIDER\ VFULSXOD FDJ 5RPDQ VWUGFHQWXU\$'*UHHQSDWLQDLQWDFW

265 *ODVDQK”QJHULQ.RSIIRUP3K¤QL]LVFK-KY&KU+FP $XV VFKZDU]HP XQG ZHLgHP RSDNHQ *ODV 8UVSU©QJOLFK VH DXIGHP.RSI5HVWHYRQ6LQWHUVHDEJHVSOLWWHUW u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ7/6DFKVHQHUZRUEHQFDDXV DOWHU%HUOLQHU6DPPOXQJ

267 $PXOHWW PLW 6WHLQERFNN¤SIHQ $FK”PHQLGLVFK FD  Y &KU kFP+FP6FKHLEHQI¤UPLJPLW]HQWUDOHU%RKUXQJXQG EHLGVHLWLJHU 'DUVWHOOXQJ $XI GHP 5DQG ]ZHL HLQDQGHU ]XJH ZDQGWHQDWXUDOLVWLVFKJHVWDOWHWH6WHLQERFNN¤SIHGHUHQ+¤UQHU GHQ SODVWLVFKHQ 5DQG YRQ 9RUGHU XQG 5©FNVHLWH ELOGHQ ,P =ZLVFKHQUDXP :LQNHO 0LW 6DPPOHU]HWWHO XQG ,QYHQWDUQXP PHUZLQ]LJHV5DQGIUDJPHQWIHKOW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV %ODFN VWHDWLWH DPXOHW GLVFVKDSHG ZLWK FHQWUDO GULOOLQJ KROH GHSLFWLQJ WKH KHDGVRIWZRLEH[HVRQWKHHGJH$FKDHPHQLGDERXW%&:LWKFROOHFWRUyV QRWHDQGLQYHQWRU\QXPEHUWLQ\IUDJPHQWRIWKHHGJHPLVVLQJ

+HDGSHQGDQWRIVDQGFRUHJODVVLQEODFNDQGZKLWH3KRHQLFLDQWKUG FHQWXU\%&7UDFHVRIVLQWHUH\HOHWEURNHQ

266 )UDJPHQW HLQHV *ODVDUPUHLIV PLW 0HQRUD )U©KE\]DQWLQLVFK (QGH$QIDQJ-KQ&KU/FP%FP$XVEO”XOLFK JU©QHP *ODV PLW ]ZHLHLQKDOE DXIJHVWHPSHOWHQ VLHEHQDUPLJHQ /HXFKWHUQ 0HQRUD 5HVWHYRQ,ULV u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 'LH 0HQRUD LVW GDV ZLFKWLJVWH UHOLJL¤VH 6\PERO GHV -XGHQWXPV XQG KHXWH QHEHQGHP'DYLGVWHUQGDVZLFKWLJVWHQDWLRQDOH6\PEROGHV6WDDWHV,VUDHO ,QGHUU¤PLVFKHQ=HLWZXUGHGLH0HQRUD]XPHUVWHQ0DOELOGOLFKDXIGHP 7LWXVERJHQLQ5RPGDUJHVWHOOW$XIGHP7ULXPSK]XJGHV7LWXVQDFKGHU(U REHUXQJ-HUXVDOHPVQ&KUZXUGHVLHDOVNRVWEDUHV%HXWHVW©FNSU”VHQWLHUW )ODYLXV-RVHSKXVEHULFKWHWGDVVGLH0HQRUDDQVFKOLHgHQGLQGHQYRQ9HV SDVLDQJHVWLIWHWHQ)ULHGHQVWHPSHOJHEUDFKWZXUGH %HOOXP,XGDFLXP  )UDJPHQWRIDEOXLVKJUHHQJODVVEUDFHOHWZLWKWZRDQGDKDOIPHQRUDV(DUO\ %\]DQWLQHHQGRIWKEHJLQQLQJRIWKHWKFHQWXU\$':LWKLULGHVFHQFH

267

167


268 â&#x20AC;¢ 6LOEHUQHU *©UWHOEHVFKODJ PLW $GOHUNRSI XQG *ODVHLQODJHQ 2VWJRWLVFK  +Â&#x201D;OIWH  -K Q &KU / FP 5©FNVHLWH GXUFK %URQ]H EOHFKVWUHLIHQYHUVWÂ&#x201D;UNW2YDOHUDEJHVFKUÂ&#x201D;JWHU %©JHO PLW YLHU UXQGHQ )DVVXQJHQ PLW URWHQ *ODVHLQODJHQXQGNROEHQI¤UPLJHP'RUQPLW JHNU©PPWHU 6SLW]H XQG ]ZHL UXQGHQ )DV VXQJHQ PLW URWHQ *ODVHLQODJHQ 5HFKWHFNL JHU %HVFKODJ PLW HLQHP $GOHUNRSI DQ HLQHU 6HLWHUXQGHQ)DVVXQJHQPLWURWHQ*ODVHLQOD JHQDQGHQ(FNHQXQGDOV$XJHGHV$GOHUV ]HQWUDO HLQH RYDOH )DVVXQJ PLW JHOEHU *ODV HLQODJH $XI GHP %©JHO XQG GHP %HVFKODJ .HUEVFKQLWWGHNRULQ)RUPYRQ%Â&#x201D;QGHUQPLW 6SLUDOHQ,QWDNW u 268

3URYHQLHQ] ([ 6DPPOXQJ .%    HUZRUEHQEHL9.1HZ<RUN'DYRU3ULYDWVDPPOXQJ 6LOYHUEXFNOHDQGSODWHRIÂ&#x20AC;HDJOHyW\SH:LWKUHFWDQJXODU SODWHZLWKHDJOHKHDGZLWKJODVVLQOD\VLQUHGDQGRQHLQ \HOORZDQGFKLSFDUYHGGHFRUDWLRQEDFNVLGHUHLQIRUFHG ZLWKEURQ]HVKHHWVWULSV2VWURJRWKLFVWKDOIRIWK FHQWXU\$',QWDFW

269

269 â&#x20AC;¢ 6LOEHUQHU *©UWHOEHVFKODJ PLW )URVFK XQG *ODVHLQODJHQ 2VWJRWLVFK  -K Q &KU / FP 2YDOHU %©JHO PLW NROEHQI¤UPLJHP 'RUQ PLW JHNU©PPWHU 6SLW]H VRZLH YLHU UXQGHQ JHIDVVWHQ JU©QHQ *ODVHLQODJHQ %HVFKODJLQ)RUPHLQHVVWLOLVLHUWHQ)URVFKHVPLW VHFKVUXQGHQJU©QHQ*ODVHLQODJHQXQGHLQHU YLHUEOÂ&#x201D;WWULJHQ5RVHWWHDXIGHP)URVFKU©FNHQ PLW JU©QHQ *ODVHLQODJHQ ,P 0DXO GHV )URVFKHV HLQH UHFKWHFNLJH %HIHVWLJXQJ I©U GHQ5LHPHQ.HUEVFKQLWWGHNRULQ)RUPYRQ 6SLUDOHQ DXI GHP %©JHO XQG LQ )RUP YRQ /LQLHQ DXI GHP )URVFK 'UHL *ODVHLQODJHQ GHU 5RVHWWH IHKOHQ 5©FNVHLWHQEOHFK QLFKW YROOVWÂ&#x201D;QGLJ5LHPHQEHIHVWLJXQJJHEURFKHQ u 3URYHQLHQ] ([ 6DPPOXQJ .%    HUZRUEHQEHL9.1HZ<RUN'DYRU3ULYDWVDPPOXQJ 6LOYHUEXFNOHZLWKSODWHLQVKDSHRIDVW\OL]HGIURJRQ WKHEXFNOHDQGWKHSODWHURXQGPRXQWLQJVDQGDURVHWWH ZLWK JUHHQ JODVV LQOD\V RQ WKH EXFNOH DQG WKH SODWH FKLSFDUYHGGHFRU2VWURJRWKLFWKFHQWXU\$'7KUHH JODVVLQOD\VRIWKHURVHWWHPLVVLQJVKHHWRIWKHEDFNVLGH QRWFRPSOHWHVWUDSIDVWHQLQJEURNHQ

270 â&#x20AC;¢ 6LOEHUQHU *©UWHOEHVFKODJ PLW /¤ZH 2VWJR WLVFK-KQ&KU/FP2YDOHU%©JHO PLW NROEHQI¤UPLJHP 'RUQ PLW VWLOLVLHUWHP 7LHUNRSI5HFKWHFNLJHU%HVFKODJPLWYLHU.X JHONRSIQLHWHQ XQG /¤ZHQGDUVWHOOXQJ 'RUQ XQG]ZHL1LHWHQORVH5©FNVHLWHQEOHFKIHKOW u 270

3URYHQLHQ] ([ 6DPPOXQJ .%    HUZRUEHQEHL9.1HZ<RUN'DYRU3ULYDWVDPPOXQJ 6LOYHUEXFNOHZLWKUHFWDQJXODUSODWHZLWKIRXUGRPHG ULYHWVDQGDOLRQ2VWURJRWKLFWKFHQWXU\$'7RQJXH DQGWZRULYHWVORRVHEDFNVLGHVKHHWPLVVLQJ

168


271 6LOEHUQHU*©UWHOEHVFKODJPLW,QVFKULIW5¤PLVFK-KQ&KU [FP5HFKWHFNLJHU%HVFKODJHLQHU5LHPHQ]XQJHPLWGHU ,QVFKULIW),'(6$P5DQGWHLOZHLVHGUHLHFNLJH(LQNHUEXQJHQ $XIHLQHU6HLWHHLQH1DJHO,QWDNW u 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 6LOYHUEHOW}WWLQJZLWKWKHLQVFULSWLRQ),'(65RPDQQGUGFHQWXU\$' ,QWDFW 271

272 %URQ]HQH *©UWHOVFKQDOOH 6DVVDQLGLVFK    -K Q &KU  [ FP %URQ]HJXVV 5HFKWHFNLJH 3ODWWH PLW ]ZHL ]XHLQDQGHU VFKDXHQGHQ P”QQOLFKHQ E”UWLJHQ GUDSLHUWHQ %©VWHQ GLH VLFK GLH +”QGH UHLFKHQ $Q GHQ 6FKPDOVHLWHQ ]ZHL XQWHUVFKLHGOLFK JURgH.Q¤SIH]XP6FKOLHgHQXQG]XU%HIHVWLJXQJGHV5LHPHQV %UDXQH3DWLQDZLQ]LJH)UDJPHQWHIHKOHQ u 3URYHQLHQ]([6DPPOXQJ&%+HVVHQYRU %URQ]HFDVWEHOWEXFNOHGHSLFWLQJWZRPDOHEXVWVVKDNLQJKDQGV6DVVDQLDQ WKWKFHQWXU\$'%URZQSDWLQDWLQ\IUDJPHQWVPLVVLQJ

273 3DDU 6LOEHU}EHOQ PLW .HWWH 7KUDNLVFK    -K Y &KU / LQVJHVDPWFP/MH)LEHOFP=ZHLHLQJOLHGULJH%©JHO}EHOQ PLW HLQIDFKHU 6SLUDONRQVWUXNWLRQ XQG UXQGHU 6FKHLEH DXI GHP )XgGLHPLWHLQHU.HWWHYHUEXQGHQVLQGGHUHQDFKW*OLHGHUDXV HLQHP'UDKWPLW]ZHLVHQXQGHLQHP0LWWHOVWHJJHIRUPWVLQG XQGVLFKDP(QGH©EHUVFKQHLGHQXQGVSLUDOLJDXIJHZLFNHOWVLQG 6HKUVFK¤QHV([HPSODU,QWDNW u

272

3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 3DLURIRQHSLHFHVLOYHUERZ}EXODHZLWKDGLVFRQWKHIRRWDQGFRQQHFWHGZLWK DFKDLQ7KUDFLDQWKUGFHQWXU\%&,QWDFWAttractive piece!

273

169


274 %©JHO}EHOQ PLW .UHLVDXJHQ 6ODZLVFK  -K Q &KU /   FP %URQ]HJXVV 0LW KDOEUXQGHU GXUFKEURFKHQHU .RSISODWWH PLW 9RJHONRSIUDQG GLH UKRPELVFKH )XgSODWWH PLW7LHUNRSIHQGH$XI.RSIXQG)XgSODWWH ~Â&#x201D;FKLJJHSXQ]WH.UHLVDXJHQ6W©FN*U©QH XQGJU©QEODXH3DWLQDEHLDOOHQ)LEHOQIHKOHQ GLH1DGHOQEHLHLQHUDXFKGLH+DOWHUXQJI©U GLH1DGHO u 3URYHQLHQ]([0©QFKQHU3ULYDWVDPPOXQJ06VHLW HU-DKUHQ :0HQJKLQ +UVJ 0HURZLQJHU]HLW(XURSDRKQH *UHQ]HQ $UFKÂ&#x201D;RORJLH XQG *HVFKLFKWH GHV  ELV  -DKUKXQGHUWV $XVVWHOOXQJ %HUOLQ  0RVNDX  6W 3HWHUVEXUJ  61U,,,

274

%RZ }EXODV ZLWK VHPLFLUFXODU RSHQZRUN KHDGSODWH ZLWKÂ&#x20AC;IXVHGyELUGKHDGNQREVIRRWSODWHWHUPLQDWLQJLQ DQLPDOKHDGKHDGDQGIRRWSODWHGHFRUDWHGZLWKULQJ DQGGRWSXQFKPDUNV6ODYRQLFWKFHQWXU\$'$OO QHHGOHVPLVVLQJDOVRDWRQH}EXODWKH}[LQJIRUWKH QHHGOH3 pieces!

275 )LEHOQ LQ 'XUFKEUXFKVWHFKQLN 6ODZLVFK  -K Q &KU /   FP *HJRVVHQ %URQ]H RGHU 0HWDOOOHJLHUXQJ $QWKURSR]RRPRUSKH %©JHO}EHOQ PLW MHZHLOV YRQ GHU .RSI XQG )XgSODWWH KÂ&#x201D;QJHQGHQ 7LHUN¤SIHQ HLQH )LEHO PLWVHFKV7LHUN¤SIHQ6W©FN%HLGUHL)LEHOQ IHKOWGLH1DGHOHLQH)LEHOPLW5LVV u

275

3URYHQLHQ]([0©QFKQHU3ULYDWVDPPOXQJ06VHLW HU-DKUHQ :0HQJKLQ +UVJ 0HURZLQJHU]HLW(XURSDRKQH *UHQ]HQ $UFKÂ&#x201D;RORJLH XQG *HVFKLFKWH GHV  ELV  -DKUKXQGHUWV $XVVWHOOXQJ %HUOLQ  0RVNDX  6W 3HWHUVEXUJ  6I1U,,, Â&#x20AC;$QWKURSR]RRPRUSKLFy ERZEURRFKHV LQ RSHQZRUN GHFRUDWLRQLQFOXGLQJDSDLURIGRZQZDUGIDFLQJDQLPDO KHDGVSURWUXGLQJIURPERWKWKHKHDGDQGWKHIRRWSODWH RQH ZLWK WKUHH SDLUV RI DQLPDOKHDGV 6ODYRQLF WK FHQWXU\$'7KUHH}EXODVZLWKRXWQHHGOHRQHZLWK }VVXUH4 pieces!

276 %©JHO}EHOQPLW.UHLVDXJHQ6ODZLVFK-KQ &KU/FP%URQ]HJXVV0LWKDOEUXQGHU .RSISODWWHPLWI©QI5XQGHOQGLHUKRPELVFKH )XgSODWWH PLW 7LHUNRSIHQGH XQG ]HQWUDOHP JHJLWWHUWHP=LHUIHOG$XI.RSIXQG)XgSODW WH~Â&#x201D;FKLJJHSXQ]WH.UHLVDXJHQ6W©FN*U© QH 3DWLQD 1DGHOQ XQG GHUHQ +DOWHUXQJHQ IHKOHQ u 3URYHQLHQ]([0©QFKQHU3ULYDWVDPPOXQJ06VHLW HU-DKUHQ :0HQJKLQ +UVJ 0HURZLQJHU]HLW(XURSDRKQH *UHQ]HQ $UFKÂ&#x201D;RORJLH XQG *HVFKLFKWH GHV  ELV  -DKUKXQGHUWV $XVVWHOOXQJ %HUOLQ  0RVNDX  6W 3HWHUVEXUJ  61U,,, 276

170

%RZ }EXODV ZLWK VHPLFLUFXODU KHDGSODWH ZLWK }YH NQREVIRRWSODWHWHUPLQDWLQJLQDQLPDOKHDGKHDGDQG IRRWSODWHGHFRUDWHGZLWKULQJDQGGRWSXQFKPDUNVDQG DKDWFKHGSDQHOLQWKHFHQWHU6ODYRQLFWKFHQWXU\$' 1HHGOHVDQGWKHLU}[LQJPLVVLQJ2 pieces!


277 %©JHO}EHOQPLW.UHLVDXJHQ6ODZLVFK-KQ&KU/ X FP %URQ]HJXVV 0LW KDOEUXQGHU .RSISODWWH PLW I©QI5XQGHOQGLHUKRPELVFKH)XgSODWWHPLW7LHUNRSIHQ GH XQG ]HQWUDOHP JHJLWWHUWHP =LHUIHOG $XI .RSI XQG )XgSODWWH ~Â&#x201D;FKLJ JHSXQ]WH .UHLVSXQNWH  6W©FN Blau JU©QHXQGJU©QH3DWLQDEHLHLQHU)LEHOIHKOWGLH1DGHO XQG GLH +DOWHUXQJ LVW NRUURGLHUW EHL GHU DQGHUHQ IHKOW GHU 1DGHOKDOWHU XQG )XgSODWWH ZLHGHU DQJHVHW]W 1DGHO PRGHUQHUJÂ&#x201D;Q]W u 3URYHQLHQ] ([ 0©QFKQHU 3ULYDWVDPPOXQJ 06 VHLW HU -DKUHQ : 0HQJKLQ +UVJ  0HURZLQJHU]HLW  (XURSD RKQH *UHQ]HQ $UFKÂ&#x201D;RORJLHXQG*HVFKLFKWHGHVELV-DKUKXQGHUWV$XVVWHOOXQJ %HUOLQ0RVNDX6W3HWHUVEXUJ  6II

277

%RZ}EXODVZLWKVHPLFLUFXODUKHDGSODWHZLWK}YHNQREVIRRWSODWH WHUPLQDWLQJ LQ DQLPDO KHDG KHDG DQG IRRWSODWH GHFRUDWHG ZLWK ULQJDQGGRW SXQFKPDUNV 6ODYRQLF WK FHQWXU\ $' 2QH }EXOD ZLWK PLVVLQJ QHHGOH DQG }[LQJ FRUURGHG WKH RWKHU ZLWK PLVVLQJ QHHGOHKROGHUUHDWWDFKHGQHHGOHDQGIRRWSODWH2 pieces!

278 %©JHO}EHOQ PLW $OPDQGLQ 9¤ONHUZDQGHUXQJV]HLW  +Â&#x201D;OIWH-KQ&KU/FP9HUJROGHWH%URQ]HPLW(L VHQQDGHO.RSISODWWHPLWMHI©QI5XQGHOQHLQHPJHZ¤OE WHQUXQGHQJHIDVVWHQ$OPDQGLQXQG.HUEVFKQLWWGHNRU LQ 3HOWHQIRUP UKRPELVFKH )XgSODWWH PLW ]ZHL JHZ¤OE WHQ UXQGHQ JHIDVVWHQ $OPDQGLQHQ DQ GHQ (FNHQ XQG .HUEVFKQLWWGHNRULQ)RUPYRQ5DXWHQ6W©FN9HUJRO GXQJJXWHUKDOWHQ,QWDNW1DGHOQHWZDVNRUURGLHUW u 3URYHQLHQ] ([ 6DPPOXQJ )7 %DGHQ:©UWWHPEHUJ HUZRUEHQ EHL*RUQ\ 0RVFK$XNWLRQ/RVDXVGHXWVFKHU 3ULYDWVDPPOXQJ

278

3DLU RI ERZ }EXODV JLOGHG EURQ]H ZLWK LURQ QHHGOH FKLSFDUYHG GHFRUDWLRQ DQG DOPDQGLQH ,QWDFW QHHGOHV SDUWLDOO\ FRUURGHG 0LJUDWLRQ3HULRGQGKDOIRIWKFHQWXU\$'2 pieces! Gilding partially well preserved!

279 %URQ]HQH %©JHO}EHO 2VWNHOWLVFK    -K Y &KU / FP 7\S 0LWWHO/D7Â&#x2122;QH6FKHPD (LQJOLHGULJH )LEHO PLW EHLGVHLWLJHU 6SLUDOH .ODPPHU ]ZLVFKHQ )XgHQGH XQG%©JHOPLW]ZHL1DGHOQ6FKZDU]H3DWLQDLQWDNW u

279

3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[ 0©QFKQHU3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]H ERZ }EXOD RI WKH W\SH 0LGGOH /D7Â&#x2122;QH &HOWLF UG  VW FHQWXU\%&%ODFNSDWLQDLQWDFW

280 %URQ]H}EHOGHV)U©KODWÂ&#x2122;QHVFKHPDV.HOWLVFK-KY&KU /FP0DVVLYJHJRVVHQHUSUR}OLHUWHU%©JHOPLW'H NRUDWLRQLQ)RUPYRQ6SLUDOHQGHULQHLQHQGUDKWDUWLJHQ 1DGHOKDOWHU©EHUJHKWGHUDXIJHERJHQLQHLQHPKRKOHQ JHJRVVHQHQ KDOENXJHOLJHQ .QRSI HQGHW GHU DP %©JHO DQVHW]W$XIGHP.QRSILP=HQWUXPHLQNOHLQHU%XFNHO XQGHLQVWUDKOHQDUWLJHV0XVWHU)LEHOPLW6SLUDONRQVWUXN WLRQ*U©QH3DWLQDLQWDNW u

280

3URYHQLHQ]([6DPPOXQJ*-$0/1LHGHUODQGHVHLW %URQ]HERZ}EXODRIWKHHDUO\/D7Â&#x2122;QHVFKHPDZLWKFDVWERZDQG VSLUDOFRQVWUXFWLRQ&HOWLFUGFHQWXU\%&*UHHQSDWLQDLQWDFW

171


281

281 0LQLDWXUJROGNUDJHQ1RUGDIULND6SÂ&#x201D;W]HLW'\QDVWLH Y&KUJkFP$XVG©QQHP*ROGEOHFKJHWULHEHQ 6LFKHOI¤UPLJPLWHLQHPKDOENUHLVI¤UPLJHQ+DOVEDQGPLW+RUXV )DONHQN¤SIHQ DQ GHQ (QGHQ XQG GD]ZLVFKHQ YLHU 5HLKHQ YRQ %OÂ&#x201D;WWHUQ6WHUQHQ7LHUHQXQG%OÂ&#x201D;WWHUQ'LHQWHDOV$PXOHWW*ROG :LQ]LJHV5DQGIUDJPHQWIHKOWOHLFKWH.QLFNH u

%URQ]HSKDOHUDGHSLFWLQJ0DUVZLWKSDUD]RQLXPDQG0LQHUYDZLWKVKLHOGDQG 0HGXVDDERYHDZUHDWKDQGWZRHDJOHVLQEHWZHHQDWURSDHXP5RPDQVW QGFHQWXU\$'&OHDQHGIUDJPHQWRIWKHHGJHPLVVLQJWLQ\KROHV

3URYHQLHQ] ([ FROOHFWLRQ 'U -RKQ :LQQLH 6W 0DU\hV *HRUJLD 86$ (UZRUEHQLQGHQHU-DKUHQ 9JO*ROGDPXOHWWLP0HWURSROLWDQ0XVHXP1HZ<RUN$FFHVVLRQ1XPEHU =XGHUDUWLJHQ$PXOHWWHQ&$QGUHZV$PXOHWVRI$QFLHQW(J\SW  6I$EED %URDGFROODUDPXOHWRIJROGIRLO1RUWK$IULFD/DWH3HULRGWKWKG\QDVW\ %&7LQ\IUDJPHQWPLVVLQJZLWK}QHEHQGV

282 %URQ]H3KDOHUD PLW 0DUV XQG 0LQHUYD 5¤PLVFK    -K Q &KUkFP5XQGH6FKHLEHPLWHLQHP5DQG]ZLVFKHQHUKD EHQHQ 6WHJHQ JHI©OOW PLW HLQHU 3XQNWUHLKH VRZLH HLQHP %ODWW NUDQ] ,P 7RQGR GLH V\PPHWULVFK DQJHRUGQHWHQ EHKHOPWHQ %©VWHQYRQ0DUVOLQNVPLW3DUD]RQLXPXQG0LQHUYDUHFKWVPLW 6FKLOGXQGHLQHP0HGXVDKDXSW'DU©EHUHLQ.UDQ]PLWHLQHP %XFNHOLP,QQHUHQXQG~DQNLHUWYRQ]ZHL$GOHUQ'D]ZLVFKHQ HLQ7URSDHXP*HUHLQLJWHLQJU¤gHUHV5DQGIUDJPHQWIHKOWNOHL QH/¤FKHU u 3URYHQLHQ]([0©QFKQHU3ULYDWVDPPOXQJ06VHLWHU-DKUHQ

172

282


283

283 %URQ]HEHVFKODJPLW0LOOH}RUL'HNRURömisch, 3. Jh. n. Chr. Ã&#x2DC; FP%URQ]HVFKHLEHPLWQDFKLQQHQJHZ¤OEWHP5DQGLP5DQG ]ZHL %HIHVWLJXQJVO¤FKHU DXI GHU 5©FNVHLWH HLQ DEJHEURFKHQHU 'RUQ 9RUQH LQ I©QI .UHLVHQ (PDLOHLQODJHQ DXV URWHP XQG EODXHP *ODVPRVDLN GDV HLQ 0LOOH}RUL0XVWHU HUJLEW *U©QH 3DWLQD(PDLO(LQODJHQIHKOHQ]7 u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]H}WWLQJZLWKPLOOH}RULGHFRUDWLRQRIUHGDQGEOXHHQDPHOZLWKPRVDLF JODVVLQVHUWV5RPDQUGFHQWXU\$'*UHHQSDWLQDHQDPHOSDUWLDOO\PLVVLQJ

284 %HVFKODJPLW0LOOH}RUL'HNRURömisch, 3. Jh. n. Chr. Ã&#x2DC; 4,7cm. %URQ]HVFKHLEHPLWQDFKLQQHQJHZ¤OEWHP5DQGDXIGHU5©FN VHLWHHLQDEJHEURFKHQHU'RUQDP5DQGMHZHLOVYLHU5LQJHXQG YLHU5XQGHOQ$XIGHU9RUGHUVHLWHLQVHFKV.UHLVHQ(PDLOHLQOD JHQDXVURWHPEODXHPZHLgHPXQGJHOEHP*ODVPRVDLN*U©QH 3DWLQD(LQODJHQIHKOHQ]7 u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ V©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ

284

%URQ]H }WWLQJ ZLWK PLOOH}RUL GHFRU RI UHG EOXH ZKLWH DQG \HOORZ HQDPHO ZLWKPRVDLFJODVVLQVHUWV5RPDQUGFHQWXU\$'*UHHQSDWLQDHQDPHO SDUWLDOO\PLVVLQJ

285 6DPPOXQJ6LOEHUVFKPXFN5¤PLVFK-KQ&KU5LHPHQ VFKQDOOH / FD FP 1LHOOR YHUORUHQ LQWDNW  PLW :ROIV]DKQ PXVWHU LQ 1LHOOR'HNRU DXI GHP %©JHO XQG ODXIHQGHP +XQG E]Z.QRSIDXIGHU5LHPHQ]ZLQJHZHLWHUH5LHPHQVFKQDOOH / FP'RUQIHKOW PLW3XQ]GHNRUDXIGHU5LHPHQ]ZLQJH)LVFK }EHO /FP1DGHOIHKOW PLWEODXHU(PDLO(LQODJHLP.RSI HLQHD[WI¤UPLJH)LEHO /FP1DGHOIHKOW.UDW]HU 5LQJ k PPLQWDNW GHVVHQ(QGHQPLW'UDKWXPZLFNHOWXQGYHU EXQGHQVLQGVRZLHHLQNHOWLVFKHU5LQJ kPPLOO\ULVFK Y&KULQWDNW PLWJHULIIHOWHQ1RSSHQ6W©FN u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   H[ /RV  H[ 0©QFKQHU3ULYDWVDPPOXQJ06VHLWHU-DKUHQ &ROOHFWLRQRI5RPDQVLOYHUMHZHOOHU\FRPSULVLQJDVWUDSEXFNOHZLWKRULJLQDO QLHOOR GHFRUDWLRQ LQWDFW  D VHFRQG VWUDS EXFNOH ZLWK SXQFKHG GHFRUDWLRQ PDQGUHOPLVVLQJ D}VKVKDSHG}EXODZLWKDQHQDPHOLQOD\ QHHGOHPLVVLQJ VFUDWFKHV D}EXODLQVKDSHRIDQD[H 1HHGOHPLVVLQJ D}QJHUULQJZLWK YROXWHVHQGLQJV LQWDFW DQGD}QJHUULQJZLWKHQJUDYHGQREV &HOWLF,OO\ULDQ %&LQWDFW 5RPDQQGUGFHQWXU\$'6 pieces!

285

173


286

286 6DPPOXQJ6LOEHUXQG%URQ]HVFKPXFN%URQ]H]HLW-KY&KU )U©KPLWWHODOWHU-KQ&KU'DUXQWHUHLQH6LOEHUQDGHOPLW 7DXEHDOV$XIVDW] /FPU¤PLVFK-KQ&KU HLQH%URQ ]HQDGHO /FP%URQ]H]HLW-KY&KU PLW3UR}OLH UXQJHQXQGWHOOHUI¤UPLJHP.RSIHLQ%URQ]HDUPUHLIPLWNRQLVFK YHUGLFNWHQ(QGHQXQG5LW]GHNRU kFP%URQ]H]HLWFD   Y&KU  HLQ %URQ]HDUPUHLI PLW NRQLVFK YHUGLFNWHQ (Q GHQXQGHLQHUELNRQLVFKHQ%URQ]HSHUOHPLW5LW]GHNRU kFP %URQ]H]HLWFDY&KUJU©QH3DWLQD HLQH6LOEHU}EHO /FPU¤PLVFK-KQ&KU PLW6FKDUQLHUNRQVWUXNWLRQ XKRKHP1DGHOKDOWHUHLQHVLOEHUQH5LQJ}EHO kFP6NDQGL QDYLHQ-KQ&KU DXVWRUGLHUWHP'UDKWHLQHEURQ]HQH +XIHLVHQ}EHOPLWDXIJHERJHQHQ(QGHQ kFP%DOWLNXP -KQ&KU HLQHEURQ]HQH)LEHOPLWXPJHVFKODJHQHP)Xg / FPU¤PLVFK9¤ONHUZDQGHUXQJV]HLW-KQ&KUJU©QH 3DWLQD PLW6SLUDONRQVWUXNWLRQXQGHLQHEURQ]HQH$XJHQ}EHO / FP U¤PLVFK  -K Q&KU  PLW JHSXQ]WHQ .UHLVSXQNWHQ 9 6W©FN 9RUZLHJHQG PLW 6DPPOHU]HWWHOQ XQG ,QYHQWDUQXPPHU DOOHLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV &ROOHFWLRQRIVLOYHUDQGEURQ]HMHZHOOHU\FRPSULVLQJD5RPDQVLOYHUSLQZLWK SLJHRQ WKFHQWXU\$' D%URQ]H$JHSLQ WKWKFHQWXU\$' WZR %URQ]H$JHEUDFHOHWVRQHZLWKHQFDUYHGGHFRUDWLRQ DERXW%&  D5RPDQVLOYHU}EXOD QGUGFHQWXU\$' DVLOYHUULQJEURRFKRIWRUGHG ZLUH 6FDQGLQDYLDWKWKFHQWXU\$' DEURQ]HEURRFKLQVKDSHRID KRUVHVKRH %DOWLFXPWKWKFHQWXU\$' 5RPDQWR0LJUDWLRQ3HULRG EURQ]H}EXOD QGWKFHQWXU\$' DQGD5RPDQEURQ]HH\H}EXODZLWK SXQFKHGFLUFOHV VWFHQWXU\$' 0RVWO\ZLWKFROOHFWRUyVQRWHVDQGLQYHQWRU\ QXPEHUDOOLQWDFW9 pieces!

287 â&#x20AC;¢ 3DDU*ROGRKUULQJHPLW*UDQXODWGHNRU6DUPDWLVFK-KY -K Q &KU  XQG J / FP %©JHORKUULQJH PLW ERRWVI¤UPLJHP &RUSXV VRZLH GUHL $QKÂ&#x201D;QJHUQ $XI GHP &RU SXVDQGHU6FKPDOVHLWHGUHLWURSIHQI¤UPLJH)DVVXQJHQI©U*ODV HLQODJHQVRZLH*UDQXODWGHNRU'LH$QKÂ&#x201D;QJHUEHVWHKHQ]ZHL0DO DXV]ZHLJORFNHQI¤UPLJHQ(OHPHQWHQPLW$QKÂ&#x201D;QJHUQLQ)RUP YRQ NDQWLJHQ WURSIHQI¤UPLJHQ 3HUOHQ XQG HLQ 0DO DXV ]ZHL KDOENUHLVI¤UPLJHQ (OHPHQWHQ PLW HEHQIDOOV NDQWLJHQ WURSIHQ I¤UPLJHQ3HUOHQ*ROG,QVJHVDPWI©QI7URSIHQDQKÂ&#x201D;QJHUZLHGHU DQJHVHW]W*ODVHLQODJHQIHKOHQ u

174

3URYHQLHQ]([6DPPOXQJ.%HUZRUEHQEHL9.1HZ<RUN 'DYRU3ULYDWVDPPOXQJ 3DLURIJROGERZERDWVKDSHGHDUULQJVZLWKGURSVKDSHGPRXQWHGJODVVLQOD\V DQGWKUHHSHQGDQWVZLWKGURSVKDSHGEHDGV6DUPDWLDQQGFHQWXU\%& QGFHQWXU\$')LYHGURSVKDSHGEHDGVUHDWWDFKHGJODVVLQOD\VPLVVLQJ

288 3DDU JROGHQH =RSIULQJH 3K¤QL]LVFK  +Â&#x201D;OIWH  -W Y &KU "  JkFP,P4XHUVFKQLWW9I¤UPLJH6SLUDOHQDXV*ROG EOHFK GLH DQ GHQ .DQWHQ PLW WRUGLHUWHP 'UDKW XQG DXI GHP &RUSXVPLW:LQGP©KOHQ~©JHOQDXVWRUGLHUWHP'UDKWXQGDXI JHEUDFKWHQ%XFNHOQGHNRULHUWVLQG*ROG(WZDV]HUGU©FNW5HVWH YRQ6LQWHU u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 3DLURIJROGKDLUULQJVZLWKGHFRUDWLRQRIWZLVWHGZLUHDQGDSSOLHGEXFNOHV 3KRHQLFLDQVWKDOIVWPLOOHQLXP%& " 6OLJKWO\FUXVKHGWUDFHVRIVLQWHU

289 3DDU*ROGRKUULQJHPLW*UDQXODWGHNRUIslamisch, 12. Jh. n. Chr. J/FP+DNHQI¤UPLJHU%©JHOGHULPXQWHUHQ7HLOYRQ WRUGLHUWHP*ROGGUDKWXPZLFNHOWLVW'DUDQKÂ&#x201D;QJWHLQELNRQLVFKHU &RUSXVGHVVHQ+Â&#x201D;OIWHQPLW'UHLHFN*UDQXODWLRQYHUVHKHQVLQG =ZLVFKHQ GHQ EHLGHQ +Â&#x201D;OIWHQ HLQ ]LHKKDUPRQLNDDUWLJHV %DQG DXV*ROGEOHFK$PXQWHUHQ(QGHHLQH3\UDPLGHGLHHEHQIDOOV PLW*UDQXODWGHNRUYHU]LHUWLVW*ROG5HVWHYRQ6LQWHUDQHLQHP 2KUULQJLQWDNW u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV 9JO0HWURSROLWDQ0XVHXPRI$UW1HZ<RUN$FFHVVLRQ1XPEHUX  'DWLHUXQJ *RUQ\ 0RVFK$XNWLRQ/RV PLW.XJHOQ ]ZLVFKHQGHPXQWHUHQ(QGHXGHU3\UDPLGH 6WHUQEHUJ=©ULFK$XNWLRQ ;;;9/RV 3DUDOOHOVW©FNH $OOHQ0HPRULDO$UW0XVHXP2KLR 0%%G;9,,,61U 3DLURIELFRQLFDOJROGHDUULQJVZLWKJUDQXOHVGHFRUDWLRQ,VODPLFWKFHQWXU\ $'7UDFHVRIVLQWHUDWRQHHDUULQJLQWDFW


287

288

289

175


290 â&#x20AC;¢ 3DDU *ROGRKUULQJH PLW *ODVHLQODJHQ XQG *UDQXODWGHNRU2VWJRWLVFK-KQ&KU J k FP $XI HLQHP VFKPDOHQ 'UDKWUHLIVLW]WHLQHKRKOHSRO\JRQDOH3HU OHGDUDXIYLHUJHZ¤OEWHGXQNHOURWH*OD VHLQODJHQ DOV ,PLWDWLRQ YRQ *UDQDW  LQ )DVVXQJHQDXIGHQDQGHUHQ6HLWHQ'UHL HFNH DXV *UDQXODW 8P GLH $QVDW]VWHO OHQGHV'UDKWUHLIVMHZHLOVHLQ%ODWWPRWLY *ROG,QWDNW u 290

3URYHQLHQ]([&KULVWLHyV1HZ<RUN6DOH 'H]HPEHU/RVGDYRUHXURSÂ&#x201D;LVFKH 3ULYDWVDPPOXQJ HUZRUEHQ  LQ GHQ 86$ JHNDXIW 3DLURIJROGHDUULQJVZLWKGDUNUHGJODVVLQOD\VLQ LPPLWDWLRQRIJDUQHWDQGJUDQXODWHGWULDQJOHVRQ DKROORZSRO\JRQDOEHDG2VWURJRWKLFWKFHQWXU\ $',QWDFW

291 â&#x20AC;¢ 3DDU *ROGRKUULQJH PLW *ODVHLQODJHQ 2VWJRWLVFK-KQ&KUJkFP $XI HLQHP VFKPDOHQ 'UDKWUHLI VLW]W HLQH KRKOH SRO\JRQDOH 3HUOH LQ GLH YLHU URWH UDXWHQI¤UPLJH *ODVHLQODJHQ DOV ,PLWDWLRQ YRQ *UDQDW  HLQJHODVVHQ VLQG 8PGLH$QVDW]VWHOOHQGHV'UDKWUHLIVHLQ stilisiertes Blattmuster. *ROG,QWDNW u 291

3URYHQLHQ] ([ 6DPPOXQJ .%    HUZRUEHQ EHL 9. 1HZ <RUN 'DYRU 3ULYDWVDPPOXQJ 3DLURIJROGHDUULQJVZLWKGDUNUHGJODVVLQOD\VLQ LPPLWDWLRQRIJDUQHWLQDKROORZSRO\JRQDOEHDG 2VWURJRWKLFWKFHQWXU\$',QWDFW

292 3DDU *ROGRKUULQJH PLW *UDQDW6WHLQHQ 3DUWKLVFK    -K Q &KU J / FP 0LW ERRWVI¤UPLJHP &RUSXV DXI GHU 9RUGHUVHLWH HLQ JHZ¤OEWHU WURSIHQ I¤UPLJHU *UDQDWVWHLQ LQ HLQHU )DVVXQJ PLW *ROGN©JHOFKHQ XQG *UDQXODW ,Q GHU 0LWWH GHV &RUSXV ]ZHL 5HLKHQ YRQ *ROGN©JHOFKHQPLW*UDQXODW$XIGHUHL QHQ+Â&#x201D;OIWHGHV&RUSXV*UDQXODWGHNRULQ )RUPYRQ5RVHWWHQXQG'UHLHFNHQVRZLH GLH'UHLHFNHYHUELQGHQGHQ*ROGGUÂ&#x201D;KWHQ DXI GHU DQGHUHQ +Â&#x201D;OIWH VWLOLVLHUWH %OÂ&#x201D;WWHU DXV'UDKWVFKOLQJHQ'HU&RUSXVYHUI©OOW *ROG)HLQH5LVVHZLQ]LJH/¤FKHU u

292

Provenienz: Ex Shlomo Moussaieff Collection /RQGRQ    %HL *RUQ\  0RVFK $XNWLRQ/RV 3DLU RI JROG ERDWVKDSHG HDUULQJV ZLWK D GURS VKDSHGPRXQWHGJDUQHWDQGJUDQXODWLRQGHFRURQ WKHFRUSXV3DUWKLDQVWQGFHQWXU\$'7LQ\ }VVXUHVDQGKROHV

176


293 3DDU JROGHQH 2KUULQJH Römisch,    -K Q &KU J / FP %RRWVI¤UPLJH 2KUULQJH PLW 'UDKWVFKOLQJHQ XQG *UDQXODWGHNRU VRZLH HLQHP WURSIHQI¤UPLJHQ XQG HLQHP UXQGHQ JHIDVVWHQ *ODVVWHLQ XQG HLQHU 5RVHWWH *ROG 2EHU~”FKH EHULHEHQHWZDV]HUGU©FNW5HVWHYRQ 6LQWHU u Provenienz: Ex Shlomo Moussaieff Collection /RQGRQ%HL*RUQ\ 0RVFK $XNWLRQ/RV

293

3DLURIJROGERDWVKDSHGHDUULQJVZLWKZLUH DQGJUDQXOHVGHFRUDWLRQWZRPRXQWHGJODVV VWRQHV DQG D URVHWWH 5RPDQ QG  UG FHQWXU\$'6XUIDFHZRUQVOLJKWO\FUXVKHG WUDFHVRIVLQWHU

294 • 3DDU *ROGRKUULQJH PLW VHQGHNRU 5¤PLVFK ¤VWOLFKHV 0LWWHOPHHUJHELHW    -K Q &KU J k FP )ODFKH5LQJHDXVJODWWHPXQGWRUGLHU WHP'UDKWGLHDQGHU$XgHQVHLWHPLW VHQ DXV GXUFKJHKHQGHP XPODX IHQGHP 'UDKW GHNRULHUW VLQG *ROG ,QWDNW u Provenienz: Ex Shlomo Moussaieff Coll HFWLRQ    ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWL NHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ /RV 3DLURIJROGFUHROHHDUULQJVZLWKWZLVWHGZLUH DQGWLQ\ORRSVRISODLQZLUH5RPDQ(DVWHUQ 0HGLWHUUDQHDQ QG  UG FHQWXU\ $' ,QWDFW

294

295 • 3DDU *ROGRKULQJH PLW *UDQXODWGHNRU 1DEDW”LVFK-KQ&KUJ / FP %©JHORKUULQJH PLW HLQHP KDOEERJHQI¤UPLJHQ JHULHIHOWHQ (OH PHQW DQ GHP ]HQWUDO HLQ $QK”QJHU DXV ]ZHL PLWHLQDQGHU YHUEXQGHQHQ .©JHOFKHQ K”QJW YRQ GHP HLQH PLW *UDQXODWGHNRU YHU]LHUW LVW *ROG (W ZDV ]HUGU©FNW EHL HLQHP 2KUULQJ %©JHOJHEURFKHQ u Provenienz: Ex Shlomo Moussaieff Coll HFWLRQ    ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWL NHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ /RV

295

3DLU RI JROG ERZ HDUULQJV ZLWK D FUHVFHQW VKDSHGHOHPHQWDQGDSHQGDQWRIWZRMRLQWHG KROORZ VSKHUHV RQH RI WKHP ZLWK JUDQXOHV 1DEDWDHDQVWQGFHQWXU\$'3DUWLDOO\ FUXVKHGRQHERZEURNHQ

177


296 â&#x20AC;¢ 3DDU *ROGRKUULQJH PLW *UDQDW XQG 3HUOPXWW %\]DQWLQLVFK    -K Q &KU J / FP +DOEPRQGI¤UPLJH LQ 'XUFKEUXFKV WHFKQLNJHDUEHLWHWH6FKHLEHPLWKRKHP%©JHO XQG HLQHP ]HQWUDOHQ JHIDVVWHQ OÂ&#x201D;QJVRYDOHQ JHZ¤OEWHP 6WHLQ DXV *UDQDW 8QWHQ YLHU $QKÂ&#x201D;QJHU DXV )XFKVVFKZDQ]NHWWHQ PLW MH ZHLOVGUHLNOHLQHQ3HUOPXWWSHUOHQXQGHLQHP (IHXEODWWDXV*ROGGUDKWDP(QGH*ROG$Q KÂ&#x201D;QJHUPRGHUQHUJÂ&#x201D;Q]W u Provenienz: Ex Shlomo Moussaieff Collection, 1948 ([SRUWLHUWPLWGHU$XVIXKUJHQHKPLJXQJGHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ/RV

296

3DLURIJROGKDOIPRRQHDUULQJVLQRSHQZRUNWHFKQLTXH ZLWKDFHQWUDOPRXQWHGJDUQHWIRXUSHQGDQWVPDGHRI IR[WDLOQHFNODFHVZLWKWKUHHPLQLDWXUHEHDGVRIQDFUH HQGLQJ LQ DQ LY\ OHDI RI JROG ZLUH %\]DQWLQH WK   WK FHQWXU\ $' 3HQGDQW ZLWK EHDGV DQG LY\ OHDI PRGHUQ

297 â&#x20AC;¢ 3DDU *ROGRKUULQJH 3DUWKLVFK    -K Y &KUJ/FP%©JHORKUULQJHPLW6FKDU QLHU PLW HLQHP NDKQDUWLJHQ VSLW]HQ SUR }OLHUWHQ $QKÂ&#x201D;QJHU GHU DQ GHQ (QGHQ PLW WRUGLHUWHP *ROGGUDKW XPZLFNHOW XQG PLW *ROGN©JHOFKHQGHNRULHUWLVW$XIGHPNDKQ I¤UPLJHQ7HLOHEHQIDOOVWRUGLHUWH*ROGGUÂ&#x201D;KWH XPGLH6SLW]HJHZLFNHOWXQGLQGHU0LWWHGHU Langseiten. *ROG6WLIWGHV9HUVFKOXVVHVIHKOW VRQVWLQWDNW u

297

Provenienz: Ex Shlomo Moussaieff Collection, 1948 ([SRUWLHUWPLWGHU$XVIXKUJHQHKPLJXQJGHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ/RV 3DLU RI JROG HDUULQJV HDFK D KROORZ VTXDUHVHFWLRQ WDSHULQJKRRSZLWKKLQJH}QLDOVFRQLFDOERDWVKDSHG SHQGDQWZLWKDSSOLHGJUDQXODWLRQDQG}OLJUHH3DUWKLDQ UG  VW FHQWXU\ %& +LQJH SLQ PLVVLQJ RWKHUZLVH LQWDFW

298 3DDU*ROGRKUULQJHPLW'LDWUHW5¤PLVFK -KQ&KUJ/FP%©JHORKUULQJH PLW HLQHP TXDGUDWLVFKHQ GXUFKEURFKHQ JH DUEHLWHWHQ 6FKLOG DXV *ROGEOHFK LQ 'LDWUHW 7HFKQLN XQG ]HQWUDOHU *ODVSHUOH VRZLH GUHL NOHLQHQ $QKÂ&#x201D;QJHUQ PLW MH HLQHU 3HUOH *ROG (LQH*ODVSHUOHIHKOW u 3URYHQLHQ] ([ 6©GGHXWVFKH 3ULYDWVDPPOXQJ 06 VHLWHU-DKUHQ 298

178

3DLURIJROGERZHDUULQJVZLWKDUHFWDQJXODUSODTXH LQSLHUFHGZRUNZLWKDJODVVVWRQHLQWKHFHQWHUDQG WKUHHSHQGDQWVZLWKDVPDOOJODVVEHDGKDQJLQJIURP WKUHHORRSV5RPDQUGWKFHQWXU\$'2QHJODVV EHDGPLVVLQJ


299 3DDU JROGHQH 2KUULQJH 5¤PLVFK    -K Q &KU J / FP%©JHORKUULQJHPLWHLQHPERRWVI¤UPLJHQKRKOHQ&RUSXV DXV*ROGEOHFK*ROG%©JHOPRGHUQHUJÂ&#x201D;Q]W&RUSXVYRQHLQHP 2KUULQJ]HUGU©FNW u 3URYHQLHQ]([6DPPOXQJ'U3**LDFRPHWWLHUZRUEHQEHL&KDUOHV(GH /WG/RQGRQFD 3DLURIJROGHQERRWVKDSHGHDUULQJV5RPDQQGUGFHQWXU\$'%RZ PRGHUQFRUSXVRIRQHHDUULQJFUXVKHG

299

300

301

300 â&#x20AC;¢ 9LHU 3DDU *ROGRKUULQJH :HVWDVLDWLVFK  -W Y &KU J k FD FP =ZHL 3DDUH EHVWHKHQ DXV HLQHP %©JHO GHU VLFK LQ GHUXQWHUHQ+Â&#x201D;OIWHLQ]ZHL6WUÂ&#x201D;QJHWHLOWGLHLQGHU0LWWHWULFKWHU DUWLJYHUGLFNWVLQGXQGDQGHU7HLOXQJVVWHOOHPLW'UDKWXPZLN NHOWVLQG(LQ3DDUEHVWHKWQXUDXVHLQHP%©JHOGHUVLFKLQGHU XQWHUHQ +Â&#x201D;OIWH ]XU 0LWWH KLQ YRQ EHLGHQ 6HLWHQ WULFKWHUI¤UPLJ YHUGLFNW(LQ3DDUEHVWHKWDXVEHLGHQ)RUPHQ*ROG3DDU In WDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK$XNWLRQ/RV

301 *ROGVFKPXFNPLW*UDQDW+HOOHQLVWLVFK-KY&KU,QVJH VDPWJ2KUULQJ +FPHWZDV]HUGU©FNW PLWHLQHP%© JHODXVWRUGLHUWHP'UDKWXQG/¤ZHQNRSI]ZLVFKHQ0DQVFKHWWH XQG /¤ZHQNRSI HLQH *UDQDWSHUOH $XgHUGHP YLHU .HWWHQHOH PHQWH / FP  DXV SVHXGRWRUGLHUWHP *ROGGUDKW LQ )RUP HLQHV +HUDNOHVNQRWHQ PLW ]HQWUDOHP UXQGHP *UDQDW *ROG  6W©FN(LQH*UDQDWSHUOHIHKOW u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ *ROGMHZHOOHU\LQFOXGLQJDERZHDUULQJZLWKDOLRQKHDGDQGDJDUQHWEHDG DQGIRXUHOHPHQWVRIDQHFNODFHLQVKDSHRID+HUDFOHVNQRWZLWKFHQWUDOJDUQHW LQOD\+HOOHQLVWLFUGQGFHQWXU\%&2QHJDUQHWLQOD\PLVVLQJ5 pieces!

)RXUSDLUVRIJROGERZHDUULQJVZLWKIXQQHOVKDSHGWKLFNHQHGKRRSVRPHRI WKHPZLWKWZRSDUWKRRS:HVWHUQ$VLDWLFVWPLOOHQLXP%&,QWDFW4 pair!

179


302 *ROGULQJ PLW 6NDUDE”XV 3K¤QL ]LVFK-WY&KUJ+FP % FP /”QJV GXUFKERKUWHU 6NDUDE”XVDXVRUDQJHP.DUQHRO DXI GHU 6LHJHO~”FKH XPODXIHQGHU 6SLUDOUDQG GDULQ HLQH DXIUHFKW VWHKHQGH IDONHQN¤S}JH )LJXU ,Q HLQHU )DVVXQJ PLW HLQHP 5DQG DXV6FKODXIHQXQG6SLUDOEDQGGH NRUPLW*UDQXODWN©JHOFKHQ'DU ©EHU HLQ PLW 'UDKW XPZLFNHOWHU %RJHQ PLW VH DOV $XIK”QJHU *ROG,QWDNW u Provenienz: Ex Shlomo Moussaieff &ROOHFWLRQ /RQGRQ    %HL *RUQ\  0RVFK $XNWLRQ   /RV 302

*ROG ULQJ ZLWK VFDUDE PDGH RI RUDQJH FRUQHOLDQGHSLFWLQJDVWDQGLQJ}JXUHZLWK KRUXV KHDG 3KRHQLFLDQ VW PLOOHQLXP %&,QWDFW

303 *ROGULQJ :LNLQJLVFK    Jh. n. Chr. 16,38g, Ringgröße 62. 6FKLHQHDXVVHFKV]XGHQ(QGHQ NRQLVFK YHUODXIHQGHQ *ROGGU”K WHQ JH~RFKWHQ GLH LQ GHU 0LW WH ~DFK YHUK”PPHUW VLQG *ROG 7UDJEDU,QWDNW u 3URYHQLHQ]([6DPPOXQJ%5%HOJLHQ VHLW

303

180

*ROG }QJHUULQJ FRPSRVHG RI VL[ SODLWHG URGV GLPLQLVKLQJ WR WKH EDFN DQG KDPPHUHG WR IRUP D SODLQ EDQG 9LNLQJWKWKFHQWXU\$',QWDFW Wearable!


304 9RWLY5LQJ PLW *HPPH 6DVVDQLGLVFK    -KQ&KU+FP*HPPH%FP)RUP YRQHLQHPVDVVDQLGLVFKHQ6WHPSHOVLHJHODXV *ROGEOHFK HOOLSVRLG PLW 4XHUERKUXQJw 2EHU~”FKH VWDUN UHOLH}HUW *HPPH DXV +H OLRWURS DXI GHP TXHURYDOHQ ,QWDJOLR HLQ ]ZHLEHLQLJHV7LHUPLWVFKODQJHQDUWLJHP+LQ WHUOHLE PLW ]XU©FNJHZDQGWHP .RSI XPJH EHQYRQ%XFKVWDEHQXQGHLQHP6WHUQ*ROG 5HVWHYRQ6LQWHUXQG*U©QVSDQLQWDNW u

298

304

Provenienz: Ex Shlomo Moussaieff Collection London, %HL*RUQ\ 0RVFK$XNWLRQ /RV *ROGYRWLYHULQJLQVKDSHRID6DVVDQLDQVWDPSVHDOZLWK DJHPVWRQHPDGHRIKHOLRWURSHGHSLFWLQJDWZROHJJHG DQLPDOZLWKDVQDNHOLNHEDFNDQGOHWWHUVDQGDVWDU 6DVVDQLDQWKWKFHQWXU\$'7UDFHVRIVLQWHUDQG FRUURGHGLQWDFW

305 *ROGULQJPLW,QVFKULIW5¤PLVFK-KQ &KU J 5LQJJU¤gH PP 1HXQHFNLJH %DQGVFKLHQH GDUDXI DXgHQ GLH ,QVFKULIW %/$6,927 LQQHQ GLH %XFKVWDEHQ LRD. *ROG,QWDNW u 305

3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ /RVH[6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLW HU-DKUHQ *ROG}QJHUULQJZLWKWKHLQVFULSWLRQ%/$6,927DQG the letters LRDLQVLGH5RPDQUGWKFHQWXU\$' ,QWDFW

306 *ROGULQJ PLW .DUQHRO*HPPH 5¤PLVFK   -KQ&KUJ5LQJJU¤gH6FKPDOH QDFK DXgHQ NRQYH[H 6FKLHQH GLH VLFK QDFK REHQYHUEUHLWHUWXQGLQHLQHURYDOHQ)DVVXQJ HQGHW 'DULQ HLQ TXHURYDOHU ,QWDJOLR DXV UR WHP.DUQHROPLW9LNWRULDPLW.UDQ]X3DOP ]ZHLJGLHGHPWKURQHQGHQ-XSLWHUPLW/DQ]H GLH+DQGUHLFKW*ROG*HEUDXFKVVSXUHQLQ WDNW u

306 294

3URYHQLHQ]([6DPPOXQJ%5%HOJLHQVHLW *ROG }QJHUULQJ ZLWK D JHPVWRQH RI UHG FRUQHOLDQ GHSLFWLQJ 9LFWRU\ ZLWK ZUHDWK DQG SDOP EUDQFK DQG HQWKURQHG-XSLWHUZLWKODQFH5RPDQVWQGFHQWXU\ $'7UDFHVRIXVDJHLQWDFW

307 *ROGULQJ9¤ONHUZDQGHUXQJV]HLW-KQ &KUJ5LQJJU¤gHPP6HKUVFKPDOH 6FKLHQHGLHVLFKQDFKREHQKLQ]ZHLWHLOW]ZL VFKHQEHLGHQ6FKLHQHQHLQ6SLUDOGUDKWREHQ DXIGHU3ODWWHMHZHLOVHLQH5DXWHDXV*UDQXODW *ROG,QWDNW u

295

307 3URYHQLHQ]([6DPPOXQJ6.3DULVHUZRUEHQ-XQL EHL%DLOO\3RPPHU\ 9RXWLHU3DULV *ROG }QJHUULQJ ZLWK WZR ORRSV DQG JUDQXOHV GHFRUDWLRQ0LJUDWLRQ3HULRGWKWKFHQWXU\$' ,QWDFW

181


309

310

309 6LOEHUULQJPLW.DUQHRO6SÂ&#x201D;WDQWLN-KQ&KU5LQJJU¤gH PP 6FKPDOH QDFK DXgHQ NRQYH[H QDFK REHQ EUHLWHU ZHUGHQGH 6FKLHQH PLW 6FKXOWHUNQLFN XQG 3UR}OLHUXQJHQ ,Q GHU 3ODWWH HLQJHODVVHQ HLQH DFKWHFNLJH *HPPH DXV RUDQJHP .DUQHRO PLW GHU ,QVFKULIW ;3,&  729 REHU XQG XQWHUKDOE HLQHV$QNHUV*HPPHEHVWRgHQ u

311 6LOEHUULQJ PLW -DVSLV 5¤PLVFK    -K Q &KU 5LQJJU¤gH  6FKPDOH QDFK DXgHQ NRQYH[H 6FKLHQH PLW 0LWWHOJUDW XQG 6FKXOWHUNQLFNGLHVLFKQDFKREHQYHUEUHLWHUW$XIGHU3ODWWHHLQ HUKDEHQHUOÂ&#x201D;QJVRYDOHU,QWDJOLRPLWWKURQHQGHP,XSLWHUPLW/DQ ]HXQG%OXPH*HEUDXFKVVSXUHQNOHLQHV/RFKLQGHU6FKLHQH LQWDNW u

3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ

3URYHQLHQ]([6DPPOXQJ'U00.DQDGDHU-DKUH

6LOYHU}QJHUULQJZLWKDRFWRJRQDOJHPVWRQHRIRUDQJHFRUQHOLDQGHSLFWLQJWKH LQVFULSWLRQ;3,&729DERYHDQGXQGHUDQDQFKRU/DWH$QWLTXHWKWK FHQWXU\$'*HPVWRQHZLWKWLQ\PLVVLQJIUDJPHQWV

6LOYHU}QJHUULQJZLWKDJHPVWRQHRIUHGMDVSHUGHSLFWLQJHQWKURQHG-XSLWHU ZLWKODQFHDQG~RZHU5RPDQQGUGFHQWXU\$'7UDFHVRIXVDJHWLQ\ KROHLQWKHKRRS

310 6LOEHUULQJPLW.DUQHRO5¤PLVFK    -K Q &KU 5LQJJU¤gH PP6FKPDOHQDFKDXgHQNRQYH[HQDFKREHQEUHLWHUZHU GHQGH6FKLHQHPLW6FKXOWHUNQLFN,QGHU3ODWWHHLQJHODVVHQHLQH OÂ&#x201D;QJVRYDOH *HPPH DXV URWHP .DUQHRO PLW 6SHV PLW )©OOKRUQ XQG%OXPH5LQJEHVWRgHQ u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 6LOYHU }QJHUULQJ ZLWK D JHPVWRQH RI UHG FRUQHOLDQ GHSLFWLQJ 6SHV ZLWK FRUQXFRSLDDQG~RZHU5RPDQQGUGFHQWXU\$'5LQJZLWKPLQRUFKLSV

311

182

312 6LOEHUULQJ PLW .DUQHRO*HPPH 5¤PLVFK    -K Q &KU 5LQJJU¤gH6FKPDOHQDFKDXgHQNRQYH[HSUR}OLHUWH6FKLHQH PLW6FKXOWHUNQLFNGLHVLFKQDFKREHQYHUEUHLWHUW$XIGHU3ODWWH HLQJHIDVVWHUOÂ&#x201D;QJVRYDOHU,QWDJOLRDXVYHUEUDQQWHP.DUQHROPLW WKURQHQGHP ,XSLWHU PLW /DQ]H XQG =ZHLJ *HEUDXFKVVSXUHQ *HPPHPLW6SU©QJHQLQWDNW u 3URYHQLHQ]([6DPPOXQJ'U00.DQDGDHU-DKUH 6LOYHU}QJHUULQJZLWKDJHPVWRQHRIUHGFRUQHOLDQGHSLFWLQJHQWKURQHG-XSLWHU ZLWK ODQFH DQG ~RZHU 5RPDQ QG  UG FHQWXU\ $' 7UDFHV RI XVDJH JHPVWRQHZLWKFUDFNV

312


313

314

313 9HUJROGHWHU%URQ]HULQJPLW1LFROR*HPPH5¤PLVFK-K Q&KU5LQJJU¤gH6FKPDOHQDFKDXgHQNRQYH[HSUR}OLHUWH 6FKLHQH GLH VLFK QDFK REHQ YHUEUHLWHUW XQG DXgHQ VHFKVHFNLJ LVW$XIGHU3ODWWHHLQOÂ&#x201D;QJVRYDOHU,QWDJOLRDXV1LFRORPLWDXIGLH .HXOHJHVW©W]WHP+HUNXOHVPLWHLQHP$SIHOLQGHU+DQG*H EUDXFKVVSXUHQ*HPPHPLW6SU©QJHQLQWDNW u

315 (LVHQULQJPLWPÂ&#x201D;QQOLFKHP3RUWUÂ&#x201D;W5¤PLVFK    -K Q &KU 5LQJJU¤gH PP 6FKPDOH QDFK DXgHQ NRQYH[H QDFK REHQ EUHLWHUZHUGHQGH6FKLHQH$XIGHU3ODWWHHLQJHODVVHQHLQHKRFK RYDOH*HPPHDXV/DJHQDFKDWPLWHLQHPPÂ&#x201D;QQOLFKHQEÂ&#x201D;UWLJHP 3RUWUÂ&#x201D;W ]ZLVFKHQ GHQ %XFKVWDEHQ , XQG $ 0LW NRUURGLHUWHQ 6WHOOHQ u

3URYHQLHQ]([6DPPOXQJ'U00.DQDGDHU-DKUH

3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ

*LOGHGEURQ]H}QJHUULQJZLWKDJHPVWRQHRIQLFRORGHSLFWLQJ+HUFXOHVOHDQLQJ RQKLVFOXEZLKDQDSSOHLQWKHULJKWKDQG5RPDQQGUGFHQWXU\$' 7UDFHVRIXVDJHJHPVWRQHZLWKFUDFNV

314 9HUJROGHWHU 0HVVLQJULQJ PLW *ODVVWHLQ ,VODPLVFK    -K 5LQJJU¤gH PP 6FKPDOH ELNRQYH[H 6FKLHQH PLW 6FKXOWHU NQLFN DXI GHU 6FKXOWHU DXI HLQHU SUR}OLHUWHQ (UK¤KXQJ HLQH NHJHOI¤UPLJH )DVVXQJ PLW HLQHP KHOOJU©QHQ OHLFKW JHZ¤OEWHQ *ODVVWHLQDXIGHU6FKXOWHU+DOEPRQGHDXVEODXHU)D\HQFH9HU JROGXQJWHLOVDEJHULHEHQVRQVWLQWDNW u 3URYHQLHQ]([6OJ6.3DULVH[*RUQ\ 0RVFK0©QFKHQ$XNWLRQ -XQL/RV *LOGHGEUDVVULQJZLWKULQJVWRQHPDGHRIOLJKWJUHHQJODVVDQGFUHVFHQWRI EOXH IDLHQFH RQ WKH VKRXOGHU ,VODPLF WK  WK FHQWXU\ *LOGLQJ ZRUQ RWKHUZLVHLQWDFW

315

,URQ }QJHUULQJ ZLWK JHPVWRQH RI OD\HUHG DJDWH GHSLFWLQJ D EHDUGHG PDOH SRUWUDLW5RPDQVWQGFHQWXU\$':LWKFRUURVLRQ

316 (LVHQULQJPLW(EHU©EHU6FKLOG5¤PLVFK-KQ&KU5LQJ JU¤gH PP 6FKPDOH QDFK DXgHQ NRQYH[H QDFK REHQ EUHL WHUZHUGHQGH6FKLHQH,QGHU3ODWWHHLQJHODVVHQHLQHTXHURYDOH *HPPH DXV +RQLJNDUQHRO PLW HLQHP (EHU ©EHU HLQHP NHOWL VFKHQ6FKLOG5LQJNRUURGLHUW u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ ,URQ}QJHUULQJZLWKJHPVWRQHRIFRUQHOLDQGHSLFWLQJDERDUDERYHDFHOWLF VKLHOG5RPDQVWQGFHQWXU\$'5LQJFRUURGHG

316

183


.$0((1*(00(16,(*(/

317

318

319

320

184

321


317 6LOEHUQH5LQJSODWWHPLW(KHSDDU5¤PLVFK(QGH$QIDQJ -KQ&KUkFP5XQGH3ODWWHPLWHLQHUGUDSLHUWHQZHLEOLFKHQ %©VWH UHFKWV XQG HLQHU PÂ&#x201D;QQOLFKHQ 3DQ]HUE©VWH OLQNV GDU©EHU XQGGDUXQWHU,QVFKULIW&21'5,,QWDNW u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 6LOYHU ULQJ EH]HO ZLWK WKH EXVWV RI D FRXSOH DERYH DQG EHORZ LQVFULSWLRQ 5RPDQHQGRIUGHDUO\WKFHQWXU\$',QWDFW

318 6LOEHUQH 5LQJSODWWH PLW ,QVFKULIW GHU /HJLR ,, )ODYLD Römisch, XPQ&KUkFP5XQGH3ODWWHPLWHLQHUPÂ&#x201D;QQOLFKHQ GUDSLHUWHQ 3DQ]HUE©VWH XQG GHU ,QVFKULIW 6(&91'$ )/  /HJLR,,)ODYLD ,QWDNW u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ ,QGHU6SÂ&#x201D;WDQWLNHJDEHVGUHL/HJLRQHV,,)ODYLDH'LH/HJLR,,)ODYLD&RQVWDQ WLDEHVWDQGYRQFDELVLQV-DKUKXQGHUWQ&KUXQGZDULQ&XVDH KHXWH$O4XVL\\D2EHUÂ&#x201D;J\SWHQ VWDWLRQLHUW'LH/HJLR,,)ODYLD&RQVWDQWLQLD QDKDWWHYRQFD"ELVPLQGHVWHQVLQV-DKUKXQGHUWQ&KULKUH6WDQGRUWH LQ,WDOLHQ0DXUHWDQLD7LQJLWDQD 1RUGPDURNNR XQG$IULFDSURFRQVXODULV /LE\HQ 'LH/HJLR,,)ODYLD9LUWXWLVZDUYRQFD"ELVPLQGHVWHQVLQV -DKUKXQGHUWQ&KULQ*DOOLHQXQG$IULFDLP(LQVDW] 6LOYHUULQJEH]HOZLWKDPDOHGUDSHGFXLUDVVHGEXVWDQGWKHLQVFULSWLRQ6(&91 '$)/ /HJLR,,)ODYLD 5RPDQDERXW$',QWDFW

GHU'LRVNXUHQGLH©EHUHLQHDP%RGHQOLHJHQGH)LJXUKLQZHJ UHLWHQDXgHQHLQH6FKODQJHF 9HUVFKLHGHQH*HUÂ&#x201D;WVFKDIWHQXQG 7LHUH 'D]ZLVFKHQ 6WHUQH XQG %XFKVWDEHQ $XI GHU 5©FNVHLWH ,QVFKULIW$:%$:Q)$&$S$0$;$$3,(WZDLQ GHU0LWWHJHEURFKHQ u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ )UDJPHQWRIDJHPVWRQHZLWKP\VWHU\VFHQH2QWKHIURQWVLGHDQHDJOHWKH EXVWRI6HOHQHDQG9LFWRU\&HUHVZLWKSRORVDQGWZRWRUFKHVWKH'LRVFXUHV ULGLQJRQDPDQO\LQJRQWKHJURXQGDVQDNHVHYHUDOVDFUL}FLDOLQVWUXPHQWV DQG DQLPDOV LQ EHWZHHQ OHWWHUV DQG VWDUV 2Q WKH EDFNVLGH *UHHN DQG 5RPDQ OHWWHUV 5RPDQ UG FHQWXU\ $' %URNHQ DSSUR[LPDWHO\ LQ WKH PLGGOH

322 $SROO DXI URWHP -DVSLV 5¤PLVFK    -K Q &KU + FP /Â&#x201D;QJVRYDOH*HPPHPLWJHZ¤OEWHU5©FNVHLWHDXIGHP,QWDJOLR VWHKHQGHU$SROOPLW/\UDGDKLQWHUHLQH6Â&#x201D;XOHPLW/RUEHHU]ZHLJ XQG.UDQ]GDYRUHLQHNOHLQHDXIHLQHP'LSKURVVLW]HQGH)LJXU +RPHU" 6HKUJXWHUKDOWHQ u 3URYHQLHQ]([6DPPOXQJ6.3DULVH[$XNWLRQ7DMDQ3DULV /RV 5HGMDVSHUJHPVWRQHZLWKVWDQGLQJ$SROORZLWKO\UHEHKLQGDFROXPQZLWK ZUHDWK DQG ODXUHO EUDQFK LQ IURQW RI KLP VPDOO VLWWLQJ }JXUH +RPHU"  5RPDQQGUGFHQWXU\$'9HU\ZHOOSUHVHUYHG

319 6LOEHUQH5LQJSODWWHPLW.DLVHU.RQVWDQWLQ,XQG+HOHQDRömisch, XP  Q &KU k FP 5XQGH 3ODWWH PLW GHU GUDSLHUWHQ %©VWHPLW6WUDKOHQYRQ+HOHQDDXI0RQGVLFKHOUHFKWVXQGGHU 3DQ]HUE©VWH PLW 6WUDKOHQNURQH YRQ .RQVWDQWLQ GHP *URgHQ OLQNVGDU©EHUGHU%XFKVWDEHWGDUXQWHUGLH,QVFKULIW+(/(1( ,QWDNW u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 6LOYHUULQJEH]HOZLWKWKHGUDSHGEXVWZLWKUD\VRQDOXQDODRI+HOHQDULJKW DQGDFXLUDVVHGUDGLDWHGEXVWRI&RQVWDQWLQ,DERYHWKHOHWWHUWEHORZWKH LQVFULSWLRQ+(/(1(5RPDQDERXW$',QWDFW

320 6LOEHUQH5LQJSODWWHPLW&KULVWRJUDPP%\]DQWLQLVFK-KQ &KUkFP5XQGH3ODWWHPLW&KL5KR,QWDNW u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 6LOYHUULQJEH]HOZLWKFKULVWRJUDPP%\]DQWLQHWKWKFHQWXU\$',QWDFW

321 )UDJPHQW HLQHU *HPPH PLW 0\VWHULHQV]HQH Römisch, 3. Jh. Q &KU % FP + FP 0RRVDFKDW $XI GHU 9RUGHUVHLWH 'DUVWHOOXQJLQGUHL5HJLVWHUQ YRQREHQQDFKXQWHQ D =HQWUDO HLQ$GOHUOLQNVGDYRQGLH%©VWHYRQ6HOHQHDXIHLQHU0RQGVLFKHO DXgHQHLQH~LHJHQGH9LNWRULDPLW.UDQ]E =HQWUDO&HUHVPLW 3RORVXQG]ZHL)DFNHOQUHFKWVXQGOLQNVYRQLKUMHZHLOVHLQHU

322

185


323 &DPHR PLW *RUJRQHLRQ 5¤PLVFK    -K Q &KU + FP $XV ]ZHLVFKLFKWL JHP/DJHQDFKDW JUDXZHLg 'DUDXIHLQ IURQWDOHV *RUJRQHLRQ PLW .RSI~©JHOQ YRQ 6FKODQJHQ XPJHEHQ 3UDFKWH[HP SODU,QWDNW u Provenienz: Ex Shlomo Moussaieff Collection /RQGRQ    %HL *RUQ\  0RVFK $XNWLRQ/RV 'DV %LOG GHU *RUJR KDWWH HLQH DSRWURSÂ&#x201D;LVFKH )XQNWLRQ XQG }QGHW VLFK GHVKDOE LQ GHQ XQWHU VFKLHGOLFKVWHQ *DWWXQJHQ ZLH ]% DXI :DIIHQ 6DUNRSKDJHQ9DVHQ0¤EHOQ$PXOHWWHQHWF%HL GHU'DUVWHOOXQJGHU*RUJRLVWHLQH(QWZLFNOXQJ VLFKWEDUGLHYRPGÂ&#x201D;PRQLVFKHQ)UDW]HQJHVLFKWPLW KHUDXVKÂ&#x201D;QJHQGHU=XQJHXQG(EHU]Â&#x201D;KQHQLP -KY&KU]XHLQHU$EELOGXQJPLWDEJHPLOGHUWHQ QDW©UOLFKHQ=©JHQRKQH(EHU]Â&#x201D;KQHLP-KKLQ ]X HLQHP PDNHOORV VFK¤QHQ )UDXHQJHVLFKW GDV PDQFKPDOPLW)O©JHOQXQGRGHU6FKODQJHQJH ]HLJWZLUGLPXQG-KJHKW &DPHR PDGH RI WZROD\HUHG DJDWH ZKLWH DQG JUH\LVK GHSLFWLQJDIURQWDO*RUJRQHLRQ5RPDQ QGUGFHQWXU\$',QWDFWGorgeous exem plar!

323

324 $FKDW*HPPH Römisch, 3. Jh. n. Chr. k FP /HLFKW JHZ¤OEWH UXQGH 6FKHL EHPLWYLHU%RKUXQJHQI©U5LHPHQ$XI GHU 2EHUVHLWH HLQH I©QIVWUDKOLJH 5RVHWWH LQ HLQHP 6WULFKNUDQ] %HVWDQGWHLO HLQHV =DXP]HXJV0LQLPDOEHVWRgHQ u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ  /RV  H[ 0©QFKQHU 3ULYDWVDPPOXQJ 06VHLWHU-DKUHQ $JDWH JHPVWRQH ZLWK IRXU KROHV DQG D URVHWWH SDUWRIDEULGOH5RPDQUGFHQWXU\$'6XUIDFH SDUWLDOO\VOLJKWO\ZRUQ

325 &DPHR DXV /DJHQDFKDW PLW $GOHU 5¤PLVFK    -K Q &KU + FP $XV ]ZHLVFKLFKWLJHQ /DJHQDFKDW %UDXQ XQG ZHLg  'DUDXI HLQ VWHKHQGHU $GOHU PLWQDFKUHFKWVJHZDQGWHP.RSIFeine $UEHLW,QWDNW u 3URYHQLHQ]([6OJ(GZDUG-6PLWK1HZ-HUVH\ 86$ (UZRUEHQ LQ GHQ HU RGHU HU -DKUHQ 7ZROD\HUHG DJDWH FDPHR GHSLFWLQJ D VWDQGLQJ HDJOH5RPDQVWQGFHQWXU\$',QWDFWVery }QHSLHFH

324

186

326 &DPHRDXV/DJHQDFKDWRömisch, 2. Jh. n. &KU+FP+RFKRYDOHU~DFKHU6DUG RQ\[&DPHR )UDXHQNRSI QO 6FK¤QHV 3RUWUÂ&#x201D;W,QWDNW u


313

325

3URYHQLHQ] ([ +LUVFK 1DFKIROJHU $XNWLRQ   /RV  LQ NRUURGLHUWHP(LVHQULQJ  &DPHRPDGHRIOD\HUHGDJDWH3RUWUDLWRIDZRPDQORRNLQJOHIW5RPDQQG FHQWXU\%&,QWDFW1LFHSRUWUDLW

327 &DPHR PLW )UDXHQE©VWH 5¤PLVFK (QGH   $QIDQJ  -K Q &KU+FP(OOLSVHQI¤UPLJHU&DPHRDXV/DJHQDFKDWPLWHLQHU VFKZDU]HQXQGHLQHUZHLgHQ6FKLFKW'DUDXIHLQHZHLEOLFKHGUD SLHUWH%©VWH,QWDNW u 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ &DPHRRIOD\HUHGDJDWHGHSLFWLQJDIHPDOHGUDSHGEXVW5RPDQHQGRIQG EHJLQQLQJRIUGFHQWXU\$',QWDFW

328 &DPHR DXV /DJHQDFKDW 5¤PLVFK  -K Y   -K Q &KU + FP+RFKRYDOHU6DUGRQ\[&DPHR0DQQOÂ&#x201D;XIWQOXQGWUÂ&#x201D;JW HLQH=LHJHXQWHUGHP$UP,QWDNW u 3URYHQLHQ] ([ +LUVFK 1DFKIROJHU $XNWLRQ   /RV  LQ NRUURGLHUWHP(LVHQULQJ 

328

327

326

&DPHRPDGHRIOD\HUHGDJDWH0DQZDONLQJOHIWKROGLQJDJRDW5RPDQVW FHQWXU\%&VWFHQWXU\$',QWDFW

329 6NDUDEÂ&#x201D;XVDXV+Â&#x201D;PDWLW1RUGDIULND6SÂ&#x201D;W]HLWELV'\QD VWLH FD u Y &KU / FP 1DWXUDOLVWLVFK JHVWDOWHW PLW 5LIIHO'HNRU DXI GHP 5©FNHQ $XI GHP ,QWDJOLR %XFKVWDEHQ HLQ$QNK=HLFKHQVRZLHHLQHDXIJHULQJHOWH6FKODQJH%HHLQGUXN NHQGHV([HPSODU6HOWHQ(LVHQUHVWHXQWHUGHP.RSIZLQ]LJHV 5DQGIUDJPHQWIHKOW u 3URYHQLHQ]([6DPPOXQJ$7HUZRUEHQLP/RQGRQHU.XQVWPDUNWLQGHQ HU-DKUHQ %HL GHP YRUOLHJHQGHQ 6NDUDEÂ&#x201D;XV KDQGHOW HV VLFK XP HLQ $PXOHWW PLW JQRVWLVFKHU,QVFKULIWDXIGHU6LHJHO~Â&#x201D;FKH'DI©UVSUHFKHQGDV0DWHULDOGLH *HVWDOWXQJGHV6NDUDEÂ&#x201D;XVPLW5LIIHOQVRZLHGLH,QKDOWHGHU6LHJHO~Â&#x201D;FKH,P DOWHQ Â&#x160;J\SWHQ ZXUGH +Â&#x201D;PDWLW ]XU %OXWVWLOOXQJ YHUZHQGHW XQG DOV $PXOHWW PLW LQV *UDE JHJHEHQ 'DV $QNK6\PERO VWHKW I©U GDV :HLWHUOHEHQ LP -HQVHLWV'LH6FKODQJHLVW+HOIHUI©U1HXJHEXUWXQG9HUM©QJXQJGHU7RWHQ 6FKODQJHQJHVWDOWHQZDUHQDXFKDOV%HJOHLWHUGHU7RWHQHLQJHVHW]W +DHPDWLWHVFDUDEGHSLFWLQJOHWWHUVDQDQNKVLJQDVZHOODVDVQDNH8VHGDV JQRVWLFDPXOHW1RUWK$IULFD/DWH3HULRGWKVWG\QDVW\DERXW %&5HPDLQVRILURQXQGHUWKHKHDGWLQ\IUDJPHQWRIWKHHGJHPLVVLQJ Impressive exemplar! Rare!

329

187


308

330

330 =ZHL 6NDUDE”HQ XQG HLQ 6NDUDERLG 0LWWOHUHV 5HLFK  1HXHV 5HLFK    '\QDVWLH FD  Y &KU D  / FP 6WHDWLW *URgHU6NDUDE”XVPLW9HUHLQLJXQJGHUEHLGHQ/”QGHUwE / FP6WHDWLW.OHLQHU6NDUDE”XVPLWOLHJHQGHU.XK6RQQQHQ VFKHLEHXQG1LOSIHUGJ¤WWLQF /FP6WHDWLW.OHLQHU6NDUDER LGIHLQDXVJHDUEHLWHWPLW1LOSIHUGJ¤WWLQ7KRHULVPLW]ZHL$IIHQ 6W©FN,QWDNW u 3URYHQLHQ]([6DPPOXQJLQ+DPEXUJLQGHQHU-DKUHQ 7ZRVFDUDEVDQGRQHVFDUDERLG0LGGOH.LQJGRP1HZ.LQJGRPWK WKG\QDVW\6WHDWLWHD %LJVFDUDEZLWKXQL}FDWLRQRIERWKFRXQWULHVwE  6PDOOVFDUDEZLWKFRZVRODUGLVFDQGKLSSRJRGGHVVF 6PDOOVFDUDERLGZLWK KLSSRJRGGHVVDQGWZRPRQNH\V3 pieces!

331 .OHLQHU6NDUDE”XV0LWWOHUHV5HLFK'\QDVWLHFD Y&KU/FP9LROHWWIDUEHQHU$PHWK\VW,QWDNW u 3URYHQLHQ] ([ HQJOLVFKH 6DPPOXQJ HKHPDOV DPHULNDQLVFKH 6DPPOXQJ *HRUJH0DWKXV 3KLODGHOSKLDHU-DKUH  6PDOOVFDUDE0LGGOH.LQJGRPWKWKG\QDVW\3XUSOHFRORXUHGVFDUDE PDGHRIDPHWK\VW

332 &KDO]HGRQ6LHJHO PLW 7LHUNDPSIV]HQH 0LWWHOPLQRLVFK ,,,  6S”WPLQRLVFK,Y&KU/FP$P\JGDORLGPLW /”QJVERKUXQJ*U©QHU&KDO]HGRQ(LQH=LHJHZLUGYRQHLQHP /¤ZHQDQJHIDOOHQ'HUDUWLJH6LHJHODXVPLQRLVFKHU=HLWVLQGVHKU VHOWHQ,QWDNW u 3URYHQLHQ]([:60©QFKHQGDYRUED\HULVFKH6DPPOXQJHUZRUEHQYRU  $P\JGDORLGFKDOFHGRQ\VHDOZLWKYHUWLFDOGULOOLQJGHSLFWLQJDJRDWDWWDFNHGE\D OLRQ0LGGOH0LQRDQ,,,ODWH0LQRDQ,%&,QWDFW

333 &KDO]HGRQ6LHJHO PLW /¤ZH 6S”WPLQRLVFK RGHU +HOODGLVFK ,% ,,$    Y &KU / FP $P\JGDORLG PLW /”QJV ERKUXQJ6FKUHLWHQGHU/¤ZHQO:LQ]LJH)UDJPHQWHIHKOHQ u

188

331

3URYHQLHQ]([:60©QFKHQGDYRUED\HULVFKH6DPPOXQJHUZRUEHQYRU  $P\JGDORLGFKDOFHGRQ\VHDOZLWKYHUWLFDOGULOOLQJKROHGHSLFWLQJDZDONLQJ OLRQ/DWH0LQRDQRU+HOODGLF,%,,$3HULRGDERXW%&7LQ\ IUDJPHQWVPLVVLQJ

334 &KDO]HGRQ6LHJHOPLW)LVFKHQ0LWWHOPLQRLVFK,,,6S”WPLQRLVFK ,Y&KU/FP$P\JGDORLGPLW/”QJVERKUXQJ 'UHL~LHJHQGH)LVFKH:LQ]LJH)UDJPHQWHIHKOHQ u 3URYHQLHQ]([:60©QFKHQGDYRUED\HULVFKH6DPPOXQJHUZRUEHQYRU  9JO &KULVWLHyV /RQGRQ 7KH (UOHQPH\HU &ROOHFWLRQ RI &UHWDQ VHDOV VDOH /RW $P\JGDORLGFKDOFHGRQ\VHDOZLWKYHUWLFDOGULOOLQJKROHGHSLFWLQJWKUHH~\LQJ }VK0LGGOH0LQRDQ,,,ODWH0LQRDQ,%&7LQ\IUDJPHQWV PLVVLQJ

335 &KDO]HGRQ6LHJHO PLW 3HJDVRV .\NODGLVFK  -K Y &KU / FP $P\JGDORLG PLW /”QJVERKUXQJ ŠVHQGHU 3HJDVRV QO 0LQLPDOEHVWRgHQ u 3URYHQLHQ]([:60©QFKHQGDYRUED\HULVFKH6DPPOXQJHUZRUEHQYRU  9JO&KULVWLHyV1HZ<RUNVDOH/RW $P\JGDORLGFKDOFHGRQ\VHDOZLWKYHUWLFDOGULOOLQJKROHGHSLFWLQJDJUD]LQJ SHJDVRV&\FODGLFWKFHQWXU\%&6XUIDFHVOLJKWO\ZRUQ

336 %HUJNULVWDOO6LHJHO PLW /¤ZH 6S”WPLQRLVFK FD  ELV  Y &KU / FP 6NDUDERLG PLW /”QJVERKUXQJ /¤ZH QOPLW]XU©FNJHZDQGWHP.RSI:LQ]LJH)UDJPHQWHIHKOHQ u 3URYHQLHQ]([:60©QFKHQGDYRUED\HULVFKH6DPPOXQJHUZRUEHQYRU  6FDUDERLGURFNFU\VWDOVHDOZLWKYHUWLFDOGULOOLQJKROHGHSLFWLQJDOLRQ/DWH 0LQRDQDERXW%&7LQ\IUDJPHQWVPLVVLQJ


333

332

334

335

336

189


337

337 6WHPSHOVLHJHO DXV 0DUPRU 6XPHULVFK  -W Y &KU k FP $XV 0DUPRU +DOENXJHOLJ PLW %RKUXQJ XQG UXQGHU 6LHJHO ~Â&#x201D;FKH 'DUDXI GUHL PHQVFKOLFKH )LJXUHQ PLW 7LHUN¤SIHQ HLQ 9LHUEHLQHUVRZLHGUHL9¤JHO0LW$EGUXFN6DPPOHU]HWWHOXQG ,QYHQWDUQXPPHULQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 0DUEOHVWDPSVHDOKHPLVSKHULFDOZLWKGULOOLQJKROHGHSLFWLQJWKUHHKXPDQ OLNH}JXUHVZLWKDQLPDOKHDGVDTXDGUXSHWDQGWKUHHELUGV6XPHULDQUG PLOOHQLXP%&:LWKLPSULQWFROOHFWRUyVQRWHDQGLQYHQWRU\QXPEHULQWDFW

338

338 5ROOVLHJHO DXV JUDXHP .DONVWHLQ 0HVRSRWDPLHQ -HPGHW 1DVU 3HULRGH FD    Y &KU + FP k FP 0LW YHUWLNDOHU%RKUXQJ'LH$EUROOXQJ]HLJWGUHLDXI0DWWHQVLW]HQGH )UDXHQ GLH LKUH $UPH HPSRU JHVWUHFNW KDEHQ GD]ZLVFKHQ MHZHLOV ]ZHL V\PPHWULVFK ©EHUHLQDQGHU OLHJHQGH *HIÂ&#x201D;gH 0LW .XJHOERKUXQJHQKHUJHVWHOOW,QWDNW u 3URYHQLHQ]([6DPPOXQJ(UOHQPH\HU6RWKHE\yV/RQGRQ-XOL/RV 6XPHULDQJUH\OLPHVWRQHF\OLQGHUVHDOLQGULOOKROHWHFKQLTXHGHSLFWLQJWKUHH IHPDOH}JXUHVVHDWHGRQPDWVLQEHWZHHQHDFK}JXUHWZRV\PPHWULFDOSRWV 0HVRSRWDPLD-HPGHW1DVU3HULRGDERXW%&,QWDFW

339

190


339 6DPPOXQJ6NDUDEÂ&#x201D;HQ1RUGDIULND=ZHLWH=ZLVFKHQ]HLWu Y&KUELV6SÂ&#x201D;W]HLWuY&KU/FP6NDUD ERLG 9RUZLHJHQG DXV 6WHDWLW   JU©QHU XQG EODXHU )D\HQFH  JODVLHUWHP6WHDWLW  PLW/Â&#x201D;QJVERKUXQJ$XIGHP,QWDJOLR XQWHUVFKLHGOLFKH'DUVWHOOXQJHQ'DUXQWHUVHFKVPLWGHP7KURQ QDPHQYRQ7KXWPRVLV,,, Y&KU  ,QY  VRZLHHLQHUPLW.¤QLJRKQH.URQHYRUHLQHP2EH OLVNHQ ,QY 6W©FN$OOHPLW$EGUXFN6DPPOHU]HWWHOQ,Q YHQWDUQXPPHUQLQ6FKXEODGHJHRUGQHWXQGJHIDVVWJU¤gWHQWHLOV LQWDNW u

3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ HU -DKUH ELV  JHNDXIW KDXSWVÂ&#x201D;FKOLFKEHL*UXQRZ%HUOLQ &ROOHFWLRQRIVFDUDEVPRVWO\RIVWHDWLWHVRPHRIEOXHJUHHQRUJOD]HGIDLHQFH ZLWKORQJLWXGLQDOGULOOLQJKROHDPRQJWKHPVL[ZLWKWKHQDPHRI7KXWPRVLV ,,, %& DQGRQHZLWKDNLQJLQIURQWRIDQREHOLVN1RUWK $IULFD6HFRQG,QWHUPHGLDWH3HULRGDERXW/DWH3HULRGDERXW %&$OOZLWKLPSULQWFROOHFWRUyVQRWHVLQYHQWRU\QXPEHUDUUDQJHG DQGPRXQWHGLQDGUDZHUPRVWO\LQWDFW28 pieces!

340

340 6DPPOXQJ6NDUDEÂ&#x201D;HQ1RUGDIULND1HXHV5HLFKFD Y&KUELV6SÂ&#x201D;W]HLWY&KU/FP6NDUDERLG 9RUZLHJHQGDXV6WHDWLW  JU©QHUEODXHUXQGEUDXQHU)D\HQFH   JODVLHUWHP 6WHDWLW   9HUPLFXOLW   PLW /Â&#x201D;QJVERKUXQJ $XIGHP,QWDJOLRXQWHUVFKLHGOLFKH'DUVWHOOXQJHQ'DUXQWHUHLQ 6NDUDEÂ&#x201D;XVPLWGHP7KURQQDPHQ6LDPXQV ELVY&KU  GHV  .¤QLJV GHU  '\QDVWLH EHVRQGHUV IHLQ JHDUEHLWHW ,QY ]ZHLPLWGHU.DUWXVFKHYRQ7KXWPRVLV,,,  Y&KU  ,QY 6W©FN$OOHPLW$EGUXFN6DPPOHU]HWWHOQ ,QYHQWDUQXPPHUQLQ6FKXEODGHJHRUGQHWXQGJHIDVVWLQWDNW u

3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ HU -DKUH ELV  JHNDXIW KDXSWVÂ&#x201D;FKOLFKEHL*UXQRZ%HUOLQ &ROOHFWLRQRIVFDUDEVPRVWO\RIVWHDWLWHVRPHRIEOXHJUHHQRUEURZQIDLHQFH RQHRIYHUPLFXOLWHZLWKORQJLWXGLQDOGULOOLQJKROHDPRQJWKHPRQHZLWKWKH FDUWRXFKHRI6LDPXQV %& DQGWZRRI7KXWPRVLV,,,  %& 1RUWK$IULFD1HZ.LQJGRPDERXW/DWH3HULRG DERXW%&$OOZLWKLPSULQWFROOHFWRUyVQRWHVLQYHQWRU\QXPEHU DUUDQJHGDQGPRXQWHGLQDGUDZHULQWDFW28 pieces!

191


341

342

192


343

341 Sammlung Skarabäen. Nordafrika, Neues Reich, ca. 1550â&#x20AC;&#x201C;1070 Y &KU ELV 6SÂ&#x201D;W]HLW u Y &KU / FP 6NDUDERLG Vorwiegend aus Steatit (20), grĂźner und blauer Fayence (5), gla VLHUWHP6WHDWLW  PLW/Â&#x201D;QJVERKUXQJ$XIGHP,QWDJOLRXQWHU VFKLHGOLFKH'DUVWHOOXQJHQ(LQ6WŠFNPLWHLQHP%URQ]HULQJDXV GHU=HLW5DPVHV,, Y&KU  ,QY 26 StĂźck!$OOH PLW$EGUXFN6DPPOHU]HWWHOQ,QYHQWDUQXPPHUQLQ6FKXEODGH geordnet und gefasst, grĂśĂ&#x;tenteils intakt. 2.000,â&#x20AC;&#x201C; Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017, gekauft hauptsächlich bei Grunow, Berlin. Collection of scarabs mostly of steatite, some of blue or green faience, with longitudinal drilling hole. One with a bronze ring. North Africa, New King GRPDERXW/DWH3HULRGDERXW%&$OOZLWKLP print, collectorâ&#x20AC;&#x2DC;s notes, inventory number, arranged and mounted in a drawer, mostly intact. 26 pieces!

342 Sammlung orientalischer Siegel. -WY&KU$XV6WHDWLW  &KDO]HGRQ  %URQ]H  3RUSK\U  XD.RQRLG  KDOE NXJHOLJ  JLHEHOI¤UPLJ  LQ(QWHQIRUP  NHJHOI¤UPLJ   PLWTXDGUDWLVFKHUXQGUXQGHU6LHJHO~Â&#x201D;FKHXQG*ULII MHZHLOV  ELVDXI6WŠFNPLW%RKUXQJRGHUÂ?VHÂ?EHUZLHJHQGPLW'DU VWHOOXQJHQYRQ)DEHOZHVHQXQG7LHUHQZLH]%6WHLQERFN$QWL ORSH:LGGHU*UHLIVRZLHHLQH6]HQHPLW3ULHVWHU17 StĂźck!$OOH PLW$EGUXFN6DPPOHU]HWWHOQ,QYHQWDUQXPPHUQLQ6FKXEODGH geordnet und gefasst, grĂśĂ&#x;tenteils intakt. 2.000,â&#x20AC;&#x201C;

Collection of stamp seals of chalcedony, steatite, bronze and porphyre, conoid, hemispherical, conical, in shape of pediments, in shape of a duck, with square or round sealing surface, with drilling hole or eyelet except one piece, mostly GHSLFWLQJDQLPDOVOLNHDQWHORSHUDPLEH[JULI}QP\WKLFDOFUHDWXUHVDQGVFHQH ZLWKDSULHVW:HVWHUQ$VLDWLFWKPLOOHQLXP%&$OOZLWKLPSULQW collectorâ&#x20AC;&#x2DC;s notes, inventory number, arranged and mounted in a drawer, intact. 17 pieces!

343 Sammlung vorderasiatischer Stempelsiegel. -W-KY&KU $XV 6WHDWLW   +Â&#x201D;PDWLW   /DSLVOD]XOL   $PHWK\VW   XD 6NDUDERLG   NRQRLG   ELNRQLVFK   JLHEHOI¤UPLJ   PLW TXDGUDWLVFKHUXQGUXQGHU6LHJHO~Â&#x201D;FKHXQG*ULII MHZHLOV ELV DXI6WŠFNPLW%RKUXQJRGHUÂ?VHÂ?EHUZLHJHQGPLW'DUVWHO OXQJHQYRQ)DEHOZHVHQXQG7LHUHQZLH]%/¤ZH6WLHU3HUO KXKQ 6WHLQERFN $QWLORSH 'DUXQWHU DXFK HLQ ELNRQLVFKHV *HZLFKW PLW DEJH~DFKWHU 8QWHUVHLWH / FP  DXV +Â&#x201D;PDWLW JHQWVSULFKW6KHNHO DXVGHU=HLW-KY&KU15 StĂźck!$OOHPLW$EGUXFN $XVQDKPH*HZLFKW 6DPPOHU]HWWHOQ ,QYHQWDUQXPPHUQLQ6FKXEODGHJHRUGQHWXQGJHIDVVWJU¤gWHQ teils intakt. 1.200,â&#x20AC;&#x201C; Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017. Collection of stamp seals of steatite, haematite, lapis lazuli and amethyst, scaraboid, conoid, biconical, in shape of pediments, with square and round sealing surface, with drilling hole or eyelet except three pieces, mostly depicting animals like lion, bull, antelope, ibex, guinea fowl and mythical creatures. ,QFOXGLQJDELFRQLFDOKDHPDWLWHZHLJKWRIVKHNHO WKWKFHQWXU\%&  :HVWHUQ$VLDWLFWKPLOOHQLXPWKFHQWXU\%&$OOZLWKLPSULQWFROOHFWRUyV notes, inventory number, arranged and mounted in a drawer, intact. 15 pieces!

Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017.

193


344

344 Sammlung vorderasiatischer Stempelsiegel.  -W   Y &KU $XV%HUJNLUVWDOO  &KDO]HGRQ  6WHDWLW  )ULWWH  3RUSK\U   XD 6NDUDERLG   NRQRLG   S\UDPLGDO   JLHEHOI¤UPLJ  WUDSH]I¤UPLJ  PLWGUHLHFNLJHU6LHJHOIÂ&#x201D;FKHXQG*ULII   PLW TXDGUDWLVFKHU 6LHJHO~Â&#x201D;FKH XQG *ULII   DOOH PLW %RKUXQJ RGHUÂ?VHÂ?EHUZLHJHQGPLW'DUVWHOOXQJHQYRQ)DEHOZHVHQXQG 7LHUHQ ZLH ]% /¤ZH 6WLHU $QWLORSH :LGGHU 6WHLQERFN XQG 6]HQHQPLW.ULHJHUQRGHU3ULHVWHUQ23 StĂźck!$OOHPLW$EGUXFN 6DPPOHU]HWWHOQ,QYHQWDUQXPPHUQLQ6FKXEODGHJHRUGQHWXQG gefasst, grĂśĂ&#x;tenteils intakt. 1.500,â&#x20AC;&#x201C; Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017. Collection of stamp seals of rock crystal, chalcedony, steatite, faience, porphyre, scaraboid, conoid, trapezoidal, in shape of pediments, with triangular or square sealing surface, with drilling hole or eyelet, mostly depicting animals like lion, bull, antelope, ram, ibex, mythical creatures and scenes with warriors or SULHVWV:HVWHUQ$VLDWLFUGPLOOHQLXP%&$OOZLWKLPSULQWFROOHFWRUyV notes, inventory number, arranged and mounted in a drawer, intact. 23 pieces!

345 Sammlung vorderasiatische Stempelsiegel. -W-KY&KU $XV+Â&#x201D;PDWLW  6HUSHQWLQ  &KDO]HGRQ  %URQ]H  EODX HP*ODV  -DVSLV  6WHDWLW  XD6NDUDERLG  LQ)RUP HLQHV 5LQGHUNRSIHV   NHJHOI¤UPLJ   KDOENXJHOLJ   GDFK I¤UPLJ  NXJHOLJ  JORFNHQI¤UPLJ  XDDOOHPLW%RKUXQJ RGHU Â?VH Â?EHUZLHJHQG PLW 'DUVWHOOXQJHQ YRQ )DEHOZHVHQ 7LHUHQ ZLH ]% 6WHLQERFN JH~ŠJHOWHU /¤ZH *UHLI $QWLORSH +LUVFK6NRUSLRQ28 StĂźck!$OOHPLW$EGUXFN6DPPOHU]HWWHOQ ,QYHQWDUQXPPHUQLQ6FKXEODGHJHRUGQHWXQGJHIDVVWJU¤gWHQ teils intakt. 1.400,â&#x20AC;&#x201C; Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017.

194

Collection of stamp seals of haematite, serpentine, chalcedony, bronze, blue JODVVMDVSHUVWHDWLWHVFDUDERLGLQVKDSHRIDEXOOKHDGKHPLVSKHULFDOGLVF shaped, in shape of a bell, conical and so on, with drilling hole or eyelet, PRVWO\GHSLFWLQJDQLPDOVOLNHGHHULEH[DQWHORSHJULI}QVFRUSLRQOLRQDQG P\WKLFDOFUHDWXUHV:HVWHUQ$VLDWLFUGPLOOHQLXPWKFHQWXU\%&$OO with imprint, collectorâ&#x20AC;&#x2DC;s notes, inventory number, arranged and mounted in a drawer, intact. 28 pieces!

346 Sammlung sasanidischer Stempelsiegel.    -K Q &KU $XV $FKDW   +HOLRWURS   +Â&#x201D;PDWLW   &KDO]HGRQ   .DUQHRO  YHUEUDQQWHP.DUQHRO  %URQ]H  +DOENXJHOLJ  PLW UXQGHU6LHJHO~Â&#x201D;FKHkFP(OOLSVRLG  PLWOÂ&#x201D;QJVXQG TXHURYDOHU6LHJHO~Â&#x201D;FKH/FP%FPGDYRQ]ZHLPLW IDFHWWLHUWHU2EHU~Â&#x201D;FKHDOOHPLW%RKUXQJÂ?EHUZLHJHQGPLW'DU VWHOOXQJHQYRQ7LHUHQZLH]%:LGGHU)DONH)LVFK5DEH3IDX +LUVFK $GOHU ]ZHL PLW HLQHU PÂ&#x201D;QQOLFKHQ %ŠVWH XQG HLQV GD YRQPLW3DKODYL,QVFKULIWHQHLQVPLWHLQHUZHLEOLFKHQ)LJXUGUHL PLW *D\RPDUG  HUVWHU PHQVFKOLFKHU :HOWHQKHUUVFKHU LQ GHU persischen Mythologie). 23 StĂźck!$OOHPLW$EGUXFN6DPPOHU ]HWWHOQ ,QYHQWDUQXPPHUQ LQ 6FKXEODGH JHRUGQHW XQG JHIDVVW intakt. 2.200,â&#x20AC;&#x201C; Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017, gekauft KDXSWVÂ&#x201D;FKOLFKEHL*UXQRZ%HUOLQ7HLOH[*RUQ\ 0RVFK$XNWLRQ /RV ,QY  Collection of stamp seals of agate, heliotrope, haematite, chalcedony, cornelian, burnt cornelian and bronze, hemispherical and ellipsoid with drilling hole, WZRZLWKIDFHWHGVXUIDFHPRVWO\GHSLFWLQJDQLPDOVOLNHUDPIDON}VKUDYHQ peacock, deer, eagle, two with a male bust and one of them with pahlavi LQVFULSWLRQ RQH ZLWK IHPDOH }JXUH WKUHH ZLWK JD\RPDUG WKH }UVW UXOHU RIWKHZRUOGLQ6DVDQLDQP\WKRORJ\ 6DVDQLDQWKWKFHQWXU\$'$OO with imprint, collectorâ&#x20AC;&#x2DC;s notes, inventory number, arranged and mounted in a drawer, intact. 23 pieces!


345

346

195


347

347 Sammlung sasanidischer Stempelsiegel.    -K Q &KU $XV $FKDW  +HOLRWURS  *RHWKLW  +Â&#x201D;PDWLW  &KDO]HGRQ   .DUQHRO  %URQ]H  %HUJNULVWDOO  XQG*RHWKLW+Â&#x201D;PDWLW  +DOENXJHOLJ  PLWUXQGHU6LHJHO~Â&#x201D;FKHkFP(OOLS VRLG  PLWOÂ&#x201D;QJVXQGTXHURYDOHU6LHJHO~Â&#x201D;FKH/FP% FPGDYRQHLQVPLWIDFHWWLHUWHU2EHU~Â&#x201D;FKHDOOHPLW%RKUXQJ Â?EHUZLHJHQG PLW 'DUVWHOOXQJHQ YRQ 7LHUHQ ZLH ]% +LUVFK /¤ZH $QWLORSH )DONH =HEX ]ZHL 6WŠFN PLW SHUV¤QOLFKHP (PEOHP QLVDQ  HLQHV PLW HLQHU PÂ&#x201D;QQOLFKHQ %ŠVWH HLQHV PLW HLQHU +DQG 28 StĂźck! $OOH PLW $EGUXFN 6DPPOHU]HWWHOQ ,Q YHQWDUQXPPHUQLQ6FKXEODGHJHRUGQHWXQGJHIDVVWLQWDNW 2.000,â&#x20AC;&#x201C;

196

Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017, gekauft hauptsächlich bei Grunow, Berlin. Collection of stamp seals of agate, heliotrope, goethite, haematite, chalcedony, cornelian, bronze, rock crystal, hemispherical and ellipsoid with drilling hole, one with faceted surface, mostly depicting animals like deer, lion, antelope, falk, cebu, two with personal emblemata, one with a male bust, one with a hand. 6DVDQLDQWKWKFHQWXU\$'$OOZLWKLPSULQWFROOHFWRUyVQRWHVLQYHQWRU\ number, arranged and mounted in a drawer, intact. 28 pieces!


348

348 Sammlung sasanidischer Stempelsiegel.    -K Q &KU $XV $FKDW   +HOLRWURS   +Â&#x201D;PDWLW   &KDO]HGRQ   .DUQHRO   0RRVDFKDW   +DOENXJHOLJ   PLW UXQGHU 6LHJHO~Â&#x201D;FKH kFP(OOLSVRLG  PLWOÂ&#x201D;QJVXQGTXHURYDOHU6LHJHO~Â&#x201D; FKH/FP%FPGDYRQ]ZHLPLWIDFHWWLHUWHU2EHU ~Â&#x201D;FKH DOOH PLW %RKUXQJ Â?EHUZLHJHQG PLW 'DUVWHOOXQJHQ YRQ 7LHUHQZLH]%$QWLORSH+DVH/¤ZH:LGGHU=HEXYLHUPLW HLQHUPÂ&#x201D;QQOLFKHQ%ŠVWHXQG3DKODYL,QVFKULIWHQGUHLPLWHLQHP *RSDWVDK /LHJHQGHV)DEHOWLHU HLQHVPLWHLQHP)DONHQŠEHUHL QHP:LGGHUHLQHVPLWHLQHP3ULHVWHUYRUHLQHP)HXHUDOWDU27 StĂźck! Beiliegend Korrespondenz mit der Universität Wien!$OOH PLW$EGUXFN6DPPOHU]HWWHOQ,QYHQWDUQXPPHUQLQ6FKXEODGH geordnet und gefasst, intakt. 2.200,â&#x20AC;&#x201C;

Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017, gekauft hauptsächlich bei Grunow, Berlin. Collection of stamp seals of agate, heliotrope, haematite, chalcedony, cornelian and moos agate, hemispherical and ellipsoid with drilling hole, two with faceted surface, mostly depicting animals like antelope, rabbit, lion, ram, cebu, four with a male bust and pahlavi inscription, three with a gopatsah, one with a IDONRYHUDUDPDQGRQHZLWKDSULHVWLQIURQWRID}UHDOWDU6DVDQLDQWKWK FHQWXU\$'$OOZLWKLPSULQWFROOHFWRUyVQRWHVLQYHQWRU\QXPEHUDUUDQJHG and mounted in a drawer, intact. 27 pieces! Including the correspondence with the institute of oriental studies of the university of Vienna!

197


*/$6



 Fläschchen aus violettem Glas. VWOLFKHU 0LWWHOPHHUUDXP ,VOD PLVFK-KQ&KU+FP$XEHUJLQHIDUEHQHVGXUFK VFKHLQHQGHV *ODV IRUPJHEODVHQ )ODVFKH PLW KH[DJRQDOHP *UXQGULVVXQGHUKDEHQHQODQJJH]RJHQHQ)O”FKHQDQGHQ6HL WHQEHUGHUVWDUNHLQJH]RJHQHQ6FKXOWHUHLQDEJHVHW]WHUOHLFKW NRQLVFKHU+DOVGHUREHQHLQPDOJHVWDXFKWLVWXQGLQHLQHU7ULFK WHUP©QGXQJHQGHW3DUWLHOOVFK¤QH,ULVLQWDNW u

198

3URYHQLHQ]([6DPPOXQJ6FKORPR0RXVVDLHII/RQGRQ $ SXUSOH LVODPLF PRXOG EORZQ ~DVN ZLWK KH[DJRQDO ERG\ DQG SVHXGR DUFKLWHFWXUDOUDLVHGDUHDVDWWKHVLGHV(DVWHUQ0HGLWHUUDQHDQWKWK FHQWXU\$'FHQWXU\$'6RPHLULGHVFHQFHLQWDFW


350

350 Alabastron in Sandkerntechnik. VWOLFKHU0LWWHOPHHUUDXP -KY&KU+FP$XVEODXHPIDVWRSDNHQ*ODVPLWJHOEHP XQGKHOOEODXHPRSDNHP)DGHQ0LWDEJHUXQGHWHP%RGHQNXU ]HP]\OLQGULVFKHP+DOVXQGYHUO”QJHUWHQVHQKHQNHOQDQGHU 6FKXOWHU(LQJHOEHU)DGHQO”XIWVSLUDOLJYRP+DOVELV]XU0LWWH GHV.¤USHUVZRHUPLWYLHUEODXHQ)”GHQ]XP=LFN]DFNPXVWHU JH]RJHQLVW'DUXQWHUZLHGHUPLWJHOEHP)DGHQGUHLPDOXPZLN NHOW3DUWLHOO9HUZLWWHUXQJ6SUXQJLP.¤USHUVRQVWLQWDNW 3.000,– 3URYHQLHQ] ([ 6DPPOXQJ /RWWPDQQ )UDQNUHLFK HUHU -DKUH ex Besitz S.K., Paris. 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHOL0XVHXP  61U (DVWHUQ0HGLWHUUDQHDQFRUHEDVHGDODEDVWURQRIEOXHWUDQVOXFHQWJODVVZLWK ]LJ]DJJHG\HOORZDQGEOXHWKUHDGDURXQGERG\WKWKFHQWXU\%&3DUWLDOO\ ZHDWKHULQJ}VVXUHLQERG\RWKHUZLVHLQWDFW

351

351 :HLgURWHV$ODEDVWURQVWOLFKHU0LWWHOPHHUUDXP-KY &KU+FP6DQGNHUQWHFKQLN6FKODQNHV6DOEJHI”gDXVRSDNHP ZHLgHP*ODV$XIGHU/LSSHOLHJWHLQEXUJXQGHUURWHU)DGHQDXI 9RP+DOVDXVJHKHQGO”XIWHLQHEHQIDOOVEXUJXQGHUURWHU)DGHQ VSLUDOLJ XP GHQ &RUSXV GHU LP 0LWWHOEHUHLFK ]X HLQHP =LFN =DFN0XVWHU JHN”PPW LVW 'DUXQWHU HLQ ZHLWHUHU XPODXIHQGHU )DGHQ$QGHU6FKXOWHUNOHLQHDXIJHVHW]WHVHQ+HQNHOHUJ”Q]W Ergänzung an der Lippe. 2.500,– 3URYHQLHQ]([6DPPOXQJ6KORPR0RXVVDLHII/RQGRQ =XU7HFKQLNYJO*O”VHUGHU$QWLNH6DPPOXQJ(UZLQ2SSHQO”QGHU   1U60*ROGVWHLQ3UH5RPDQDQG(DUO\5RPDQ*ODVV  $EE  (DVWHUQPHGLWHUUDQHDQFRUHIRUPHGZKLWHJODVVDODEDVWURQZLWKSXUSOHWUDLOLQJ WKWKFHQWXU\%&+DQGOHVDQGSDUWRIWKHULPUHSOHQLVKHG

199


351

352 354 353

352 Blaues Fläschchen. Â?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU+ FP /Â&#x201D;QJOLFKH DSIHOI¤UPLJH )ODVFKH DXV EODXHP .ODUJODV XQWHQPLWHLQHP'RUQPLWODQJHP+DOVXQGQDFKDXgHQDXVJH zogener Lippe. Teil der Lippe wieder angesetzt, sonst intakt. 1.000,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU 9JO<,VUDHOL$QFLHQW*ODVLQWKH,VUDHO0XVHXP  61U (DVWHUQ0HGLWHUUDQHDQEDJVKDSHGERWWOHRIEOXHFOHDUJODVVZLWKGURSVKDSHG EDVHDQGORQJQHFNVWFHQWXU\$'3DUWRIWKHULPUHDWWDFKHGRWKHUZLVH intact.

353 Kleines Fläschchen. �VWOLFKHU 0LWWHOPHHUUDXP  -K Q &KU + FP $XV EODXHP *ODV %DXFKLJHU .¤USHU PLW NOHLQHU 200

6WDQG~Â&#x201D;FKHODQJHP]\OLQGULVFKHQ+DOVXQGHLQJHIDOWHWHU/LSSH .OHLQH'HOOHLP+DOVVRQVWLQWDNW u Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017. Eastern Mediterranean piriform bottle of blue glass with long neck. 1st century $',ULGHVFHQFHLQWDFW

354 'HOOHQ~Â&#x201D;VFKFKHQÂ?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU +FP$XVKHOOHPJUŠQOLFKHP.ODUJODV6FKODQNHUELNRQL VFKHU&RUSXVPLWYLHUYHUWLNDOHQ'HOOHQXQWHUVFKLHGOLFKHU*U¤ gHXQG7LHIHNXU]HP+DOVQDFKDXgHQJHERJHQHP5DQGXQG QDFKLQQHQXPJHE¤UGHOWHU/LSSHWunderschĂśne grĂźn und blau schimmernde Iris!,QWDNW u


356 355

Provenienz: Ex Sammlung S. K., Paris; ex Gorny & Mosch MĂźnchen Auktion /RV Toilet bottle with four vertical indentations of greenish glass. Eastern 0HGLWHUUDQHDQ UGWK FHQWXU\ $' Beautiful iridescence in blue and green! Intact.

355 ZiergefäĂ&#x;. -KQ&KU+FP$XVPDVVLYHPJUŠQOLFKHP .ODUJODV 7RUGLHUWHU OÂ&#x201D;QJOLFKHU OHLFKW JHERJHQHU &RUSXV PLW 6WDQG~Â&#x201D;FKHXQGDXVNUDJHQGHP5DQGPLWXPJHE¤UGHOWHU/LSSH WunderschĂśne goldene Iris!,QWDNW u Provenienz: Ex Sammlung S. K., Paris; ex Gorny & Mosch MĂźnchen Auktion /RV Ornamental vessel of massive greenish glass with wounded body and

RXWVSOD\HG ULP XSSHU SDUW VOLJKWO\ EHQW UGWK FHQWXU\ $' Beautiful golden iridescence! Intact.

356 'RSSHONRSI~DVFKHÂ?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU +FP.OHLQHV*HIÂ&#x201D;gDXVIDUEORVHP*ODVPLWMDQXVI¤UPLJHP *HVLFKWXQGODQJHP]\OLQGULVFKHQ+DOVPLWJHIDOWHWHU/LSSHMit GHP=HUWL}NDWXQG.RSLHGHU5HFKQXQJYRQGHU*DOHULH*ŠQWHU Puhze!3DUWLHOO%HODJLQWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ +*5KHLQODQG3IDO] 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U (DVWHUQ0HGLWHUUDQHDQEORZQGRXEOHKHDG~DVNRIFRORUOHVVJODVVZLWKORQJ QHFNQGUGFHQWXU\$'3DUWLDOO\FRYHULQJLQWDFWAccompanied with DFHUWL}FDWHDQGDFRS\RIDQLQYRLFHIURPWKH*DOOHU\*ŠQWHU3XK]H

201


358

357

357 • Fläschchen mit Gefäßdekor. -KQ&KU+FP$XVJU©QOL FKHP.ODUJODV)RUPJHEODVHQ4XDGHUI¤UPLJHU&RUSXVPLWDE JHUXQGHWHQ.DQWHQXQG]\OLQGULVFKHP+DOVVRZLHQDFKDXgHQ JH]RJHQHP 5DQG $XI GHQ 6HLWHQ DOWHUQLHUHQG .DQWKDURL XQG 2LQRFKRHQ)HLQH5LVVHDP$XVJXVVXQGDP%RGHQDEHUNRP SOHWWXQGQLFKWUHVWDXULHUWVFK¤QH,ULV u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ,VUDHO([SRUWLHUW aus Israel mit der Ausfuhrgenehmigung der israelischen Antikenbehörde. Bei *RUQ\ 0RVFK$XNWLRQ/RVXQG$XNWLRQ Small cuboid bottle of greenish glass with vessel decoration. Mold blown. 1st FHQWXU\$')LVVXUHVDWWUDFWLYHLULGHVFHQFH

358 Gefäß in Vogelform. VWOLFKHU0LWWHOPHHUUDXP-KQ&KU +FP/FP$XVKHOOJU©QHP*ODVPLWYRJHOI¤UPLJHP .¤USHU 'HOOH LP %RGHQ DXVJH]RJHQHU 6FKZDQ] PLW ~DFKHP

UXQGOLFKHP(QGHDQGHQ6HLWHQDXVJH]RJHQH)O©JHOOHLFKWJH GU©FNWHU5©FNHQEUHLWHUNRQLVFKHU+DOVPLW.OHHEODWWP©QGXQJ 6SU©QJHLP+DOVVRQVWLQWDNW u 3URYHQLHQ] ([ $XNWLRQ 0DJQLQ :HGU\ 6HSWHPEHU   /RV  ([ Sammmlung S.K., Paris. 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U (DVWHUQ0HGLWHUUDQHDQELUGVKDSHGYHVVHORIOLJKWJUHHQJODVVZLWKORQJWDLO SXOOHGRXWZLQJVF\OLQGULFDOQHFNDQGWUHIRLOPRXWKVWUGFHQWXU\$' )LVVXUHVLQERG\RWKHUZLVHLQWDFW

 Aryballos. VWOLFKHU0LWWHOPHHUUDXPRGHU,WDOLHQ-KQ &KU + FP $XV KHOOEODXHP .ODUJODV .XJHOI¤UPLJHV *H I”gPLW]\OLQGULVFKHP+DOVJHVWDXFKWHPXQGXPJHVFKODJHQHP 5DQGXQG]ZHL'HO}Qw+HQNHOQ)HLQH,ULVLQWDNW u 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U  (DVWHUQ 0HGLWHUUDQHDQ JOREXODU ~DVN RI OLJKW EOXH JODVV ZLWK VKRUW QHFN OHGJHULPZLWKFROODUDQGGROSKLQwKDQGOHVVWQGFHQWXU\$')LQH iridescence, intact.

360 Topf mit gezwickten Noppen. VWOLFKHU 0LWWHOPHHUUDXP    -K Q &KU + FD FP $XV KHOOEODXHP .ODUJODV %DXFKLJHU .¤USHUPLWEUHLWHUOHLFKWHLQJHWLHIWHU6WDQG~”FKH]\OLQGULVFKHP +DOVXQGHLQJHIDOWHWHU/LSSH5XQGXPGLH0LWWHGHV.¤USHUV YLHU]HKQZDDJHUHFKWJH]ZLFNWH1RSSHQ)HLQH,ULVLQWDNW 400,– Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017. 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U 

202

Eastern Mediterranean globular jar of light blue clear glass with wide F\OLQGULFDOQHFNDQGIRXUWHHQSLQFKHVDURXQGPLGGOHRIERG\WKWKFHQWXU\ $',ULGHVFHQFHLQWDFW


360

361

362

361 Sprinkler. Â?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU+FP .XJHOI¤UPLJHV*HIÂ&#x201D;gDXVJUŠQHP*ODVPLWEUHLWHU6WDQG~Â&#x201D;FKH HLQJHVFKQŠUWHP+DOVPLWZHLWHP$XVJXVVXQGXPJHVFKODJHQHP 5DQG,QQHQLP+DOV9HUHQJXQJ$QGHQ6HLWHQ]ZHLJHNQLFNWH +HQNHO$P.¤USHU6SLUDOULSSHQ9HUZLWWHUXQJXQGVFK¤QH,ULV 7HLOGHU/LSSHXQG+DOVHUJÂ&#x201D;Q]W u 3URYHQLHQ](UZRUEHQEHL%HFNHQEDXHU0ŠQFKHQ([6OJ+-63 +HVVHQ-DKUHH[*RUQ\ 0RVFK$XNWLRQ/RV Globular sprinkler of green glass with tubular rim and spiral ribbs on ERG\(DVWHUQPHGLWHUUDQHDQUGWKFHQWXU\$'3DUWLDOFRYHULQJDQG iridescence, part of the rim and neck restored.

362 Zylindrischer Becher. /HYDQWHXP-KQ&KU+FP$XV JUŠQHP.ODUJODV=\OLQGULVFKHU.¤USHUPLWHLQJHWLHIWHU6WDQG~Â&#x201D; FKHJHUXQGHWHU6FKXOWHUNRQNDYHP+DOVJHVWDXFKWHP.UDJHQ XQG7ULFKWHUPŠQGXQJ6SUŠQJHLP+DOVVRQVWLQWDNW u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[0ŠQFKQHU Privatsammlung 1970er Jahre. /HYDQWLQHF\OLQGULFDOMXJOHWRIJUHHQFOHDUJODVVZLWKURXQGHGVKRXOGHUULGJH RQWKHQHFNDQGIXQQHOPRXWKWKFHQWXU\$'&UDFNVLQQHFNRWKHUZLVH intact.

363 Konische Flasche. Â?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU + FP $XV KHOOEUDXQHP .ODUJODV .RQLVFKHU .¤USHU PLW JHUXQGHWHP%RGHQOHLFKWJHUXQGHWHQ6FKXOWHUQ]\OLQGULVFKHP +DOV XQG QDFK DXgHQ JH]RJHQHU XQG JHIDOWHWHU /LSSH 3DUWLHOO Verwitterung, intakt. 1.600,â&#x20AC;&#x201C;

363

3URYHQLHQ] ([ 6DPPOXQJ /RWWPDQQ )UDQNUHLFK HUHU -DKUH Ex S.K., Paris. Eastern Mediterranean conical bottle of light brown glass without handles. UGWKFHQWXU\$'3DUWLDOO\ZHDWKHULQJLQWDFW

203


365 364

364 *URgH~DFKH)ODVFKH5¤PLVFKRGHU¤VWOLFKHU0LWWHOPHHUUDXP -KQ&KU+FP*ORFNHQI¤UPLJHV*HI”gDXVKHOOJU© QHP*ODVPLWVHKUEUHLWHUOHLFKWJHWLHIWHU6WDQG~”FKHODQJHP ]\OLQGULVFKHQ+DOVGHUVLFKDP.¤USHUYHUM©QJWXQGQDFKDX gHQJH]RJHQHUXQGXPJHIDOWHWHU/LSSH0LW5HVWHQGHVDQWLNHQ ,QKDOWV O" LQWDNW u

365 Große Flasche. VWOLFKHU0LWWHOPHHUUDXP-KQ&KU+ FP$XVIDUEORVHP.ODUJODV.XJHOLJHU.¤USHUPLWEUHLWHU 6WDQG~”FKHODQJHP]\OLQGULVFKHP+DOVOHLFKWJHVWDXFKWHPXQG XPJHVFKODJHQHP5DQG8QWHUGHU/LSSHDXIGHU6FKXOWHUXQG NXU] YRU GHU 6WDQG~”FKH O”XIW MHZHLOV HLQ G©QQHU )DGHQ XP :XQGHUVFK¤QH3HUOHQ,ULVLQWDNW u

Provenienz: Ex Sammmlung S.K., Paris. Aus Pariser Nachlassversteigerung. 9JO':KLWHKRXVH5RPDQ*ODVVLQ7KH&RUQLQJ0XVHXPRI*ODVV,   S. 152 N 258.

3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU

5RPDQRU(DVWHUQ0HGLWHUUDQHDQ&DQGOHVWLFNwERWWOHZLWKZLGH~DWERG\ VWUGFHQWXU\$':LWKDQWLTXHUHPDLQV RLO" LQVLGHLQWDFW

204

Eastern Mediterranean large globular bottle of colorless glass with long neck DQGGHFRUDWLYHWUDLOVUGWKFHQWXU\$'0DUYHOORXVSHDUOLULGHVFHQFH intact.


366 Modiolus. 5¤PLVFK-KQ&KU +FPkFP RKQH+HQ NHO (LQKHQNHOLJHU%HFKHUPLWNR nischer Wandung, unterhalb des nach auĂ&#x;en gewĂślbten Randes ge VWDXFKW$XgHUGHPPLW6WDQGULQJ XQGOHLFKWJHZ¤OEWHP%RGHQ'HU YHUWLNDO SUR}OLHUWH +HQNHO DP XQWHUHQ $QVDW] DXVJH]RJHQ XQG JHULSSW6SUXQJDPXQWHUHQ+HQ kelansatz, aber unrestauriert und ohne Fehlstellen. 2.800,â&#x20AC;&#x201C; Provenienz: Ex Shlomo Moussaieff &ROOHFWLRQ/RQGRQ 9JO ' :KLWHKRXVH 5RPDQ *ODVV LQ WKH&RUQLQJ0XVHXPRI*ODVV   1U  XQG HLQ ([HPSODU DXV GHP +DXV GHV 0HQDQGHU LQ 3RPSHML 6$3 ,QY 5RPDQ PRGLROXV VW FHQWXU\ $' Greenish clear glass, small crack at the handle, unrestored, no missing parts.

366

367 GroĂ&#x;er Becher. Â?VWOLFKHU 0LWWHO PHHUUDXP    -K Q &KU + FP $XV IDUEORVHP .ODUJODV =\OLQGULVFKHU .¤USHU PLW EUHL WHU 6WDQG~Â&#x201D;FKH XQG JHUXQGHWHU /LSSH .RQYH[H 6HLWHQ PLW YLHU JURgHQ 5LSSHQ 8QWHU GHU /LS pe zwei dĂźnne Schliffringe. Wei gH,ULV6SUŠQJHLP8QWHUWHLO 1.200,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ /RWWPDQQ )UDQNUHLFK HUHU -DKUH H[ Sammmlung S.K., Paris. Eastern Mediterranean cylindrical EHDNHUZLWKFRQYH[VLGHVVWUGFHQWXU\ $':KLWHLULGHVFHQFH}VVXUHV

367

205


368 

368 Flasche mit Fadendekor. Â?VWOLFKHU0LWWHOPHHUUDXP-KQ &KU+FP$XVKHOOEODXHP.ODUJODV.XJHOLJHU.¤USHUPLW EUHLWHU6WDQG~Â&#x201D;FKHODQJHP+DOVXQGOHLFKWJHVWDXFKWHU7ULFKWHU PŠQGXQJ(LQGŠQQHU6SLUDOIDGHQOÂ&#x201D;XIWYRP+DOVELV]XP%R GHQXPGHQ.¤USHU'LH)Â&#x201D;GHQDP+DOVSDUWLHOODEJHEURFKHQ sonst intakt. 600,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  61U Eastern Mediterranean globular bottle of light blue clear glass with long neck, WXEXODUULPDQGVSLUDOWUDLOGHFRUDWLRQVWQGFHQWXU\$'3DUWRIWUDLOV on neck missing, otherwise intact.

206

 Flasche. Â?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU+FP $XV IDUEORVHP .ODUJODV .XJHOLJHU .¤USHU PLW NOHLQHU 6WDQG ~Â&#x201D;FKHXQGODQJHPVLFKQDFKXQWHQYHUMŠQJHQGHP+DOV/HLFKW ŠEHUGHU0LWWHGHV+DOVHVHLQ)DGHQULQJ)HLQH,ULVLQWDNW 600,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU Eastern Mediterranean globular bottle of colorless clear glass with long neck WDSHULQJWRZDUGERWWRPDQGDVSLUDOWUDLOGHFRUDWLRQRQLWWKWKFHQWXU\ $')LQHLULGHVFHQFHLQWDFW


370 Flasche mit Fadendekor. Â?VWOLFKHU 0LWWHOPHHUUDXP-KQ&KU+ FP $XV KHOOJUŠQOLFKHP .ODU JODV .XJHOLJHU &RUSXV PLW 'HO OHLP%RGHQ]\OLQGULVFKHP+DOV VLFK QDFK XQWHQ YHUMŠQJHQG XQG gerundeter Lippe. Ein tĂźrkiser Fadenring unter der Lippe. Der .¤USHU LVW PLW GŠQQHQ WŠUNL VHQ)Â&#x201D;GHQLQDFKW%Â&#x201D;QGHUJHWHLOW VHFKV GDYRQ PLW %HPDOXQJ 'LH GUHL XQWHUHQ %Â&#x201D;QGHU VLHEHQPDO DP .¤USHU ]XVDPPHQJH]ZLFNW :LQ]LJHV/RFKLP.¤USHUVFK¤ QH,ULV u 3URYHQLHQ] ([ 6DPPOXQJ /RWWPDQQ )UDQNUHLFK HUHU -DKUH H[ S.K., Paris. (DVWHUQ 0HGLWHUUDQHDQ ~DVN RI OLJKW green glass with globular body and cylindrical neck, thin turquoise trails around body, partially pinched together DWRQHOHYHOWKFHQWXU\$'7LQ\KROH in body, beautiful iridescence. 370

371 Flasche mit Warzen. Â?VWOLFKHU 0LWWHOPHHUUDXP-KQ&KU + FP )ODVFKH DXV KHOOEODX HP .ODUJODV .XJHOLJHU .¤USHU PLW NOHLQHU 6WDQG~Â&#x201D;FKH XQG KR KHU 7ULFKWHUPŠQGXQJ $P .¤U per zwei Reihen von gezwickten :DU]HQ)HLQH,ULVXQG%HODJLQ takt. 600,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ++%D\HUQ vor 1970. Vgl. Y. Israeli, Ancient Glas in the Israel 0XVHXP  61U Eastern Mediterranean bottle of light blue clear glass, globular body with â&#x20AC;&#x161;nipplesâ&#x20AC;&#x2DC; LQWZRURZVUGWKFHQWXU\$')LQH iridescence and covering, intact.

371

207


372

372 Großer Krug. VWOLFKHU 0LWWHOPHHUUDXP    -K Q &KU + FP $XV JU©QOLFKEODXHP .ODUJODV =\OLQGULVFKHU .¤USHU PLWODQJHP+DOVZHLWQDFKDXgHQJH]RJHQHP5DQGXQGPHKU IDFKJHIDOWHWHU/LSSHVRZLHEUHLWHP%DQGKHQNHO(LQYHUWLNDOHU 6SUXQJLP.¤USHUVFK¤QH,ULV u 3URYHQLHQ] ([ 6DPPOXQJ /RWWPDQQ )UDQNUHLFK HUHU -DKUH ex Besitz S.K., Paris. (DVWHUQ 0HGLWHUUDQHDQ ODUJH F\OLQGULFDO MXJ RI OLJKW EOXHJUHHQ JODVV ZLWK ORQJQHFNZLGH~DWULPDQGEURDGVKRXOGHUVWQGFHQWXU\$'$FUDFN in body, beautiful iridescence.

208

373

373 Großer Krug. VWOLFKHU 0LWWHOPHHUUDXP    -K Q &KU + FP $XV KHOOEODXHP .ODUJODV =\OLQGULVFKHU .¤USHU PLW ]\OLQGULVFKHQ+DOVXQGPHKUIDFKJHIDOWHWHUEUHLWHU/LSSHVRZLH EUHLWHPJHULSSWHQ%DQGKHQNHO6FK¤QH,ULVLQWDNW u 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU 9JO<,VUDHOL$QFLHQW*ODVVLQWKH,VUDHO0XVHXP  6I Eastern Mediterranean large cylindrical jug of light blue glass with cylindrical QHFNOHGJHULPZLWKFROODUDQGEURDGULEEHGVKRXOGHUVWQGFHQWXU\$' Beautiful iridescence, intact.


374

374 Feiner Krug. Â?VWOLFKHU 0LWWHOPHHUUDXP    -KQ&KU+FP$XVKHOOEODXHP.ODUJODV $SIHOI¤UPLJHU .¤USHU PLW EUHLWHU 6WDQG~Â&#x201D;FKH %RGHQ LQ GUHL NRQ]HQWULVFKHQ .UHLVHQ JHIRUPW ]\OLQGULVFKHU +DOV VLFK QDFK XQWHQ YHUMŠQJHQG PHKUIDFK JHIDOWHWH XQG QDFK DXgHQ JH]RJHQH EUHLWH /LSSH XQG JHULSSWHU %DQGKHQNHO ]ZHL PDO DQJHVHW]W 'HU .¤USHU LVW YRP %RGHQ ELV ]XU6FKXOWHUJHULSSW3DUWLHOO%HODJIHLQH,ULVDP 5DQGNOHLQHU$EEUXFK u 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU Eastern Mediterranean ribbed jug of light blue glass with cylindrical neck, ledge rim with collar and ribbed shoulder. VWQGFHQWXU\$'3DUWLDOO\FRYHULQJ}QHLULGHVFHQFH minor chipping at the rim.

375 'RSSHONRKO~DVFKH PLW $XIEDX /HYDQWH    -KQ&KU+FP$XVKHOOEODXHP.ODUJODV 8I¤UPLJHU.¤USHUDXV]ZHLODQJHQ5¤KUHQYRQ HLQHP GŠQQHQ )DGHQ LQ DFKW :LQGXQJHQ XP ]RJHQ PLW JHUXQGHWHQ /LSSHQ %RGHQ JHUXQGHW XQG DEJH~DFKW PLW HLQHP DQJHVHW]WHQ .QÂ&#x201D;XHO Zu beiden Seiten zwei dĂźnne Schlaufenhenkel, DXIZHOFKHQGHUGUHLVW¤FNLJH.RUEKHQNHODXVJH wĂślbten dicken Fäden aufsitzt. Der oberste Stock besteht aus einer Schlaufe, die unteren Ebenen DXVMHHLQHP0I¤UPLJHQ(OHPHQW3DUWLHOOOHLFK WHU%HODJSDUWLHOOIHLQH,ULVLQWDNW u

375

3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ EHL+LUVFK1DFKIROJHU$XNWLRQ/RV /HYDQWLQHGRXEOHNRKOWXEHRIOLJKWEOXHJODVVZLWKZRXQG trail around the body and a handle from superimposed WUDLOV WK  WK FHQWXU\ $' 3DUWLDOO\ VOLJKWO\ FRYHUHG SDUWLDOO\}QHLULGHVFHQFHLQWDFW

209


377 â&#x20AC;˘ Islamischer Vielhenkeltopf.  -KQ&KU+FP$XVJUŠQOL FKHP.ODUJODV$XI~DFKHP6WDQ GULQJ $SIHOI¤UPLJHU .¤USHU PLW NDXPJHZ¤OEWHU:DQGXQJGHXW OLFK DEJHVHW]WHU +DOVNHKOH ŠEHU ~DFKHU6FKXOWHUXQGDXVODGHQGHP 5DQG$XIGHU:DQGXQJPHKUH re Reihen dĂźnner Fäden in wel OHQI¤UPLJ JHVFKZXQJHQHQ %¤JHQ sowie fĂźnf ausgezwickte Warzen in einer Reihe. Zwischen diesen XQGŠEHULKQHQ]HKQ+HQNHOFKHQ DXV DXEHUJLQHIDUEHQHQ *ODVIÂ&#x201D;GHQ DQJHEUDFKW$XgHUGHPVFKPD le, fast rechtwinkelig abknickende +HQNHO DXV JUŠQHP XQG DXEHU JLQHIDUEHQHP *ODV ]ZLVFKHQ /LSSH XQG 6FKXOWHU (LQ +HQ kelchen fehlt, ansonsten intakt. 3.500,â&#x20AC;&#x201C; Provenienz: Ex Shlomo Moussaieff &ROOHFWLRQ,VUDHO([SRUWLHUW aus Israel mit der Ausfuhrgenehmigung der israelischen AntikenbehĂśrde. Bei *RUQ\ 0RVFK/RV =XP'HNRUDWLRQVV\VWHPYJO6&DUERQL  ':KLWHKRXVH *ODVV RI WKH 6XOWDQV  61U Islamic multi handled jar. Greenish clear glass with applications of greenish and SXUSOHJODVV)LYHSLQFKHGZDUWVDQGWKLQ applied trail in a wavy pattern at body. Between and over the warts small trail KDQGOHV DQG  KDQGOHV EHWZHHQ ULP DQG VKRXOGHU WK  WK FHQWXU\ $' One small handle lost, otherwise intact.

376

376 Islamisches Fläschchen. Â?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU+FP$XVIDUEORVHP .ODUJODV .RQLVFKHU .¤USHU PLW NOHLQHP UXQGOLFKHP 6WDQGIXg XQG ODQJHP ]\OLQGULVFKHP +DOVGHU]XU6FKXOWHUKLQNRQYH[ŠEHUJHKW9LHU%Â&#x201D;QGHUDXVEODXHPXQGIDUEORVHP*ODVLP XQWHUHQ%HUHLFKXQGYLHUDXVEODXHP*ODVLPREHUHQ%HUHLFKGHV.¤USHUVGLHPHKUIDFKDQ GHQ .¤USHU DQJHVHW]W XQG JH]ZLFNW VLQG ELOGHQ )ŠgH XQG +HQNHO .OHLQHV )UDJPHQW HLQHV FuĂ&#x;es fehlt, partiell verwittert, sonst intakt. 2.000,â&#x20AC;&#x201C; 3URYHQLHQ]([&KULVWLHhV$XNWLRQ/RVH[6DPPPOXQJ6.3DULV ,VODPLFERWWOHRIFRORUOHVVJODVVZLWKHLJKWDWWDFKHGDQGSLQFKHGVWUDSVIRUPLQJIHHWDQGKDQGOHVWKWKFHQWXU\ $'6PDOOIUDJPHQWRIDIRRWPLVVLQJSDUWLDOO\FRYHULQJRWKHUZLVHLQWDFW

210

378 Schale mit Dekor. Â?VWOLFKHU 0LWWHOPHHUUDXPXP-KQ &KU + XP FP k XP FP $XV JHOEOLFK JUŠQHP .ODUJODV PLW HLQHP 6WDQGULQJ EDXFKLJHU :DQGXQJXQGZHLWDXVJH]RJHQHP 5DQG PLW JHIDOWHWHU /LSSH XQG VHFK]HKQHLQJH]ZLFNWHQ3XQNWHQ 8QWHU GHP 5DQG PLW GŠQQHP )DGHQ IŠQIPDO XPZLFNHOW .OHLQHU 6SUXQJ LP 6WDQGIXg SDUWLHOOYHUVLQWHUWVFK¤QH,ULV 2.200,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ /RWWPDQQ )UDQNUHLFK HUHU -DKUH H[ Besitz S.K., Paris. %RZORIJUHHQLVKFOHDUJODVVQGWK FHQWXU\$'7LQ\FUDFNLQIRRWSDUWLDOO\ sintered, nice iridescence.


377

378

211




 5LSSHQVFKDOHVWOLFKHU0LWWHOPHHUUDXP-KQ&KU+FP kFP6WHLOZDQGLJH6FKDOHDXVKHOOEDXHP.ODUJODVPLW]DKOUHL FKHQ IHLQHQ 5LSSHQ IDVW ELV ]XP %RGHQ %RGHQ PLW GUHL NRQ ]HQWULVFKHQ.UHLVHQ6FKPDOHUDEJHVFKOLIIHQHU5DQG,QWDNW 400,–

380 Zwei Alembiks. -KQ&KU+XFP$XVEODXHP .ODUJODV'HVWLOOLHUNROEHQPLWJHUXQGHWHP%RGHQXQGJHUXQGHWHU oder gefalteter Lippe und langer Tülle oder Röhre an einer Seite. 2 Stück! (QGH GHU 5¤KUH DEJHEURFKHQ HLQ 6W©FN PLW NOHLQHU (UJ”Q]XQJSDUWLHOOVWDUNHU%HODJXQGIHLQH,ULV u

3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU 9JO.XQVWPXVHXP/X]HUQ-DKUH*ODVNXQVWYRQGHU$QWLNHELV]XP -XJHQGVWLO  61U

Provenienz: Ex Sammmlung S.K., Paris. Aus Pariser Nachlassauktion.

(DVWHUQ 0HGLWHUUDQHDQ ULEEHG ERZO RI OLJKW EOXH JODVV VW FHQWXU\ $' Intact.

380

212

7ZRLVODPLFDOHPELFVRIEOXHFOHDUJODVVWKWKFHQWXU\$'(QGVRISLSHV XQFRPSOHWHRQHSLHFHZLWKVPDOOUHSDLUSDUWLDOO\FRYHULQJDQG}QHLULGHVHQFH 2 pieces!


125'$)5,.$

381

381 6HOWHQHV0XWWHUPLOFK*HI”g18. Dynastie, Herrschaft des Thut PRVLV,,,ELV$PHQRSKLV,,,Y&KU+ RKQH6R FNHO FP+6RFNHOFP7HUUDNRWWDPLWEUDXQHPEHU]XJ .QLHQGH )UDX PLW HLQHP .OHLQNLQG DXI GHP 6FKRg ,KUH ODQ JHQRIIHQHQ+DDUHIDOOHQLQGHQ1DFNHQ]ZHLGLFNH6WU”KQHQ OLHJHQEHLGHUVHLWVGHU%U©VWHDXIGHPQDFNWHQ2EHUN¤USHUDXI 'LHJURgHQIHLQJOLHGULJHQ+”QGHXPIDVVHQGDV.LQGDP%DXFK XQG OLQNHQ 2EHUVFKHQNHO 'LH PHLVWHUOLFKH $UEHLW LVW DQ GHQ 2EHUDUPHQ VLFKWEDU GLH WHLOZHLVH YRQ GHP ]DUWHQ OHLFKW JH EHXJWHQ.¤USHUDEVWHKHQ'DV.LQGJUHLIWPLWGHPOLQNHQ$UP

]XUUHFKWHQ%UXVWGHU0XWWHUVHLQOLQNHU$UPK”QJWDPUHFK WHQ2EHUVFKHQNHOGHU0XWWHUKHUXQWHU'LH)UDXWU”JWHLQHQKR KHQ DOV $XVJXVV GLHQHQGHQ 3RORV 0LW EHUQDKPHEHVW”WLJXQJ des KHM, Wien und österreichischer Exportlizenz sowie Kopien GHV7/*XWDFKWHQVYRP)HEUXDUGHV=HUWL}NDWVYRQ$UW /RVV5HJLVWHU XQG HLQHU 0XVHXPVEHVFKUHLEXQJ 2EHU~”FKH HW ZDV DEJHULHEHQ +HQNHO DQ GHU 5©FNVHLWH DEJHEURFKHQ .RSI +DOVSDUWLH XQG UHFKWHU )Xg GHV .LQGHV IHKOHQ YRUGHUH 3DUWLH GHV.QLHVPLW:DFKVUHVWDXULHUW u

213


 6FKPLQNSDOHWWHLQ)RUPHLQHU6FKLOGNU¤WH3UÂ&#x201D;G\QDVWLVFK 1DTXDGD ,, XP    Y &KU / FP % FD FP*U©QJUDXHU'ROHULW)ODFKH6FKPLQNSDOHWWHPLW GHQDEVWUDNWJHVWDOWHWHQ8PULVVHQHLQHU6FKLOGNU¤WHGLH $XJHQ DP .RSI JHERKUW XQG YHUPXWOLFK PLW DQGHUV IDUELJHP 6WHLQ HLQJHOHJW =ZHL NDXP VLFKWEDUH VFKPD OH.HUEHQWUHQQHQGHQ.RSIYRP©EULJHQ.¤USHUGLH 8QWHUVHLWHLVWJODWWDPXQWHUHQ5DQGJHORFKW([]HOOHQWH (UKDOWXQJ u Provenienz: Ex Slg. Roland Hartlaub, Spezialauktion Sammlung ägyptischer Kunst u.a.; Auktionshaus Weidler, Iphofen, 20. Juli 2005, Los 3 (Teil). Für ähnliche Objekte siehe: W.M. Flinders Petrie, Prehistoric Egypt, Corpus of Prehistoric Pottery and Palettes (1920) Taf. LII,14H. An Egyptian greywacke cosmetic palette, in the form of a freshwater WXUWOHZLWKFLUFXODUERG\VPDOOSRLQWHG~LSSHUVDQGSURMHFWLQJKHDG with drilled circular eyes, pierced at the back. Predynastic Period, 1DTDGD,,FD%&Excellent condition!

383 6FKPLQNSDOHWWH 3UÂ&#x201D;G\QDVWLVFKH =HLW FD  Y &KU / FP 6LOWVWHLQ 5KRPERLG JHIRUPWHV ~DFKHV 6WHLQREMHNWDQEHLGHQ6HLWHQLQGHU0LWWHHLQH0XOGH XP $XJHQVFKPLQNH DQ]XUHLEHQ (LQLJH %HVWRgXQJHQ DQHLQHP(QGHNOHLQHU$EEUXFKGDULQDOWH6DPPOXQJV 1UPLW7LQWHQRWLHUW0XOGHDXIHLQHU6HLWHPLWVWDUNHQ *HEUDXFKVVSXUHQ u 381

3URYHQLHQ] 6DQJLRUJL 6DPPOXQJ 3DOD]]R %RUJKHVH 5RP ELV  $XV GLHVHU Sammlung von Russell Roberts im selben Jahr erworben und seitdem im Familienbesitz. Ausgestellt als Dauerleihgabe im Kunsthistorischen Museum Wien vom 1. September ELV]XP-DQXDU $XFKZHQQGLH7/$QDO\VHDXIHLQHQ%UHQQ]HLWSXQNWLQSWROHPÂ&#x201D;LVFKH=HLWZHLVWLVW davon auszugehen, dass die allgemeine, mit diesem Objekt vorgeschlagene Datierung LQGLH'\QDVWLHGDV5LFKWLJHWULIIWGHQQVÂ&#x201D;PWOLFKHDQGHUHYRQ(%UXQQHU7UDXW vorgestellten Vergleichsstücke stammen aus dem Neuen Reich. Die Frühdatierung wurde auch von Professor Dietrich Wildung befürwortet. Möglicherweise überstand GDV*HIÂ&#x201D;gHLQHQVSÂ&#x201D;WHUHQ=ZHLWEUDQGLQSWROHPÂ&#x201D;LVFKHU=HLW 'LH JHQDXH 9HUZHQGXQJ GHU VRJ 0XWWHUPLOFK*HIÂ&#x201D;gH LVW LQ GHU )RUVFKXQJ QRFK XPVWULWWHQ'DKLHUHLQH0XWWHURGHU$PPHPLW.LQGGDUJHVWHOOWLVWXQGGDV*HIÂ&#x201D;g ungefähr die Menge Milch aufnehmen kann, die eine Mutterbrust während eines QRUPDOHQ 6WLOOYRUJDQJV DEJLEW LVW GLH 9HUZHQGXQJ DOV 0XWWHUPLOFK)OÂ&#x201D;VFKFKHQ QDKHOLHJHQG *HPHLQVDP LVW GLHVHU $UW *HIÂ&#x201D;gFKHQ GDVV VLH GLH 0LOFK HLQHU )UDX HQWKDOWHQVROOWHQGLHHLQPÂ&#x201D;QQOLFKHV.LQGJHERUHQKDWWH9JOGD]X(%UXQQHU7UDXW 'DV 0XWWHUPLOFKNU©JOHLQ LQ :G2 9   Â&#x160;J\SWHQV $XIVWLHJ ]XU :HOWPDFKW .DWDORJGHU$XVVWHOOXQJLP5RHPHUXQG3HOL]DHXV0XVHXP+LOGHVKHLP0DLQ] 61U (J\SWLDQ&HUDPLF0RWKHUyVPLON~DVNRIPRVWEHDXWLIXODQGDHVWKHWLFTXDOLW\7KH statuette as a whole is an exquisite masterpiece, detailed and gentil in expression. Cylindrical handle on the back broken off, front part of the knee carefully restored with wax. Hands and legs of the child are missing. Although the test results showed D GDWLQJ DERXW  %& WKH FRPPRQ GDWLQJ RI WKLV }JXUH HJ3URIHVVRU :LOGXQJ IRUPHUFXUDWRURIWKH%HUOLQ0XVHXP LVEHWZHHQ%&:LWKWDNHRYHU FRQ}UPDWLRQRIWKH.+09LHQQDDQG$XVWULDQH[SRUWOLFHQFHSOXVFRSLHVRID 7/DQDO\VLVGDWHGQG)HEUXDU\DFHUWL}FDWHIURP7KH$UW/RVV5HJLVWHUDQG DGHVFULSWLRQRIWKH0XVHXP

214

3URYHQLHQ]6HLWGHQHU-DKUHQLQED\HULVFKHP%HVLW])$ München. Siehe dazu zwei vergleichbare Stücke im Ã&#x201E;gyptischen Museum %HUOLQ .DWDORJ1U  ,QY1U   XQG LP 3HOL]DHXV 0XVHXP+LOGHVKHLP,QY1U 5KRPERLGDOSDOHWWHPDGHIURPVLOWVWRQH2QHDFKVLGHDWURXJK VKDSHGGHSUHVVLRQWRSUHSDUHH\HPDNHXSRQHZLWKWUDFHVRIXVLQJ Minor bruises, one top only slightly damaged with old collection QXPEHUDSSOLHGZLWKLQN3UHG\QDVWLFSHULRGFD%&

384 5LWXDOPHVVHU DXV )HXHUVWHLQ 3UÂ&#x201D;G\QDVWLVFK 1DTXDGD .XOWXU ,,F,,,D XP    Y &KU / FP +HOO ELV GXQNHOEUDXQHU )HXHUVWHLQ =ZHL 7HLOH YRQ 0HVVHUNOLQJHQPLWFDPPEUHLWHQJOHLFKPÂ&#x201D;gLJHQ$E VFKODJ~Â&#x201D;FKHQ  u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV H[*UXQRZ/LVWH$EE Die Stücke waren in der Sammlung zu einem Objekt zusammengefügt, stammen aber ursprünglich von zwei verschiedenen Messern. Aus Feuerstein hergestellte Messer dieser Art wurden wahrscheinlich EHLULWXHOOHQ2SIHUQYHUZDQGW6LHZXUGHQLQ*UÂ&#x201D;EHUQGHU1HJDGH Epoche gefunden, teilweise rituell zerbrochen, wie auch die vorliegenden Stücke. Zu Messern dieses Typs vgl. Afrika. Die Kunst HLQHV.RQWLQHQWV$XVVWHOOXQJ%HUOLQ  1UDE 7ZRSDUWVIURPULWXDONQLYHVZLWKGRXEOHEODGHIURPWKH1HJDGH &XOWXUH/LJKWEURZQ~LQW7KHWZRSDUWVRULJLQDOO\QRWEHORQJLQJ %&




383

384

215




 6DPPOXQJ YRQ VLHEHQ 0LQLDWXUJHI”gHQ D  + FP k FP 'LRULW .OHLQHV JHGUXQJHQHV *HI”g DXV SROLHUWHP 6WHLQ %RKU ULOOHQLQQHQVLFKWEDU$OWHV5HLFK'\QDVWLHFD Y&KU,QWDNWE +FPkFP.DO]LW.OHLQHVEDXFKLJHV 6DOEJHI”g$OWHV5HLFK'\QDVWLHXPY&KU,QWDNWF  +FP.DO]LW.OHLQHV6FKPLQNJHI”gLQ%HFKHUIRUP0LWWOH UHV5HLFK'\QDVWLHFDY&KU,QWDNWG + FP .DO]LW .OHLQHV EDXFKLJHV 6DOEJHI”g LQ 9DVHQIRUP PLW DEJHVHW]WHP5DQG0LWWOHUHV5HLFKXPY&KU,QWDNWH  +FP'XQNHOJUDXHU7RQ.OHLQHU.UXJPLWEDXFKLJHP.¤U SHUXQGVFKODQNHP+DOV'HU'HNRUEHVWHKWDXVZHLgJHI©OOWHQ 6WULFKRGHU3XQNWPXVWHUQ=ZLVFKHQ]HLW +\NVRVw XP Y&KUI +FPkFP)D\HQFHKHOOEODXH*ODVXU.OHLQHU 1DSII©UNRVPHWLVFKHRGHUNXOWLVFKH=ZHFNH1HXHV5HLFK '\QDVWLH XP  Y &KU 2EHU~”FKH HWZDV YHUVLQWHUW VRQVW LQWDNWJ +FP.DO]LW.OHLQHV$ODEDVWURQPLW1RSSHQKHQ NHOQ 6S”W]HLW FD    Y &KU 5DQG REHQ DEJHEURFKHQ 6W©FN u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV Nice collection of seven miniature vessels from different periods: a) Squat VKRXOGHUHGMDUPDGHIURP'LRULWH,QWDFW2OG.LQJGRPUGG\QDVW\FD %&E %HOO\VKDSHGDODEDVWHUPDNHXSYHVVHO,QWDFW2OG.LQJGRP WKG\QDVW\DERXW%&F 0DNHXSYHVVHOLQIRUPRIDIRRWHGEHDNHU ,QWDFW0LGGOH.LQJGRPWKWKG\QDVW\FD%&G 2YRLG VKDSHG DODEDVWHU PDNHXS YHVVHO ZLWK ~DW ULP ,QWDFW 0LGGOH .LQJGRP DERXW%&H 6PDOOFOD\MXJZLWKRQHKDQGOHFRQLFDOO\EXOJLQJIRUP DQGVOHQGHUVKDQN,QWDFWQG,QWHUPHGLDWH3HULRG +\NVRV" DERXW %&I 6PDOOIDLHQFHGLVKOLJKWEOXHJOD]HVOLJKWO\VLQWHUHG1HZ.LQJGRP WKG\QDVW\DERXW%&J $ODEDVWHUDODEDVWURQ8SSHUSDUWPLVVLQJ RWKHUZLVHLQWDFW/DWH3HULRG%&SLHFHV

386 .OHLQHV *HI”g I©U $XJHQVFKPLQNH 0LWWOHUHV 5HLFK IU©KH  '\QDVWLH XP  Y &KU + FP *U©QHU $FKDW %DXFKL JHVNOHLQHV6FKPLQNJHI”gPLWJODWWHP%RGHQXQG~DFKHP5DQG YHUPXWOLFK]XU$X~DJHHLQHV'HFNHOV ,QWDNW u 3URYHQLHQ] ([ &ROOHFWLRQ 'U -RKQ :LQQLH 6W 0DU\yV *HRUJLD 86$ HUZRUEHQLQGHQHU-DKUHQ Small vessel for eye makeup made from green agate. Early Middle Kingdom, DERXW%&,QWDFW

387 .OHLQHV 6DOEJHI”g 1HXHV 5HLFK  '\QDVWLH =HLW 7KXWPRVLV ,,,FDY&KU+FDFP2Q\[0DUPRU.XJH OLJHV *HI”g PLW UXQGHP %RGHQ DEJHVHW]WHP +DOV XQG HLQHP EUHLWHQ5DQG]XU$X~DJHHLQHV'HFNHOV,QWDNW u 3URYHQLHQ]([&ROOHFWLRQ-&ODHVVHQ+ROODQGYRU Small spherical vessel made from onyx stone with round bottom and broad rim WRSODFHDOLG,QWDFW1HZ.LQJGRPWLPHRI7KXWPRVH,,,FD%&

388 +¤O]HUQHV 6FKPLQNJHI”g LQ )RUP GUHLHU JHE©QGHOWHU 6”XOHQ 1HXHV 5HLFK IU©KH  '\QDVWLH XP  Y &KU + FP (EHQKRO] 'DV *HI”g ]HLJW GLH )RUP GUHLHU VLFK QDFK REHQ YHUM©QJHQGHU 6”XOHQ PLW /RWXVEO”WWHU .DSLWHOOHQ GLH YRQ HL QHP PHKUIDFK JHULHIHOWHQ %DQG ]XVDPPHQJHKDOWHQ ZHUGHQ $OOH GUHL 6”XOHQ VLQG YHUWLNDO GXUFKERKUW XP GLH GD]XJHK¤UL JHQ6FKPLQNJULIIHODXI]XQHKPHQ.OHLQHV/RFKVRQVWLQWDNW u 3URYHQLHQ]([&ROOHFWLRQ:+'DYLHV3HQQV\OYDQLD86$HUZRUEHQYRQ  Wood khol tube in the form of three bundled pillars with lotus capitals. Small KROHRWKHUZLVHLQWDFW(DUO\1HZ.LQJGRPDERXW%&

216


386

387

388

217


389 6HW YRQ GUHL 6FKPLQNJHI”gHQ 1HXHV 5HLFK  '\QDVWLH  -K Y &KU D  k FP $ODEDVWHU .OHLQH ~DFKH 6FKDOHPLW]ZHL1RSSHQKHQNHOQ]XP $QUHLEHQ YRQ 6FKPLQNH ,QWDNW E  H 3cm. Alabaster. Kleines konisches 6DOEJHI”g PLW DEJHVHW]WHP 5DQG 2EHU~”FKH HWZDV DEJHULHEHQ DP 5DQGZLQ]LJH$XVEU©FKHF /FP k FP $ODEDVWHU 6FKHLQVSLHJHO Intakt. 6W©FN u

389

3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ HUZRUEHQHU-DKUHELV 'D GHU 6SLHJHO ZHJHQ VHLQHU *U¤gH XQG seines Materials nicht funktionsfähig ist, KDQGHOWHVVLFKEHLGLHVHQGUHL*HJHQVW”QGHQ K¤FKVWZDKUVFKHLQOLFKXP*UDEEHLJDEHQ Three alabaster burial objects from the New Kingdom. a) Small shallow bowl for preparing H\HPDNH XS ,QWDFW E  0LQLDWXUH FRQLFDO YHVVHOPDNHXSYHVVHO7LQ\FKLSVRWKHUZLVH LQWDFWF )DOVHPLUURU,QWDFWWKG\QDVW\ WKFHQWXU\%&SLHFHV

 .RSWLVFKHU/¤IIHO/FP/¤IIHODXV $ODEDVWHU PLW NUHLVI¤UPLJHQ 2UQD PHQWHQDXIGHP*ULII,QWDNW u 3URYHQLHQ]([6.3DULVH[$XNWLRQ%RLV JLUDUG/RV 1DFKODVVYHUVWHL gerung). Coptic spoon made of alabaster and with circular ornaments on the handle. Intact. 

391

218

391 .DQRSHQGHFNHOGHV+DSL'ULWWH =ZL VFKHQ]HLWXPY&KUkFP $ODEDVWHU .DQRSHQ'HFNHO PLW GHP DXVJHDUEHLWHWHQ 3DYLDQNRSI GHV +DSL GHU GLH /XQJH GHV 9HUVWRUEH QHQ VFK©W]HQ VROO 'D GLH 8QWHUVHLWH HLQHUXQGH$XVK¤KOXQJI©UHLQHQ(LQ VDW]=DSIHQ DXIZHLVW N¤QQWH HV VLFK XP HLQH 6FKHLQ.DQRSHw KDQGHOQ 6ROFKH6FKHLQ.DQRSHQJDEHVRIWLQ GHU(SRFKHXPY&KUDOVPDQ EHL 0XPLHQ YRQ 3ULYDWOHXWHQ K”X}J GLH (LQJHZHLGH HQWZHGHU LP .¤USHU EHOLHgRGHUQDFK0XPL}]LHUXQJXQG (LQZLFNOXQJ LQ GLH .¤USHUK¤KOH ]X U©FNOHJWH7URW]GHPJDEPDQGHQ7R WHQ .DQRSHQ LQ GLH *U”EHU PLW GLH WHLOV PDVVLY ZDUHQ RGHU PLW :DFKV JHI©OOW'LHVH6LWWHZXUGHVS”WHUZLH GHU DXIJHJHEHQ 8QWHUHU 5DQG PLW NOHLQHQ%HVFK”GLJXQJHQVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ )7 %DGHQ Württemberg. Erworben 2002 ex Sammlung :ROWHU %UDXQVFKZHLJ GRUW DOWHV )DPLOLHQ erbstück.


Alabaster canopic lid in the form of a baboonâ&#x20AC;&#x2DC;s KHDG UHSUHVHQWLQJ WKH *RG +DSL ZKR protected the lungs of the dead. A drafthole at the underside suggests that this lid might have been part of a dummy jar. This practise is known during the Third Intermediate Period DERXW%&6RPHPLQRUGDPDJHVDWULP otherwise intact.

 .DQRSHQGHFNHO6SÂ&#x201D;W]HLWFD Y &KU + FD FP .DONVWHLQ DQ GHU 8QWHUVHLWH ~DFKHU UXQGHU (LQ ODVV]DSIHQ .DQRSHQYHUVFKOXVV GHV IDONHQN¤S}JHQ .HEHFKVHQXHI HLQHU GHUYLHU+RUXVV¤KQHGLHGLHEHLGHU 0XPL}]LHUXQJ HQWQRPPHQHQ XQG LQ .U©JHQ DXIEHZDKUWHQ (LQJHZHLGH GHV9HUVWRUEHQHQVFK©W]WHQ.HEHFK VHQXHIZDUI©UGHQ6FKXW]GHU*HGÂ&#x201D;U PH]XVWÂ&#x201D;QGLJ.OHLQHU$EVFKODJOLQNV KLQWHQVRQVWLQWDNW u



Provenienz: Ex Nachlass Karin Korte, %D\HUQGDYRU)DPLOLHQEHVLW]LQ'HXWVFKODQG seit den 1920er Jahren. Limestone canopic head in the form of the IDOFRQKHDGHG 4XHEHVHQXHI VRQ RI +RUXV %UXLVHOHIWRWKHUZLVHLQWDFW/DWH3HULRGFD %&

393 /RWXV 6NDUDEÂ&#x201D;XV 5LQJ 1HXHV 5HLFK '\QDVWLHFDY&KU k FP *URgHU 6NDUDEÂ&#x201D;XV 5LQJ DXV EODXJODVLHUWHU)D\HQFHSehr selten in GLHVHU4XDOLWÂ&#x201D;W6HKUJXWHUKDOWHQ u Provenienz: Ex amerikanische Sammlung /RXLVYLOOH&RORUDGR YRU  Vgl. Petrie Museum London, Inv.nr. 8&:DOWHUV$UW0XVHXP%DOWLPRUH ,QYQU  $UFKÂ&#x201D;RORJLVFKHV 1DWLRQDO PXVHXP1HDSHO,QYQU

393

%LJ ORWXV VFDUDE ULQJ PDGH RI EOXH IDLHQFH 1HZ.LQJGRPWKG\QDVW\9HU\UDUH

394 %URQ]HULQJ PLW 6NDUDEÂ&#x201D;XV  =ZL VFKHQ]HLWFDY&KU+ FP%URQ]HXQG6WHDWLW'LH%DVLV GHV 6NDUDEÂ&#x201D;XV ]HLJW GUHL 5HLKHQ PLW V\PPHWULVFK DQJHRUGQHWHQ 6\PER OHQ,QWDNW u Provenienz: Ex englische Sammlung T. West 6XVVH[ YRU  Vgl. Percy E. Newberry, Egyptian Scarabs, Tafel X, Nr. 29. Skarabäen und andere 6LHJHODPXOHWWH DXV %DVOHU 6DPPOXQJHQ 6 1U %URQ]H ULQJ ZLWK VFDUDE QG LQWHUPHGLDWH 3HULRG%URQ]HDQGVWHDWLWH7KHEDVHRIWKH scarab shows three rows of symbols. Intact.

394

219


 396

 *O”VHUQHU 2KUVW¤SVHO 1RUGDIULND    -W Y &KU + FP /”QJOLFKHV2EMHNWDXVZHLgHP*ODVXQGVSLUDOI¤UPLJHQEODXHQ /LQLHQPLWWULFKWHU”KQOLFKHP(QGH,QWDNW u

397 0XPLHQDXJH6S”W]HLW-KY&KU/FP%URQ]H)UDJ PHQWHLQHV$XJHVLQ%URQ]HJHIDVVWPLW3XSLOOHDXV7RQ  u

Provenienz: Ex S.K., Paris, ex Sammlung Lottmann, Frankreich, HUHU-DKUH

3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ    'DYRU6DPPOXQJ:LQWHU6HLWYRU

6PDOOJODVHDUSOXJ1RUWKHUQ$IULFDQGVWPLOOHQQLXP%&2EORQJREMHFW made of white glass with blue helical lines. Intact.

Mummy eye made of bronze with pupil made of clay.

396 $PXOHWWHLQHU.RSIVW©W]H6S”W]HLW'\QDVWLHFLUFD Y&KU+FDFP'XQNOHU6WHLQ.OHLQHV0RGHOOHLQHU .RSIVW©W]H GDV GHP 9HUVWRUEHQHQ PLWJHJHEHQ ZXUGH 'DV $PXOHWW VROOWH GHQ 7RWHQ DXIULFKWHQ XQG GDYRU VFK©W]HQ GDVV LKPGHU.RSIJHQRPPHQZXUGH,QWDNW u

398 .OHLQHV6DOEJHI”gPLW'HFNHO1HXHV5HLFK'\QDVWLH FDY&KU+FP)D\HQFHPLW5HVWHQYRQEODVV EODXHU*ODVXU.OHLQHV*HI”gLQ)RUPHLQHV(LHUEHFKHUVwPLW YHUWLNDOHU+LHURJO\SKHQ,QVFKULIWPGWw PHGMHW 6DOEH *OD VXUZHLWJHKHQGDEJHULHEHQVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV

3URYHQLHQ]'HXWVFKH6DPPOXQJ.0©QFKHQYRU 6WRQHDPXOHWRIDKHDGUHVW/DWH3HULRGWKWKG\QDVW\FD%&

397

220

0LQLDWXUHHJJFXSVKDSHGOLGHGYRWLYHYHVVHO)DLHQFH*OD]HPRVWO\ZRUQRII RWKHUZLVHLQYHU\JRRGFRQGLWLRQ1HZ.LQJGRPWKWKG\QDVW\ %&

398


399

399 6DPPOXQJ YRQ VLHEHQ 9RWLYEH FKHUQ 0LWWOHUHV  1HXHV 5HLFK FDY&KU+FP  FP .OHLQH 9RWLYJHIÂ&#x201D;gH IŠU Â?OVSHQGHQLQ.HOFK)RUPWŠUNLV ELV FUHPHIDUEHQ JODVLHUW -HGHV *HIÂ&#x201D;g LVW EHVFKULHEHQ HQWZHGHU HLQJUDYLHUW RGHU PLW VFKZDU]HU )DUEH DXIJHPDOW ]XP JU¤gWHQ 7HLO NDXP QRFK OHVEDUH .¤QLJV NDUWXVFKHQ(LJHQQDPHQXQG%H ]HLFKQXQJHQYRQ KHLOLJHQÂ?OHQw  6WŠFN *ODVXU EHL DOOHQ ZHLWJH KHQGDEJHULHEHQVRQVWLQWDNW u Provenienz: Ex Collection Trekey, Frank UHLFKHU-DKUHH[*RUQ\ 0RVFK 0ŠQFKHQ$XNWLRQ/RV Seven glazed composition votive cups. The goblets with glazes ranging from turquoise to cream in colour, each cup with either incised or black glazed inscrip tion, mostly unintelligible, naming Kings, private names or â&#x20AC;&#x17E;sacred oilsâ&#x20AC;&#x153;. Middle .LQJGRP  1HZ .LQJGRP FD   %&SLHFHV

 6WDWXHWWHGHV6RQQHQJRWWHV5H+D UDFKWH6SÂ&#x201D;W]HLW'\QDVWLH FLUFD    Y &KU + FP %URQ]H6RQQHQJRWW5H+DUDFKWH GDUJHVWHOOW DOV )DONH PLW 6RQQHQ scheibe. +HUYRUUDJHQGH 4XDOLWÂ&#x201D;W 6HKUVHOWHQ0LW5HFKQXQJVNRSLH 9¤OOLJLQWDNW u



3URYHQLHQ]([,$'$$0LWJOLHG*ŠQWHU 3XK]HH[EHOJLVFKH6DPPOXQJ*% YRU   %URQ]H }JXULQH RI WKH VXQ JRG 5H+D rachte as falcon with solar disc. Late Pe ULRGWKWKG\QDVW\FD %&([FHOOHQWTXDOLW\:LWKFRS\RIWKH invoice!

221






 6WDWXHWWHGHU,VLV6S”W]HLWFDY&KU+ RKQH6RFNHO  FP %URQ]HYROOJXVV 7KURQHQGH ,VLV PLW +DWKRUNURQH DXI GHP6FKRgGHQ+RUXVNQDEHQKDOWHQGGHPVLHGLHOLQNH%UXVW JLEW$XI6RFNHOPRQWLHUWLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV %URQ]HVWDWXHWWHRIVHDWHG,VLVVXFNOLQJ+RUXV:LWKKHUULJKWKDQGWKHJRGGHVV supports her left breast, but the child at her lap is not turned towards her but IDFHVVWUDLJKWDKHDG2QZRRGHQEDVHLQWDFW/DWH3HULRGFD%&

 6WDWXHWWHGHV&KRQV1HXHV5HLFK'\QDVWLHFD   Y &KU + RKQH 6RFNHO  FP .OHLQH 6WDWXHWWH GHV 0RQGJRWWHV&KRQVGHUDOV0XPLHPLW.UXPPVWDE*HLgHOXQG :DDV=HSWHUVRZLHGHU0RQGVFKHLEH0RQGVLFKHOXQG-XJHQG ORFNHDXIGHP.RSIGDUJHVWHOOWZLUGDQGHU5©FNVHLWHVH$XI +RO]VRFNHO PRQWLHUW ZLQ]LJHU $XVEUXFK DQ GHU +¤UQHUNURQH UHFKWVVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV %URQ]HVWDWXHWWHRI&KRQVXW\SLFDOO\GHSLFWHGDVDPXPP\ZLWKWKHV\PERO of childhood, a sidelock of hair, as well as the menat necklace with crook and ~DLO0LQRUGDPDJHDWULJKWVLGHRIWKHFURZQRWKHUZLVHLQYHU\JRRGFRQGLWLRQ 1HZ.LQJGRPWKWKG\QDVW\FD%&

222






 $PXOHWW GHV 2VLULV 6S”W]HLW FD    Y &KU + FP %URQ]HYROOJXVV%UHWWDUWLJHV$PXOHWWGHV*RWWHV2VLULVLQ0X PLHQIRUPGLHDXVGHU:LFNOXQJKHUDXVUDJHQGHQ+”QGHWUDJHQ .UXPPVWDEXQG*HLVVHOGLH%HNU¤QXQJEHVWHKWDXVGHU$WHI .URQH PLW 6RQQHQVFKHLEH /HLFKWH 9HUVLQWHUXQJHQ VRQVW VHKU JXWHU=XVDWQG u

 $PXOHWWGHV1HKHENDX1HXHV5HLFKELV'ULWWH=ZLVFKHQ]HLWFD Y&KU+FP%URQ]HYROOJXVV6FKUHLWHQGH)LJXU GHV*RWWHV1HKHENDXLQ0HQVFKHQJHVWDOWPLW6FKODQJHQNRSI(U WU”JWHLQH3HU©FNHXQGHLQHQ6FKXU]$XI+RO]VRFNHOPRQWLHUW %HLQH ELV ]X GHQ .QLHQ IHKOHQ DXI GHP 5©FNHQ 5HVWH HLQHU DEJHEURFKHQHQVH u

3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV

3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV

%RDUGVKDSHGDPXOHWRI2VLULVEURQ]HIXOOFDVW0XPP\IRUPKROGLQJFURRN DQG~DLOZHDULQJWKH$WHIFURZQRQWRS6OLJKWVLQWHULQJVRWKHUZLVHLQWDFW /DWH3HULRGFD%&

%URQ]HDPXOHWRIJRG1HKHENDXDSSHDULQJLQKXPDQIRUPZLWKWKHKHDGRI a cobra wearing a wig. Legs missing, otherwise intact. New Kingdom to 3rd ,QWHUPHGLDWH3HULRGFD%&

223




 8VKHEWLIŠUGHQ3ULQ]HQ 3WDKw6RKQYRQ3KDUDR5DPVHV,,1HX HV5HLFK'\QDVWLHFLUFDY&KU+FP 'XQNHOEUDXQH)D\HQFHPLWZHLgHU6FKULIWNROXPQH0XPLHQI¤U PLJHV8VKHEWLKDW$UPHŠEHUGLH%UXVWJHNUHX]WXQGKÂ&#x201D;OWLQGHQ +Â&#x201D;QGHQ$UEHLWVJHUÂ&#x201D;WH'DV*HVLFKWLVWEUHLWJHVWDOWHWXQGZLUG YRQHLQHUJURgHQGUHLWHLOLJHQ3HUŠFNHJHUDKPW(LQHKRUL]RQWDOH +LHURJO\SKHQVFKULIWPLWGHQ:RUWHQ (VZHUGHHUOHXFKWHWGHU 9HUVWRUEHQH6RKQGHV.¤QLJVÂ&#x20AC;3WDKy>@JHUHFKWIHUWLJWwEHGHFNW GHQ.¤USHU6HKUVHOWHQ0LW5HFKQXQJVNRSLHYRQ Intakt. u 3URYHQLHQ] ([ ,$'$$ 0LWJOLHG *DOHULH 5RVZLWKD (EHUZHLQ   H[ Sammlung eines Doktors aus Hamburg, ex franzĂśsische Sammlung (vor   8VKHEWLIRUWKHSULQFHÂ&#x20AC;3WDKyVRQRISKDUDRK5DPVHV,,1HZ.LQJGRPWK WKG\QDVW\FD%&0XPPLIRUPXVKHEWLPDGHIURPEURZQ faience with white horizontal band with inscription. Arms crossed on the chest, holding instruments. Large head, wearing tripartite wig. :LWKFRS\RIWKH LQYRLFHRI

224



 8VKHEWLIŠU1HVWDKL=ZLVFKHQ]HLW'\QDVWLHFLUFD Y&KU+FP*UŠQH)D\HQFHPLWGXQNHOEUDXQHQ +LHURJO\SKHQ%HLGH$UPHVLQGYRUGHU%UXVWYHUVFKUÂ&#x201D;QNW+Â&#x201D;Q GH]X)Â&#x201D;XVWHQJHEDOOW7UÂ&#x201D;JWHLQHGUHLWHLOLJH3HUŠFNH*HVLFKWLVW VHKUQDWXUDOLVWLVFKJHVWDOWHW6HKUIHLQDXVJHDUEHLWHWHV*HVLFKWIn WDNWVHKUJXWHUKDOWHQ u 3URYHQLHQ]([3ULYDWVDPPOXQJLQ+DPEXUJ YRU  8VKHEWLIRU1HVWDKLUGLQWHUPHGLDWH3HULRGVWQGG\QDVW\FD %&0XPPLIRUPXVKHEWLPDGHRIJUHHQIDLHQFHZLWKEURZQLQVFULSWLRQ Arms crossed on the chest. Nice natural face, wearing tripartite wig.


407

408

407 Ushebti des Imhotep. '\QDVWLHY&KU+ RKQH 6RFNHO  FP +HOOEODX JODVLHUWH )D\HQFH 8VKHEWL LQ 0XPL HQIRUPPLWJODWWHU3HU©FNHGLH+Â&#x201D;QGH©EHUNUHX]DXIGLH%UXVW JHOHJW6DDWNRUEXQG]ZHL+DFNHQKDOWHQGKLQWHQ5©FNHQSIHL OHU'LHHLQ]HLOLJHYHUWLNDOH+LHURJO\SKHQ,QVFKULIWDXIGHU9RU GHUVHLWHQHQQWDOV*UDEKHUUQHLQHQ,PKRWHS$XI$FKDW6RFNHO PRQWLHUW8QWHUWHLODEJHEURFKHQVRQVWLQJXWHP=XVWDQG u

408 Kleines Ushebti. 6SÂ&#x201D;W]HLW'\QDVWLHFDY&KU RGHUVSÂ&#x201D;WHU+ RKQH6RFNHO FP+HOOEODXJODVLHUWH)D\HQFH .OHLQHV EUHWWDUWLJHV 8VKHEWL LQ VXPPDULVFKHU %HDUEHLWXQJ $XI UXQGHP +RO]VRFNHO PRQWLHUW OHLFKWH 9HUVLQWHUXQJHQ LP 2EHUWHLO u

Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er Jahre bis 2017; ex Grunow, Liste 41, 1996, Nr. 1352. =X GHP *UDEKHUUQ ,PKRWHS V + 3DJH*DVVHU  $% :LHVH Â&#x160;J\SWHQ  $XJHQEOLFNHGHU(ZLJNHLW  6I1U$

0LQLDWXUHDQRQ\PRXVXVKHEWLIDLHQFHOLJKWEOXHJOD]HQRGRUVDOSLOODU,Q IDLUFRQGLWLRQ/DWH3HULRGWKWKG\QDVW\RUODWHUFD%&

Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er Jahre bis 2017; ex *RUQ\ 0RVFK$XNWLRQ/RV

8VKHEWLIRU,PKRWHSOLJKWEOXHJOD]HIDLHQFH)HHWPLVVLQJRWKHUZLVHLQYHU\ JRRGFRQGLWLRQ/DWH3HULRGWKG\QDVW\%&

225




 8VKHEWL I©U GHQ 5HQHS3ULHVWHU +RUHPKHE 6S”W]HLW  '\ QDVWLH FD    Y &KU +  FP +HOOJU©QH )D\HQFH 0XPLHQI¤UPLJHV8VKHEWLPLW5©FNHQSIHLOHUXQG©EHUGHU%UXVW JHNUHX]WHQ +”QGHQ GLH GLH ©EOLFKHQ :HUN]HXJH 6DDWNRUE XQG+DQGS~XJ]HLJHQ'LHHLQ]HLOLJH,QVFKULIWDXIGHU9RUGHU XQG5©FNVHLWHODXWHW'HU(UOHXFKWHWHHLQ2VLULVGHU5HQHS 3ULHVWHU +RUHPKHE 6RKQ GHV $QFKSDFKHUHG JHERUHQ YRQ GHU +HUULQ GHV +DXVHV 7DFKHUHGHQWDLKw Mit ausführlichen Unterlagen! Sehr schön erhaltenes Exemplar! $XI G©QQH 3OH [LJODVSOLQWKHPRQWLHUW u Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er Jahre bis 2017; GDYRU'”QLVFKH6DPPOXQJ+1HKHPDOVHQJOLVFKH6DPPOXQJ YRU  9JO*-DQHV6KDEWLV$SULYDWH9LHZ  61U 'HU7LWHOHLQHV5HQHS3ULHVWHUVwZDULP8QWHU”J\SWLVFKHQ*DX©EOLFKLQ GHP+DWKRURGHUGLH.XK*¤WWLQ6HFKDW+RUKDXSWV”FKOLFKYHUHKUWZXUGHQ +DWKRU 6KDEWL RI +RUHPKHE 5HQHSSULHVW RI WKH JRGGHVVHV +DWKRU RU 6HFKDWKRU3DOHJUHHQIDLHQFHLQWDFW/DWH3HULRGWKG\QDVW\FD %&7KHWLWOHRID5HQHSSULHVWwZDVFRPPRQLQWKHUG/RZHU(J\SW GLVWULFW ZKHUH +DWKRU DQG 6HFKDW+RU ZHUH ZRUVKLSSHG DV PDLQ JRGGHV ses.

226



 Statuette des Anubis. 6S”W]HLW'\QDVWLHY&KU +FP)D\HQFHPLWW©UNLVIDUEHQHU*ODVXU$PXOHWWGHVVFKD NDON¤S}JHQ*RWWHV$QXELVGHUDOV6FKXW]JRWWGHU(LQEDOVDPLH UHUJDOW$P5©FNHQSIHLOHUGXUFKERKUWNOHLQH$EVSOLWWHUXQJHQ VRQVWLQWDNW u Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er Jahre bis 2017; JHNDXIWEHL$QWLNH0©Q]HQ6FKZDQKHLPHU6WU%HUOLQDP )DLHQFHDPXOHWRIWKHMDFNDOKHDGHG*RG$QXELVWKHSURWHFWLYHJRGRIWKH HPEDOPSULHVWV6RPHPLQRUFKLSSLQJVRWKHUZLVHLQWDFW/DWH3HULRGWK VWG\QDVW\%&




 Amulett des Anubis. 6SÂ&#x201D;W]HLWFDY&KU+FP+HOO EODX JODVLHUWH )D\HQFH 6WDWXHWWH GHV VFKDNDON¤S}JHQ $QXELV EHLGH+Â&#x201D;QGHHQJDQGHQ.¤USHUJHOHJW6HKUIHLQHGHWDLOUHLFKH $UEHLWLQWDNW u 3URYHQLHQ]([&ROOHFWLRQ'U-.HPLVK2UDQJH&RXQW\&DOLIRUQLD86$ erworben vor 1975. $PXOHW RI WKH MDFNDOKHDGHG GHLW\ $QXELV OLJKW EOXH JOD]HG IDLHQFH /DWH 3HULRGFD%&9HU\}QHZRUNH[FHOOHQWFRQGLWLRQ



 $PXOHWWGHV+RUXV6SÂ&#x201D;W]HLWFDY&KU+FP'XQNHO W©UNLV JODVLHUWH )D\HQFH 6WDWXHWWH GHV VFKUHLWHQGHQ +RUXV PLW GHU.URQHYRQ8QWHUXQG2EHUÂ&#x201D;J\SWHQKLQWHQ5©FNHQSIHLOHU ,QWDNWLP5©FNHQSIHLOHUNOHLQHV%HIHVWLJXQJVORFK u 3URYHQLHQ] ([ 6OJ 'U - .HPLVK 2UDQJH &RXQW\ .DOLIRUQLHQ 86$ Erworben vor 1975. /DWH3HULRGID\HQFHDPXOHWRIWKHVWULGLQJJRG+RUXVZHDULQJWKHFURZQRI /RZHUDQG8SSHU(J\SW7LQ\KROHDWGRUVDOSLOODULQWDFW&D%&

 3DWÂ&#x201D;NHQ$PXOHWWXQG.¤SIFKHQ6SÂ&#x201D;W]HLWELVSWROHPÂ&#x201D;LVFKH(SR FKHFDY&KUD + RKQH6RFNHO FP6WHDWLWPLW EODVVEODXHU*ODVXU6WDWXHWWHHLQHVNOHLQHQ3DWÂ&#x201D;NHQ QDWXUJHWUHXH :LHGHUJDEH HLQHV ]ZHUJZ©FKVLJHQ 0HQVFKHQ  GLH +Â&#x201D;QGH DXI GHQ2EHUVFKHQNHOQOLHJHQGDXIGHP.RSIGLH~DFKH3WDKNDS SH$XIUXQGHQ+RO]VRFNHOPRQWLHUWLQWDNWE + RKQH6RFNHO  FP)D\HQFHGXQNHOW©UNLVH*ODVXU.RSIYRQGHU6WDWXHWWH HLQHV0DQQHVGDV+DDUELVDXIYLHU)HOGHUDQGHU6WLUQXQGDP +LQWHUNRSI DXVUDVLHUW $XI 3OH[LJODV6RFNHO PRQWLHUW LQWDNW 2 6W©FN6HOWHQ u 

Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er Jahre bis 2017. 7ZRPLQLDWXUHIDLHQFHSLHFHVIURPWKH/DWH3HULRGFD%&D  $PXOHWRI3WDLFKRV6WHDWLWHZLWKSDOHJUHHQJOD]H,QWDFWE 0LQLDWXUHKHDG EOXHIDLHQFH,QWDFWSLHFHV

227




 )XgEUHWWHLQHV6DUNRSKDJHV6S”W]HLWFDY&KUFP [FP+RO]PLW6WXFN©EHU]XJXQG%HPDOXQJLQ7©UNLV5RW XQG6FKZDU]2EHQOHLFKWDEJHUXQGHWHV)XgEUHWWHLQHV0XPL HQVDUNRSKDJHVPLWGHU'DUVWHOOXQJYRQ]ZHL6FKUHLQHQDXIGH QHQMHZHLOVGHUVFKDNDOJHVWDOWLJH*RWW$QXELVOLHJWGHU©EHUGLH 7RWHQZDFKWXQG©EHUVHLQHU6FKXOWHUGDV)ODJHOOXP *HLgHOw  WU”JW 'LH 6FKUHLQH ]HLJHQ DXIJHPDOWH 6FKHLQW©UHQ GHU REHUH $EVFKOXVVZLUGYRQHLQHU+RKONHKOHJHELOGHW=ZLVFKHQLKQHQ Z”FKVW HLQH KRKH /RWXV3~DQ]H PLW GUHL %O©WHQ 'DV %UHWW LVW DQGHQ/”QJVVHLWHQ]XU$QEULQJXQJYLHUIDFKGXUFKERKUWUHFKWV XQWHQLVWHLQ+RO]]DSIHQHUKDOWHQMit Kopie des Echtheitszerti }NDWHVXQGGHU¤VWHUHUUHLFKLVFKHQ([SRUWOL]HQ]8QWHQDEJHEUR FKHQ6WXFNHWZDVDEJHZLWWHUW%HPDOXQJVHKUJXWHUKDOWHQ u 3URYHQLHQ](UZRUEHQLP-DKUEHL&KULVWRSK%DFKHU$UFK”RORJLH:LHQ GDYRULQREHU¤VWHUUHLFKLVFKHU3ULYDWVDPPOXQJVHLWGHQHU-DKUHQ :RRGHQIRRWSODWHRIDQDQFLHQWVDUFRSKDJXVJHVVRHGDQGSDLQWHGLQWXUTXRLVH UHGDQGEODFN7KHSLFWXUHVKRZVWZRVKULQHVRQHDFKRIWKHPOLHVWKHMDFNDO OLNHJRG$QXELVKROGLQJD~DJHOOXPLQKLVUROHDVWKHJXDUGLDQRIWKHGHFHDVHG $ODUJHORWXVSODQWZLWKWKUHHEORVVRPVUDLVHVEHWZHHQWKHVKULQHV/RZHUSDUW PLVVLQJWKHSDLQWLQJLVZHOOFRQVHUYHG)RXUPRXQWLQJKROHRQHZLWKRULJLQDO WDS/DWH3HULRGFD%&:LWKFRSLHVRIDFHUWL}FDWHDQGWKH $XVWULDQH[SRUWOLFHQFH



228

 Mumienverzierung mit Darstellung des Gottes Thot. 5¤PLVFKH =HLW-KQ&KUFP[FP LQQHUHU5DKPHQFP [ FP ”XgHUH 5DKPXQJ FP [ FP  $XI HLQHQ 8QWHU JUXQGDXIJHEUDFKWH0XPLHQDSSOLNDWLRQDXVYHUJROGHWHP6WXFN GLHGHQQDFKOLQNVVLW]HQGHQ*RWW7KRWLQ3DYLDQJHVWDOWPLWJH K¤UQWHU 6RQQHQVFKHLEH GDUVWHOOW Mit Original des Kaufbeleges! 6SXUHQ YRQ +DU] DXI GHU /HLQZDQG DQ GHU $SSOLNDWLRQ URWHU %ROXVDOV9HUJROGXQJVXQWHUJUXQGVLFKWEDU u


Provenienz: Ex Sammlung Dr. Prawitz, Hessen. Erworben EHLGHU*DOHULHÂ&#x160;J\SWLVFKHU.XQVW)LUPD&KULVWLDQ 6DQGPHLHU*¤WWLQJHQ %HLGLHVHP2EMHNWKDQGHOWHVVLFKDOOHU:DKUVFKHLQOLFKNHLW QDFKXPGDV)UDJPHQWHLQHU0XPLHQK©OOHI©UHLQHQ3DYL DQGHUDOV,QNDUQDWLRQGHV*RWWHV7KRWJDOW'LH9HUHKUXQJ GLHVHU$IIHQDUWGXUFKGLHÂ&#x160;J\SWHUJHKWDXIGHUHQ$QJHZRKQ KHLW]XU©FNVLFKPLWHUKREHQHQ+Â&#x201D;QGHQYRUGLH0RUJHQ VRQQH]XVHW]HQXPVLFK]XZÂ&#x201D;UPHQZDVDOV%HJU©gHQRGHU $QEHWHQGHU6RQQHDXVJHOHJWZXUGH'LH7LHUHPXVVWHQDXV GHP6©GHQHLQJHI©KUWZHUGHQZHVKDOEVLHVHOWHQZDUHQXQG LQGHU5HJHOLQ7HPSHOQJHKDOWHQZXUGHQ1DFKLKUHP7RG ZXUGHQVLHDXIZÂ&#x201D;QGLJHLQEDOVDPLHUW $Q (J\SWLDQ WH[WLOH IUDJPHQW ZLWK JLOW VWXFFR GHSLFWLQJ WKHJRG7KRWLQIRUPRIDEDERRQVHDWHGWRWKHOHIWDQG ZHDULQJ WKH VXQ GLVF ,W SUREDEO\ RULJLQDWHV IURP WKH PXPP\ZUDSSLQJVRIDEDERRQZKLFKZDVZRUVKLSSHGDV UHLQFDUQDWLRQ RI WKH JRG 7KRW E\ WKH (J\SWLDQV 5RPDQ WLPHVVWQGFHQWXU\$',QH[FHOOHQWFRQGLWLRQZLWK WUDFHV RI UHVLQ RQ WKH FDQYDV :LWK LQYRLFH RI *DOHULH Â&#x160;J\SWLVFKHU.XQVW*¤WWLQJHQ

 0XPLHQPDVNH XQG %DUWIUDJPHQW 3WROHPÂ&#x201D;LVFKH ELV U¤PLVFKH =HLW  Y &KU   -K Q &KU D  + FP % FP =HGHUQKRO] *HVLFKWVPDV NH PLW DQVDW]ZHLVH HUNHQQEDUHP .RSIWXFK XQG (LQVDW]]DSIHQ XQWHU GHP .LQQ 6SXUHQ YRQ 6WXFNXQGU¤WOLFKHU%HPDOXQJ9HUZLWWHUWODQJHU 6SUXQJ LQ GHU OLQNHQ *HVLFKWVKÂ&#x201D;OIWH XQWHU GHP .LQQ(LQODVV]DSIHQE /FDFP+RO]8QWHQ JHERJHQHU =HUHPRQLDOEDUW 6SXUHQ YRQ 6WXFN XQGW©UNLVHU%HPDOXQJ 1LFKW]XU0DVNHJHK¤ ULJ 6W©FN u



3URYHQLHQ]([6DPPOXQJ5:+HVVHQ)DPLOLHQEHVLW] seit vor 1980. 7ZRZRRGHQREMHFWVIURPWKH3WROHPDLFRUHDUO\5RPDQ SHULRG%&VWFHQWXU\$'D $FDUYHGPXPP\ PDVN IRUPHG IURP RQH SLHFH RI FHGDU ZRRG SUHYLRXVO\ JHVVRHGDQGSDLQWHGUHG:HDWKHUHGDQGORQJFUDFNDWOHIW VLGHRIWKHIDFHWDSXQGHUWKHFKLQE ,QGLYLGXDOFHUHPRQLDO EHDUGRQFHJHVVRHGDQGSDLQWHGWXUTXRLVH:LWKWDSDERYH 1RWEHORQJLQJWRD SLHFHV

 0XPLHQPDVNH XQG 8VKHEWL2EHUWHLO D  FP +RO] *HVFKQLW]WH 0XPLHQPDVNH YRQ HLQHP +RO]VDUNRSKDJ GLH PDQGHOI¤UPLJHQ $XJHQ OHLFKW YRUJHZ¤OEW VFKDUIH YRUVSULQJHQGH 1DVH XQG ZXOVWLJH /LSSHQ )©QI =DS~¤FKHU DQ GHU 6WLUQ QRFK HLQ =DSIHQ HUKDOWHQ 8UVSU©QJOL FKHU 6WXFN XQG %HPDOXQJ DEJHZLWWHUW 6SU©QJH LP +RO] 3WROHPÂ&#x201D;LVFKH (SRFKH  FD  Y &KUE + RKQH6RFNHO FDFP*U©QW©UNL VH )D\HQFH .RSIWHLO HLQHV 8VKHEWLV PLW JODWWHU 3HU©FNH XQG JH~RFKWHQHP =HUHPRQLDOEDUW ,Q WDNW6SÂ&#x201D;W]HLW'\QDVWLHFDY&KU 6W©FN u Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er Jahre bis 2017. 7ZR REMHFWV IURP WKH /DWH DQG 3WROHPDLF 3HULRG D  :RRGHQ FDUYHG PXPP\ PDVN SUHYLRXVO\ JHVVRHG DQG SDLQWHG6RPHFUDFNVLQWKHZRRGWDSSLQJKROHV3WROHPDLF 3HULRGFD%&E 8SSHUSDUWRIDIDLHQFHXVKHEWL ZLWKSODLQZLJ,QWDFW/DWH3HULRGWKG\QDVW\FD %&SLHFHV



229


 %LOGKDXHUPRGHOO 6SÂ&#x201D;W]HLW  '\QDVWLH ELV SWROHPÂ&#x201D;LVFKH (SRFKH FD    Y &KU + FP % FP .DONVWHLQ 4XDGUDWLVFKH 3ODWWH PLWGHU%©VWHHLQHV.¤QLJVLP+RFKUHOLHIGHUGDV 1HPHV.RSIWXFKPLW8UÂ&#x201D;XVVFKODQJHXQGHLQHP 'RSSHOJHK¤UQ DXI GHP .RSI WUÂ&#x201D;JW 6WÂ&#x201D;UNHUH 2EHU~Â&#x201D;FKHQYHUZLWWHUXQJ UHFKWV (UJÂ&#x201D;Q]XQJ DP .RSIOLQNV u Provenienz: Ex Sammlung V.S., Berlin, erworben 1980er -DKUHELVH[$XNWLRQ'DQQHQEHUJ%HUOLQ.DWDORJ 139, 2015, Nr. 1705; aus Berliner Privatbesitz. 9JO]XGLHVHP6W©FN17RPRXP7KH6FXOSWRUyV0RGHOV RIWKH/DWHDQG3WROHPDLF3HULRGV$6WXG\RWWKH7\SHDQG )XQFWLRQRID*URXSRI$QFLHQW(J\SWLDQ$UWLIDFWV   7DI 6FXOSWRUyVPRGHORID3KDUDRZHDULQJWKH1HPHVKHDGGUHVV DQGXUDHXVFURZQHGE\WZRKRUQV5LJKWVLGHZHDWKHUHG PRGHUQ DGGLWLRQ DW KHDG OHIW /DWH 3HULRG WR 3WROHPDLF WLPHVFD%&

 Fragment einer Statue. 6SÂ&#x201D;W]HLWFDY &KU / FP + FP *URgHV LQWHUHVVDQWHV )UDJPHQWDXV*UDQLW(UKDOWHQLVWGLHOLQNH+DQG VRZLHHLQ7HLOGHV2EHUN¤USHUVHLQHU*HZDQGVWD WXHI©UHLQHQKRKHQ%HDPWHQ)UDJPHQWDULVFK u 3URYHQLHQ] ([ )DPLOLHQVDPPOXQJ 2WKPDU 6FKRHFN .RPSRQLVW   DQVFKOLHgHQG 6DPPOXQJ 6FKRHFN*U©EOHU.DQWRQ6FKZ\] ELVHU-DKUH H[ *RUQ\ 0RVFK$XNWLRQ/RV 

,QWHUHVWLQJIUDJPHQWRIDJUDQLWHVWDWXH7KHOHIWKDQGDQG SDUWRIWKHYHVWHGXSSHUERG\LVSUHVHUYHG3UREDEO\DQLPDJH RIDKLJKRI}FLDO)UDJPHQWDU\SUHVHUYHG/DWH3HULRGFD %&



230


420 =ZHL *UDENHJHO GHV 6HQHQPXW 5HJLHUXQJV]HLW GHU +DWVKHSVXW    Y &KU +  XQG FP 5¤WOLFKHU 7RQ =ZHL *UDENHJHO GHUHLQHIUDJPHQWLHUW  PLW GHU JOHLFKHQ $XIVFKULIW GLH EHVDJWGDVVGHU*UDEKHUU6HQHQ PXW 3ULHVWHU GHV $PXQ8VHU KDWw XQG 9RUVWHKHU GHV +DXVHV GHU .¤QLJVWRFKWHU GHU 7RFKWHU GHU+DWVKHSVXW 5DQHIHUXwVRZLH $XIVHKHUGHU5LQGHUGHV$PXQw ZDU6W©FN6HKUVHOWHQH2EMHN te! u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ :©UWWHPEHUJHUZRUEHQ 9JO ]X GLHVHQ *UDENHJHOQ PLW GHP 6LHJHOGHV6HQHQPXWZHLWHUH*UDENHJHO PLWVHLQHU7LWXODWXULQŠJ\SWHQV$XIVWLHJ ]XU:HOWPDFKW$XVVWHOOXQJ+LOGHVKHLP  1U

420

7ZRIXQHUDU\FRQHVRI6HQHQPXW+LJK 6WHZDUWRI+DWVKHSVXWDQGWKHDUFKLWHFW RIWKH4XHHQyVWRPEPRQXPHQWDW'HLUHO %DKUL,QWKHLQVFULSWLRQKHFDOOVKLPVHOI KLJKSULHVWRI$PXQ8VHUKDWDQG6WHZDUW RI WKH 4XHHQyV GDXJKWHU 1HIHUXUH DQG VXSHUYLVRURI$PXQyVFDWWOHFD  %&  SLHFHV 2EMHFWV RI JUHDW KLVWRULFDOLQWHUHVW

 3DS\UXV)UDJPHQW 3WROHP”HU]HLW FDY&KU[FP 6HKU JURgHV 3DS\UXV)UDJPHQW PLW GHPRWLVFKHU 6FKULIW EHLGVHL WLJEHVFKULIWHW   u



3URYHQLHQ]([GHXWVFKH3ULYDWVDPPOXQJ :6 5KHLQODQG  3IDO] JHVDPPHOW LQ den 1950er bis 1960er Jahren. 3DS\UXV IUDJPHQW 3WROHPDLF 3HULRG %LJ IUDJPHQW ZLWK GHPRWLF VFULSW RQ both sides.

422 =ZHL 3DS\UXV)UDJPHQWH 3WR OHP”HU]HLW FD    Y &KU FD  [ FP XQG  [ FP =ZHL 3DS\UXV )UDJPHQWH PLW GHPRWLVFKHU 6FKULIW EHLGVHLWLJ EHVFKULIWHW 6W©FN u

422

3URYHQLHQ]([GHXWVFKH3ULYDWVDPPOXQJ :6 5KHLQODQG  3IDO] JHVDPPHOW LQ den 1950er bis 1960er Jahren. 3DS\UXVIUDJPHQW3WROHPDLF3HULRG%LJ IUDJPHQW ZLWK GHPRWLF VFULSW RQ ERWK sides. SLHFHV

231


$/7(525,(17



 Augenidol aus Ton. 7HOO%UDNFDY&KU+FP%PD FP$XVZHLgHP7RQPLWJUDXHPEHU]XJ$XIHLQHPNH JHODUWLJHQ &RUSXV VLW]HQ ]ZHL UXQGH 6FKHLEHQ PLW %RKUXQJHQ LP =HQWUXP €$XJHQy  $XI GHP .¤USHU YRUQH HLQ 6WHLQERFN KLQWHQHLQ3DQWKHU " LP5HOLHIGDU©EHUMHZHLOV]ZHLKRUL]RQWDOH %”QGHUPLW6FKU”JVWULFKHQ0LW7/$QDO\VHXQG%HVWLPPXQJV zettel des Sammlers! EHU]XJ ]7 DEJHSODW]W 7HLO GHV OLQNHQ $XJHVJHEURFKHQXQGZLHGHUDQJHVHW]W u

232

3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV*U¤gWHQWHLOV HUZRUEHQEHL*UXQRZLQGHQHUHU-DKUHQ 'DVYRUOLHJHQGH,GROHQWVSULFKWQLFKWGHPDXV7HOO%UDNEHNDQQWHQ7\SXVGHU $XJHQLGROHVRQGHUQXQWHUVFKHLGHWVLFKLQ0DWHULDOXQG'HNRU9HU]LHUXQJHQ LQ)RUPYRQ7LHUHQVLQGDXIGHUDUWLJHQ,GROHQVHKUVHOWHQ &OD\H\HLGROZLWKSODVWLFGHFRULQIRUPRIDQLEH[DQGDSDQWKHU " DQG HQFDUYHGGHFRUDWLRQ7HOO%UDNDERXW%&6OLSSDUWLDOO\ZRUQRISDUW RIRQHH\HEURNHQDQGUHDWWDFKHG:LWK7/$QDO\VLVDQGFROOHFWRUyVQRWH


424

424 7HUUDNRWWDVWDWXHWWHHLQHUZHLEOLFKHQ*RWWKHLW6\URKHWKLWLVFK -W Y &KU + FP $XV KHOOHP U¤WOLFKHQ 7RQ PLW EHLJHP EHU]XJ1DFNWH)LJXUPLWDXVODGHQGHQ+©IWHQXQG6WXPPHO DUPHQVRZLHHLQHP9RJHONRSIJHVLFKWPLWKHUYRUWUHWHQGHU1DVH XQG.UHLVDXJHQ+LQWHUGHP.RSIHLQWUDSH]RLGHU$XIEDXPLW /¤FKHUQGLH]XU$XIQDKPHYRQ6FKPXFNDXV0HWDOOJHGDFKW ZDUHQ 0LW 7/$QD\OVH :LQ]LJH )UDJPHQWH HLQHU $UPVSLW]H IHKOHQ u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3URI'U-0HUZRUEHQ ]ZLVFKHQXQG 9JO,GROH)U©KH*¤WWHUELOGHUXQG2SIHUJDEHQ$XVVWHOOXQJ0©QFKHQ   6  1U  + 0©OOHU.DUSH +DQGEXFK GHU 9RUJHVFKLFKWH ,,,   7DI 6\URKLWWLWHIHPDOHLGROPDGHRIFOD\QGPLOOHQLXP%&7LQ\IUDJPHQWVRI WKHWLSRIRQHDUPPLVVLQJ:LWK7/DQDO\VLV



 7HUUDNRWWD,GRO6\URKHWKLWLVFK-WY&KU+FP+HOOURWHU 7RQ PLW EHLJHP EHU]XJ 3IHLOHUDUWLJHU .¤USHU GHU VLFK ]XU ~DFKHQ6WDQG~”FKHYHUEUHLWHUWXQGQDFKREHQLQHLQHP~DFKHQ 2EHUN¤USHUPLW$UPVWXPPHOQXQGHLQHPYRJHODUWLJHQ*HVLFKW PLWDXIJHOHJWHQ.UHLVDXJHQXQGHLQHUSODVWLVFKHQ1DVHDXVO”XIW 8P GHQ +DOV OLHJW HLQ JHNHUEWHV 6FKPXFNEDQG XQG HLQ 5LQJ 'HU.RSIO”XIWLQHLQHUNRQLVFK]XODXIHQGHQ.DSSHDXV(WZDV EHULHEHQ DP +DOV JHEURFKHQ XQG ZLHGHU ]XVDPPHQJHVHW]W EHLGH$UPVWXPPHOHUJ”Q]W u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ-66©GGHXWVFKODQGHUZRUEHQLQGHQ HUELVHU-DKUHQLPHQJOLVFKHQ.XQVWKDQGHO 7HUUDFRWWDLGROZLWKDELUGVKHDG6\URKLWWLWHUGPLOOHQLXP%&6XUIDFH SDUWLDOO\ZRUQUHDVVHPEOHGDWWKHQHFNWKHVWXPSVRIDUPVUHVWRUHG

233


427 ,GRO YRP .XVXUD%H\FHVXOWDQ7\SXV :HVWDVLDWLVFK 0LWWH  -W Y&KU+FP:HLgHUIHLQN¤UQLJHU0DUPRU6FKHPDWLVFKHV VHKU ~DFKHV ,GRO PLW VFKHLEHQI¤UPLJHQ &RUSXV PLW ZLQ]LJHQ $UPVWXPPHOQODQJHP+DOVXQGVFKHLEHQI¤UPLJHP.RSI6LQ WHUUHVWHDP+DOVJHNOHEW u 3URYHQLHQ] ([ 6DPPOXQJ )7 %DGHQ:©UWWHPEHUJ HUZRUEHQ DXI GHU &XOWXUDEHL*DOOHULD6HURGLQH 9JO.XQVWGHU.\NODGHQ$XVVWHOOXQJ.DUOVUXKH  61U 6FKHPDWLF LGRO RI WKH .XVXUD%H\FHVXOWDQ W\SH 0LG UG PLOOHQLXP %& 5HDVVHPEOHGDWWKHQHFN

428 *URgHV.LOL\D,GRO:HVWDVLDWLVFKFDY&KU + FD  FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU 6WDUN VWLOLVLHUWHU ~DFKHU.¤USHUPLWGLDJRQDODQJHZLQNHOWHQ8QWHUDUPHQHLQHP VSLW] ]XODXIHQGHQ 8QWHUN¤USHU /DQJHU G©QQHU +DOV X EUHLWHU .RSIPLWODQJHUG©QQHU1DVHXSODVWLVFKHU$QJDEHGHU2KUHQ XQG$XJHQ+DOVJHNOHEW6SLW]HYRQ8QWHUN¤USHUIHKOWSDUWLHOO YHUVLQWHUW u 3URYHQLHQ]([1DFKODVV(70©QFKHQHU-DKUH 0DUEOHLGRORIWKH.LOL\DW\SH:HVWHUQ$VLDWLFDERXW%& 5HDWWDFKHGDWWKHQHFNSDUWLDOO\VLQWHUHG 426

426 Idol. &D-WY&KU+FP5RWHU7RQPLWKHOOURWHPEHU ]XJ=\OLQGULVFKHU.¤USHUPLWDXVJHVWUHFNWHQXQGLP(OOHQER JHQJHEHXJWHQ$UPHQJURgHU.RSIPLWODQJHUNRQLVFKHU0©W]H HFNLJHQ 2KUHQ .UHLVDXJHQ XQG OHLFKW JH¤IIQHWHP 0XQG $XI GHP.¤USHUHLQ*HZDQGPLW/LQLHQXQGHLQHPNRQ]HQWULVFKHQ 5KRPEXVDQJHGHXWHW(LQH+DQGLQGHU0LWWHJHEURFKHQZLQ]L JH$EVSOLWWHUXQJHQEHU]XJSDUWLHOODEJHULHEHQ u

 .LOL\D,GRO:HVWDVLDWLVFK FD    Y &KU + FD  FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU 6WDUN VWLOLVLHUWHU ~D FKHU.¤USHUPLWGLDJRQDODQJHZLQNHOWHQ8QWHUDUPHQXQGHLQHP VSLW]]XODXIHQGHQ8QWHUN¤USHU/DQJHUG©QQHU+DOVPLWHLQHP EUHLWHQ.RSIPLWG©QQHU1DVHXQGSODVWLVFKHU$QJDEHGHU2K UHQXQG$XJHQ$P+DOVJHNOHEW)UDJPHQWGHV8QWHUN¤USHUV XUHFKWHP$UPIHKOHQSDUWLHOOYHUVLQWHUW u 3URYHQLHQ]([1DFKODVV(70©QFKHQHU-DKUH 0DUEOHLGRORIWKH.LOL\DW\SH:HVWHUQ$VLDWLFDERXW%& 5HDWWDFKHGDWWKHQHFNIUDJPHQWRIORZHUERG\DQGULJKWDUPDUHPLVVLQJ SDUWLDOO\VLQWHUHG

3URYHQLHQ] ([ 1DFKODVV .DULQ .RUWH %D\HUQ GDYRU )DPLOLHQEHVLW] LQ 'HXWVFKODQGVHLWGHQHU-DKUHQ

 .RSIHLQHV.LOL\D,GROV:HVWDVLDWLVFKFDY&KU% FP+FP:HLgHUIHLQN¤UQLJHU0DUPRU%UHLWHVVWLOLVLHUWHV *HVLFKWPLWSODVWLVFKKHUYRUJHKREHQHU1DVHX2KUHQ6LQWHUUH VWHZLQ]LJH)HKOVWHOOHQDP+DOVJHEURFKHQ u

(DVWHUQ0HGLWHUUDQHDQFOD\LGROZLWKDFRQLFDOKDW$ERXWVWPLOOHQLXP%& 3DUWRIOHIWKDQGPLVVLQJPLQRUFKLSSLQJVOLSSDUWLDOO\UXEEHGRII

3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUZRUEHQEHL*RUQ\ 0RVFK$XNWLRQ/RV +HDGRIDPDUEOHLGRO:HVWHUQ$VLDWLFDERXW%&5HVWRIVLQWHU WLQ\VSOLQWHUVDUHPLVVLQJEURNHQDWWKHQHFN

 .RSIHLQHV.LOL\D,GROV:HVWDVLDWLVFKFDY &KU+FP:HLgHUIHLQNULVWDOOLQHU0DUPRU%UHLWHU.RSIPLW ODQJHUG©QQHU1DVHXSODVWLVFKHU$QJDEHGHU2KUHQ$P+DOV JHEURFKHQWHLOVYHUVLQWHUW u 3URYHQLHQ]([1DFKODVV(70©QFKHQHU-DKUH +HDGRIDPDUEOHLGRO .LOL\DW\SH :HVWHUQ$VLDWLFDERXW %&%URNHQDWWKHQHFNSDUWLDOO\VLQWHUHG

234


427



428





235


 Miniaturstreitwagen aus Ton. 1D KHU2VWHQ-WY&KU/FP %FQ+FPkGHU5Â&#x201D;GHUFD FP=ZHLDFKVLJHU)URQWVFKLOG ZDJHQ PLW YLHU 6FKHLEHQUÂ&#x201D;GHUQ $Q GHU )URQW XQG 5©FNVHLWH 5LW]GHNRU LQ )RUP HLQHV JURgHQ .UHX]HV PLW HLQJHVWUHXWHQ 3XQN WHQ $Q GHU )URQW ]ZHL /¤FKHU I©UGHQ'XUFKODVVGHU=©JHOMit 7/$QDO\VH XQG %HVWLPPXQJV zettel des Sammlers! 2EHU~Â&#x201D;FKH VWHOOHQZHLVHEHULHEHQ$FKVHQPLW 5Â&#x201D;GHUQWHLOZHLVHPRGHUQHUJÂ&#x201D;Q]W VRQVWLQWDNW u 

Provenienz: Ex Slg. V. S., Berlin, erworben bei Galerie Grunow Liste 37, 1995, Nr. 1326. 9JO 2ULHQW XQG 2N]LGHQW $XVVWHOOXQJ 0©QFKHQ  6I.DW9,,, 1DFKELOGXQJHQYRQ6WUHLWZÂ&#x201D;JHQDXV7RQ ]HLJHQVRZRKO]ZHLDOVDXFKYLHUUÂ&#x201D;GULJH :DJHQPRGHOOH 6WUHLWZÂ&#x201D;JHQ ZDUHQ GDV 6WDWXVV\PEROYRQ:DJHQNÂ&#x201D;PSIHUQXQG GLHQWHQ LP 0LQLDWXUIRUPDW DOV :HLK oder Grabbeigaben. 0LQLDWXUH YRWLYH FKDULRW PDGH RI FOD\ 0LGGOH(DVWUGPLOOHQLXP%&6XUIDFH SDUWLDOO\ZRUQZKHHOVPRGHUQPRXQWHG DQG SDUWLDOO\ UHVWRUHG RWKHUZLVH LQWDFW :LWK7/$QDO\VLVDQGFROOHFWRUyVQRWH

e Silberne Statuette der Isis(?). 6DEÂ&#x201D;LVFK    -K Q &KU + FP )LJ©UOLFKHV .RKOJHIÂ&#x201D;g LQ )RUPHLQHUDXIHLQHPPLWHLQHP 0Â&#x201D;DQGHUEDQG XQG ODXIHQGHP +XQG YHU]LHUWHQ 3RGHVW VLW]HQ GHQ )UDXHQ}JXU PLW HLQHP NOHL QHQ .LQG DXI GHP 6FKRg $XI GHP .RSI ]\OLQGULVFKHU $XIVDW] PLW HLQHU ,QVFKULIW ,P 1DFNHQ ]ZHL GXUFKJHVWRgHQH /¤FKHU I©U HLQH $XIKÂ&#x201D;QJXQJ "  $P 3RORV JHEURFKHQ GXQNOHU %HODJ 5HVWH YRQ .OHEVWRII DP 5DQG GHV 3R ORVXDXIGHU5©FNVHLWHLQWDNW u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ    ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ$QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ/RV 

236

6LOYHUNRKOYHVVHOLQIRUPRIDVWDWXHWWHRI ,VLV " VLWWLQJRQDSODWIRUPDQGKROGLQJ DFKLOG,QVFULSWLRQRQWKHSRORV6DEDHDQ VW  QG FHQWXU\ $' %URNHQ DW WKH SRORV GDUN FRYHU UHPDLQV RI DGKHVLYH RQ WKH ERWWRP RI WKH SRORV DQG DW WKH EDFNVLGHRWKHUZLVHLQWDFW




e %URQ]HQHU1DGHONRSIPLW)LJXUHQJUXSSH/HYDQWHFD-W Y&KU+FP5HVWHHLQHV9LHUNDQWVWDEHVGDUDXIHLQH)LJXUHQ JUXSSHEHVWHKHQGDXVHLQHPJU¤gHUHQIURQWDOHQ6WLHUNRSIVRZLH ]ZHL NOHLQHUHQ VHLWOLFKHQ 6WLHUN¤SIHQ $XI GHP JURgHQ 6WLHU NRSIHLQVWHKHQGHV3Â&#x201D;UFKHQGDVVLFKDQGHQ+¤UQHUQIHVWKÂ&#x201D;OW *U©QH3DWLQDDP6FKDIWJHEURFKHQ u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK$XNWLRQ/RV



 Stehende Figur. 3DUWKLVFK  -K Y   -K Q &KU + FP 0Â&#x201D;QQOLFKH )LJXU EHNOHLGHW PLW +RVHQ XQG HLQHU 7XQLND GLH GLH +Â&#x201D;QGH YRU GHP %DXFK JHIDOWHW KDW XQG XP GHQ +DOV HLQH .HWWHXQGDXIGHP.RSIHLQ.DSSHWUÂ&#x201D;JW*U©QH3DWLQDLQWDNW u 3URYHQLHQ]6HLWGHQHU-DKUHQLP%D\HULVFKHQ%HVLW])$0©QFKHQ %URQ]H VWDQGLQJ PDOH }JXUH ZLWK WURXVHUV DQG WXQLFD WKH DUPV IROGHG 3DUWKLDQVWFHQWXU\%&QGFHQWXU\$'*UHHQSDWLQDLQWDFW

%URQ]HSLQKHDGZLWKDJURXSRIWKUHHEXOOKHDGVDQGDVWDQGLQJFRXSOHRQLW /HYDQWQGVWPLOOHQLXP%&*UHHQSDWLQDEURNHQDWWKHVKDIW

237


e 6LW]HQGH%URQ]H}JXU$PODVK-WY&KU " +FDFP6LW]HQGHP”QQOLFKH )LJXUPLWHLQHP=DSIHQDP*HV”gGLH$UPHHUKREHQXQGLQGHU/LQNHQHLQHQ NRQLVFK]XODXIHQGHQ6WDE'XQNHOJU©QH3DWLQDLQWDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLWGHU$XVIXKUJHQHK PLJXQJGHULVUDHOLVFKHQ$QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ/RV %URQ]HVHDWHGPDOH}JXUHZLWKDUPVUDLVHGKROGLQJLQWKHOHIWKDQGDURGDWWKHEHKLQGDSLQ $PODVKVWPLOOHQLXP%& " 'DUNJUHHQSDWLQDLQWDFW

e :HLEOLFKH %URQ]H}JXU/HYDQWH  -W Y &KU + FP :HLEOLFKH QDFNWH VWH KHQGH)LJXUPLW+DOVNHWWHGLHLKUH$UPHDQJHZLQNHOW]XU6HLWHJHVWUHFNWKDW *U©QH3DWLQD9RUGHUDPHJHEURFKHQ u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLWGHU$XVIXKUJHQHK PLJXQJGHULVUDHOLVFKHQ$QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ/RV %URQ]HIHPDOHQDNHG}JXUHZLWKVWUHFKWHGRXWDUPV/HYDQWQGPLOOHQLXP%&*UHHQSDWLQD IRUHDUPVEURNHQ





238

 Standartenaufsatz. /XULVWDQ    -K Y &KU / FP %URQ]H *HGUXQJHQH )RUPPLWHLQHP8QWHUWHLOGDVDXVVWDUNKHUYRUWUHWHQGHQDQWLWKHWLVFKHQ+LQWHU WHLOHQYRQNDW]HQDUWLJHQ7LHUHQ 3DQWKHUQ" JHELOGHWZLUG'DUXQWHUHLQHNXU]H 7©OOHPLW]ZHLVHLWOLFKHQVHQ'DV2EHUWHLOEHVWHKWDXVHLQHPU¤KUHQDUWLJHQ 2EHUN¤USHUPLWHLQHPPHQVFKOLFKHQ-DQXVNRSI6HLWOLFKDXVGHP0LWWHO]\OLQ GHUZDFKVHQGLH+”OVHYRQ3DQWKHUQKHUDXVGLHYRP0HQVFKHQNRSIQDFKDX




gHQVFKDXHQ,P5HOLHIVLQGDXIGHP2EHUN¤USHU GLH 9RUGHUOÂ&#x201D;XIH GHU 3DQWKHU DQJHJHEHQ :LQ]L JHV)UDJPHQWIHKOW u 3URYHQLHQ]6HLWGHQHU-DKUHQLP%D\HULVFKHQ%HVLW] )$0©QFKHQ 9JO*=DKOKDDV/XULVWDQ$QWLNH%URQ]HQDXVGHP,UDQ $XVVWHOOXQJ0©QFKHQ  61U 7RSRID}JXUDOEURQ]HVWDQGDUG$ERYHDPDQOLNH}JXUH ZLWKMDQXVKHDGLQWKHPLGGOHWZRSDQWKHUKHDGVDQGWKH IRUHOHJVRIWKHP$WWKHORZHUHQGWZRKLQGOHJVRISDQWKHUV " /XULVWDQWKWKFHQWXU\%&7LQ\IUDJPHQWPLVVLQJ

 Standartenaufsatz. /XULVWDQ    -K Y &KU /FP%URQ]H'HUXQWHUH7HLOEHVWHKWDXVDQ WLWKHWLVFKHQ7LHUKLQWHUWHLOHQGHUHQ2EHUVFKHQNHO VWDUNRUQDPHQWDODEJHVHW]WVLQG'DUDXIIROJWHLQ PHQVFKOLFKHU -DQXVNRSI DXV GHP VHLWOLFK QDFK XQWHQ EOLFNHQGH +DKQHQN¤SIH ZDFKVHQ 'HQ REHUHQ7HLOELOGHWHLQPHQVFKOLFKHU2EHUN¤USHU PLW-DQXVNRSIXQG]ZHL$UPHQGLHVHLWOLFK]ZHL WLHULVFKH 0LVFKZHVHQ KDOWHQ GLH DXI GHQ +DK QHQN¤SIHQVLW]HQXQGGHUHQ+LQWHUEHLQHLP5H OLHIJHVWDOWHWVLQG*U©QHXQGEUDXQH3DWLQDHLQ 2KUGHV-DQXVNRSIHVIHKOWHLQ+DKQHQVFKQDEHO ZLHGHUDQJHVHW]W u 3URYHQLHQ]6HLWGHQHU-DKUHQLP%D\HULVFKHQ%HVLW] )$0©QFKHQ 9JO*=DKOKDDV/XULVWDQ$QWLNH%URQ]HQDXVGHP,UDQ $XVVWHOOXQJ0©QFKHQ  61U 7RS RI D }JXUDO EURQ]H VWDQGDUG 7KH ORZHU SDUW ZLWK DQWLWKHWLF DQLPDO UHDU SDUWV LQ WKH PLGGOH D MDQXVKHDG ZLWK D URRVWHU KHDG DW HDFK VLGH WKH XSSHU SDUW ZLWK D KXPDQXSSHUERG\ZLWKMDQXVKHDGKROGLQJZLWKKLVDUPV WZRDQLPDOOLNHPL[HGFUHDWXUHVVLWWLQJRQWKHURRVWHUKHDGV /XULVWDQWKWKFHQWXU\%&*UHHQDQGEURZQSDWLQD RQH HDU RI WKH MDQXVKHDG PLVVLQJ EHDN RI RQH URRVWHU UHDWWDFKHG



e %URQ]HVFKZHUWJULII PLW 6WLHUNRSI (ODPLWLVFK "  FD    Y &KU / FP PLW (LVHQGRUQ FP0DVVLYHU%URQ]HYROOJXVV'HU.QDXILQ )RUP HLQHV YROOSODVWLVFKHQ 6WLHUNRSIHV GHVVHQ )HOOLQ.DOWDUEHLWDQJHJHEHQLVW5XQGHU*ULIIPLW HLQHU3DULHUVWDQJHLQ)RUPYRQ]ZHLJHJHQVWÂ&#x201D;QGL JHQ'DXPHQLQGHU0LWWHHLQ(LVHQGRUQ]XU%H IHVWLJXQJGHU.OLQJH'XQNHOJU©QH3DWLQD5HVWH YRQ 6LQWHU (LVHQGRUQ NRUURGLHUW DXI GHU 6WLUQ GHV6WLHUHV%UXFKVWHOOH u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ Los 470. %URQ]HVZRUGKDQGOHZLWKDSRPPHOLQVKDSHRIDEXOOhV KHDGDQGFURVVJXDUGLQVKDSHRIWZRRSSRVLWHWKXPEVLURQ SLQIRU}[LQJWKHEODGH(ODPLWH " DERXW%& 'DUNJUHHQSDWLQDWUDFHVRIVLQWHULURQSLQFRUURGHGGHQW RQWKHIRUHKHDGRIWKHEXOO

440

239


 Wetzstein mit Griff. 2UGRV    -K Y &KU / FP %URQ]H X 6WHLQ(UKDOWHQLVWHLQHELNRQLVFKH 7©OOH PLW VWLOLVLHUWHP 6WHLQERFN 'DULQ HLQ ODQ]HWWI¤UPLJHU :HW] VWHLQ*U©QH3DWLQDLQWDNW u Provenienz: Seit den 1990er Jahren im %D\HULVFKHQ%HVLW])$0©QFKHQ



:KHWVWRQHZLWKEURQ]HKROGHULQVKDSH RIDVW\OL]HGLEH[KHDG2UGRVWKWK FHQWXU\%&*UHHQSDWLQDLQWDFW

442 Wetzsteingriff. /XULVWDQ    -KY&KU/FDFP%URQ]H (UKDOWHQ LVW HLQH 7©OOH PLW 6WHLQ ERFNSURWRPHPLWZHLWDXVVFKZLQ JHQGHQ +¤UQHUQ GLH DP +DOV DQVHW]HQ $XI GHU 7©OOH VLQG LP 5HOLHIGLH9RUGHUEHLQHGHV7LHUHV DQJHJHEHQ,QGHU7©OOH]ZHL/¤ FKHUI©UHLQHQ$XIKÂ&#x201D;QJHULQJ*U© QH3DWLQDHLQ/RFKGHU7©OOHHWZDV DXVJHEURFKHQ u Provenienz: Seit den 1990er Jahren im %D\HULVFKHQ%HVLW])$0©QFKHQ 9JO * =DKOKDDV /XULVWDQ  $QWLNH %URQ]HQ DXV GHP ,UDQ $XVVWHOOXQJ 0©QFKHQ  61U Bronze whetstone holder with an ibex SURWRPH/XULVWDQWKWKFHQWXU\%& *UHHQSDWLQDRQHKROHRIWKHJURPPHW EURNHQRXW

442

240


444 Wetzsteinfragment mit Griff. /X ULVWDQ    -K Y &KU / FD FP %URQ]H X 6WHLQ (UKDOWHQ LVW HLQH 7©OOH PLW 6WHLQERFNSUR WRPH PLW ZHLW DXVVFKZLQJHQGHQ +¤UQHUQ GLH LP 1DFNHQ DQVHW ]HQ$XIGHU7©OOHVLQGLP5HOLHI GLH9RUGHUEHLQHGHV7LHUHVDQJH JHEHQ ,Q GHU 7©OOH ]ZHL /¤FKHU I©U HLQHQ $XIKÂ&#x201D;QJHULQJ ,Q GHU 7©OOHVWHFNWHLQ7HLOGHV:HW]VWHL QHV *U©QH 3DWLQD NOHLQHV /RFK LP*ULII:HW]VWHLQJHEURFKHQ u Provenienz: Seit den 1990er Jahren im %D\HULVFKHQ%HVLW])$0©QFKHQ 9JO * =DKOKDDV /XULVWDQ  $QWLNH %URQ]HQ DXV GHP ,UDQ $XVVWHOOXQJ 0©QFKHQ  61U :KHWVWRQHIUDJPHQWZLWKEURQ]HKROGHU LQVKDSHRIDQLEH[SURWRPH/XULVWDQWK WKFHQWXU\%&*UHHQSDWLQDWLQ\KROH LQWKHLEH[SURWRPHZKHWVWRQHEURNHQ

444

 :HW]VWHLQJULII DXV %URQ]H $FKÂ&#x201D; PHQLGLVFK-KY&KU/FP ,Q)RUPHLQHV:LGGHUNRSIHVPLW 7©OOH $XJHQ XQG 0DXO GXUFK 5LW]XQJ DQJHJHEHQ *U©QH 3DWL QD/RFKGHU7©OOHDXVJHEURFKHQ u 3URYHQLHQ] ([ V©GGHXWVFKH 3ULYDW VDPPOXQJ06HU-DKUH %URQ]HZKHWVWRQHKDQGOHLQVKDSHRID UDPyV KHDG $FKDHPHQLG WK FHQWXU\ %&*UHHQSDWLQDKROHRIWKHWXEHEUR NHQ



241


446 %URQ]HQDGHOPLW3IHUG$PODVFK-KY&KU/FP .RQLVFK ]XODXIHQGHU 6FKDIW PLW HLQHP 1DGHONRSI LQ )RUP HLQHV VWLOLVLHUWHQ SODVWLVFKHQ 3IHUGFKHQV $P EHUJDQJ YRP 6FKDIW]XP3IHUGFKHQHLQ/RFK7HLOVJU©QH3DWLQDLQWDNW u 3URYHQLHQ]([3ULYDWVDPPOXQJ6:&KLHPJDX,QGHQHU-DKUHQLP 0©QFKQHU.XQVWKDQGHOHUZRUEHQ %URQ]HSLQZLWKDKHDGLQVKDSHRIDVW\OL]HGKRUVH$PODVKWKWK FHQWXU\%&3DUWLDOO\JUHHQSDWLQDLQWDFW

447 %URQ]HQHU=HEX6WLHU:HVWDVLDWLVFK+”OIWH-WY&KU / FP + FP 9ROOJXVV ]ZLVFKHQ GHQ +LQWHUEHLQHQ YLHUHFNLJHV*XVVORFK%URQ]HPLWKRKHP.XSIHUJHKDOW6WHKHQGHV 5LQG PLW ODQJJHVWUHFNWHP .¤USHU %HLQHQ PLW DEJHVHW]WHQ +XIHQGHU.RSIPLWDXVHLQDQGHUJHERJHQHQ+¤UQHUQJHVHQNW 'DVWUDSH]I¤UPLJH*HVLFKWPLWGXUFK3XQNWHQKHUYRUJHKREHQHQ $XJHQXQG1©VWHUQGDV0DXOPLWHLQHU.HUEHDQJHJHEHQLP 1DFNHQ HLQ NOHLQHU =HEX%XFNHO SODVWLVFKH +HUYRUKHEXQJ GHV *HVFKOHFKWVWHLOV GHU 6FKZDQ] JHUDGH KHUDEK”QJHQG 7HLOV JU©QH3DWLQDDXIHLQHU6HLWH/¤FKHUYRQ/XIWEODVHQEHLP*XVV DXIHLQHP+XI,QY1ULQWDNW u 3URYHQLHQ]([6DPPOXQJ'U0(EQ¤WKHU6FKZHL]VHLWHUHU -DKUHH[6DPPOXQJ&0RQDFR 446

447

242

%URQ]HFDVWFHEXEXOOZLWKORQJFRUSXVEHWZHHQWKHKLQGOHJVFDVWLQJKROH EURQ]H ZLWK D KLJK FRSSHU FRQWHQW :HVWHUQ $VLDWLF QG  VW KDOI RI VW PLOOHQLXP%&3DUWLDOO\JUHHQSDWLQDRQRQHVLGHFDVWLQJGHIHFWVRQRQH KRRILQYHQWRU\QXPEHULQWDFW


448 6WHLQERFNDXV%URQ]H3DUWKLVFK-K Y &KU / FP 6SULQJHQGHU 6WHLQERFN PLW 6WHJHQ ]ZLVFKHQ GHQ 9RUGHU XQG +LQWHUKXIHQ P¤JOLFKHUZHLVH XUVSU©QJ OLFK GHU *ULII HLQHV *HI”gHV 6FK¤QH JU©QH3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ :HVWIDOHQ HUZRUEHQ LQ GHQ HUQ DXV GHU 6DPPOXQJ3DXO:HEHU3DGHUERUQ HUELV HU-DKUH  %URQ]H LEH[ 3DUWKLDQ UG  VW FHQWXU\ %& -XPSLQJLEH[PD\EHLQLWLDOO\WKHKDQGOHRIDYHVVHO ZLWKIRUHOHJVDQGKLQGOHJVH[WHQGHG1LFHJUHHQ SDWLQDLQWDFW

448

 %URQ]HKLUVFK $PODVFK  -W Y &KU / FP + FP 6WHKHQGHU +LUVFK PLW DXVODGHQGHP *HZHLK XQG ODQJJH]R JHQHP .¤USHU *U©QVFKZDU]H 3DWLQD LQWDNW u 3URYHQLHQ]$XVGHQHKHPDOLJHQ5HVWEHVW”QGHQ GHU 0©Q]KDQGOXQJ .DUO .UHVV 0©QFKHQ YRU 1980. Standing bronze deer with prominent antlers and ORQJFRUSXV$PODVKVWPLOOHQLXP%&*UHHQ EODFNSDWLQDLQWDFW



 +LUVFKDXV%URQ]H$PODVFKFD -K Y &KU / FP + FP 6WHKHQGHU +LUVFKPLWODQJHPJHUDGHP*HZHLKXQG ODQJHP +DOV VH DP 5©FNHQ *U©QH 7¤QXQJLQWDNW u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ :HVWIDOHQ HUZRUEHQ LQ GHQ HUQ DXV GHU 6DPPOXQJ3DXO:HEHU3DGHUERUQ HUELV HU-DKUH  %URQ]H}JXUHRIDVWDQGLQJVWDJZLWKODUJHDQWOHVV DQGZLWKVXVSHQVLRQORRSDWWKHWRS$PODVKWK WKFHQWXU\%&*UHHQSDWLQDLQWDFW



243


 %URQ]HQHU 6WLHU :HVWDVLDWLVFK    -KY&KU/FP+FDFP9ROOJXVV 6WHKHQGHU 6WLHU PLW VSLW]HQ +¤UQHUQ SODVWLVFK JHVWDOWHWHQ $XJHQ 2KUHQ XQG 0DXOVRZLHHULJLHUWHP3HQLVXQGODQJHP KHUDEK”QJHQGHP 6FKZDQ] *U©QH X URWEUDXQH3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ'U0(6FKZHL]VHLW 1970er Jahre. %URQ]HFDVWEXOOZLWKSODVWLFDOH\HVHDUVDQGPRXWK HUHFWHGSHQLVDQGORQJWDLO:HVWHUQ$VLDWLFWK  WK FHQWXU\ %& *UHHQ DQG UHGEURZQ SDWLQD LQWDFW 

 %XFNHOVWLHUDXV%URQ]H$PODVFK -KY&KU/FP+FP%URQ]H}JXU HLQHVVWHKHQGHQ=HEXVPLWHLQHUVHDP 5©FNHQ*U©QH3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ :HVWIDOHQ HUZRUEHQ LQ GHQ HUQ DXV GHU 6DPPOXQJ3DXO:HEHU3DGHUERUQ HUELV HU-DKUH  Bronze zebu bull with suspension loop at the top. $PODVK WK  WK FHQWXU\ %& *UHHQ SDWLQD LQWDFW



 %URQ]HQHU =HEX6WLHU PLW 3XQ]GHNRU $PODVK-KY&KU/FP+ FP 9ROOJXVV 6WLOLVLHUWHV VWHKHQGHV =HEX5LQG PLW GXUFKERKUWHP %XFNHO XQG EHLGVHLWLJHP 'HNRU LQ )RUP YRQ HLQHPPLW3XQNWHQJHI©OOWHP=LFN=DFN %DQG DXI GHP .¤USHU 'LH $XJHQ GHV VFKHLEHQI¤UPLJHQ .RSIHV PLW 3XQNWHQ DQJHJHEHQ *U©QH 3DWLQD DXI HLQHP +LQWHUEHLQ,QY1ULQWDNW u 3URYHQLHQ]([6DPPOXQJ'U0(6FKZHL]VHLW 1970er Jahre.



244

%URQ]HFDVWFHEXEXOOZLWKSXQFKHGGHFRUDWLRQLQ IRUPRID]LJ]DJVWULSHZLWKGRWVRQERWKVLGHVRI WKHFRUSXV$PODVKWKWKFHQWXU\%&*UHHQ SDWLQDRQRQHKLQGOHJLQYHQWRU\QXPEHU LQWDFW




 %URQ]HVWLHU:HVWDVLDWLVFK-WY&KU/FP+FP%URQ ]HYROOJXVV6WHKHQGHU6WLHUPLWOHLFKWJHQHLJWHP.RSIXQGEH ZHJWHU %HLQVWHOOXQJ 'XQNHOJU©QH XQG EUDXQH 3DWLQD HLQ +LQWHUEHLQJHEURFKHQVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV



 Ziege. /XULVWDQ-KY&KU%URQ]HYROOJXVV+FP/ FP6WHKHQGH=LHJHPLW$XIVDW]DXIGHP5©FNHQ'XQNHOJU©QH 3DWLQDLQWDNW u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ:HVWIDOHQHUZRUEHQLQGHQ HUQ DXV GHU 6DPPOXQJ 3DXO :HEHU 3DGHUERUQ HU ELV HU -DKUH 

%URQ]H }JXUH RI D EXOO :HVWHUQ $VLDWLF VW PLOOHQLXP %& *UHHQEURZQ SDWLQDKLQGOHJEURNHQRWKHUZLVHLQWDFW

%URQ]HJRDW/XULVWDQWKWKFHQWXU\%&'DUNJUHHQSDWLQDLQWDFW

 0DVVLYHU%URQ]H$UPUHLI.DXNDVXV(QGH-WY&KUkFP 0DVVLYHU 5HLI GHU ]X GHQ (QGHQ VLFK NRQLVFK YHUHQJW 'LH (QGHQ VLQG PLW JUDYLHUWHP )LVFKJUÂ&#x201D;WPXVWHU GHNRULHUW *U©QH 3DWLQDLQWDNW u

 0DVVLYHU %URQ]H$UPUHLI .DXNDVXV (QGH  -W Y &KU k FP0DVVLYHU5HLIGHU]XGHQ(QGHQVLFKNRQLVFKYHUHQJW 'LH(QGHQVLQGPLWJUDYLHUWHP6WULFKPXVWHUGHNRULHUW*U©QH 3DWLQDLQWDNW u

3URYHQLHQ] ([ 3ULYDWVDPPOXQJ :6 0©QFKHQ LQ HU -DKUHQ LP 0©QFKQHU.XQVWKDQGHOHUZRUEHQ'DYRULP'HXWVFKHQ3ULYDWEHVLW] 'HUDUWLJH%URQ]HUHLIHGLHQWHQZRKOQLFKWQXUDOV6FKPXFNVRQGHUQDXFKDOV =DKOXQJVPLWWHOXQG5RKPDWHULDOI©UGLH%URQ]HYHUDUEHLWXQJ

3URYHQLHQ] ([ 3ULYDWVDPPOXQJ :6 0©QFKHQ LQ HU -DKUHQ LP 0©QFKQHU.XQVWKDQGHOHUZRUEHQ'DYRULP'HXWVFKHQ3ULYDWEHVLW] 'HUDUWLJH%URQ]HUHLIHGLHQWHQZRKOQLFKWQXUDOV6FKPXFNVRQGHUQDXFKDOV =DKOXQJVPLWWHOXQG5RKPDWHULDOI©UGLH%URQ]HYHUDUEHLWXQJ

0DVVLYH EURQ]H EUDFHOHW ZLWK HQJUDYHG KHUULQJERQH SDWWHUQ DW WKH RSHQ HQGLQJV&DXFDVXVHQGRIQGPLOOHQLXP%&*UHHQSDWLQDLQWDFW

0DVVLYH EURQ]H EUDFHOHW ZLWK HQJUDYHG KHUULQJERQH SDWWHUQ DW WKH RSHQ HQGLQJV&DXFDVXVHQGRIQGPLOOHQLXP%&*UHHQSDWLQDLQWDFW





245


 %URQ]HDUPUHLIPLW'UDFKHQNRSIHQ den. 8UDUWXY&KU k FP %URQ]HYROOJXVV :LHGHU ]XVDPPHQJHVHW]W u 3URYHQLHQ]([6DPPOXQJ++%D\HUQ vor 1970. 0DVVLYH EURQ]H EUDFHOHW ZLWK GUDJRQ KHDGV8UDUWX%&5HDV sembled.



e 3DDU $UPUHLIH .DXNDVLVFK "   -WY&KUkFP6LOEHU0DV VLYHRIIHQH$UPUHLIHPLWUXQGHP 4XHUVFKQLWWGHUHQ(QGHQLQ6SL UDOHQ ©EHUJHKHQ GLH PLWHLQDQGHU YHUEXQGHQ VLQG %UDXQH 3DWL QD7HLOHGHU6SLUDOHQIHKOHQ u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ    ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ$QWLNHQEHK¤UGH%HL*RUQ\ 0RVFK$XNWLRQ/RV 3DUDOOHOVW©FNH LQ 6RWKHE\yV /RQGRQ $QWLTXLWLHV  'H]  ORW  5RPDQ 



3DLURIVLOYHUEUDFHOHWVZLWKVSLUDOHQGLQJV MRLQWHGZLWKHDFKRWKHU&DXFDVLDQ "  VWPLOOHQLXP%&%URZQJUHHQSDWLQD IUDJPHQWVRIWKHVSLUDOVPLVVLQJ

e 3DDU $UPUHLIH .DXNDVLVFK "   -WY&KUkFP6LOEHU0DV VLYHRIIHQH$UPUHLIHPLWUXQGHP 4XHUVFKQLWWGHUHQ(QGHQLQ6SL UDOHQ ©EHUJHKHQ GLH PLWHLQDQGHU YHUEXQGHQ VLQG %UDXQH 3DWL QD7HLOHGHU6SLUDOHQIHKOHQ u

460

3URYHQLHQ]([6KORPR0RXVVDLHII&ROO HFWLRQ([SRUWLHUWPLWGHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ/RV 3DLURIVLOYHUEUDFHOHWVZLWKVSLUDOHQGLQJV MRLQWHGZLWKHDFKRWKHU&DXFDVLDQ "  VWPLOOHQLXP%&%URZQJUHHQSDWLQD VSLUDORIRQHEUDFHOHWPLVVLQJ

246


 .HXOHQNRSI DXV %URQ]H :HVWD VLDWLVFK  -W Y &KU + FP 9ROOJXVV =\OLQGULVFKHU 6FKDIW PLW SUR}OLHUWHQ (QGHQ DP REH UHQ(QGH]XV”W]OLFKGUHL1RSSHQ 8P GHQ 6FKDIW HLQ 5LQJ DXV S\ UDPLGDOHQ 6SLW]EXFNHOQ 0LW %H stimmungszettel des Sammlers! *U¤gWHQWHLOVJU©QH3DWLQDLQWDNW u Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017. %URQ]HPDFHKHDGZLWKF\OLQGULFDOVKDIW DQG ULQJ RI S\UDPLGDO NQREV :HVWHUQ $VLDWLFQGPLOOHQLXP%&0RVWO\JUHHQ SDWLQDLQWDFW:LWKFROOHFWRUyVQRWH 

462 %URQ]HQH6FKHLQD[W/XULVWDQ   -K Y &KU / FP +RKH 7©OOH DXV GHU GDV PLW /HLVWHQ YHUVW”UNWH %ODWW Z”FKVW 'LH REH UH .RQWXU GHV %ODWWHV LVW OHLFKW JHZ¤OEW GLH 6FKQHLGHw JHUDGH GLHXQWHUH.RQWXUVFKZLQJWVWDUN QDFKXQWHQ$XIGHU7©OOHVFKU” JH/HLVWHQLP1DFNHQVLW]HQYLHU GXUFK HLQHQ 6WHJ YHUEXQGHQH 6SLW]HQ*U©QH3DWLQDLQWDNW u Provenienz: Seit den 1990er Jahren im %D\HULVFKHQ%HVLW])$0©QFKHQ 9JO * =DKOKDDV /XULVWDQ  $QWLNH %URQ]HQ DXV GHP ,UDQ $XVVWHOOXQJ 0©QFKHQ  61U %URQ]HFHUHPRQLDOD[H/XULVWDQWK WKFHQWXU\%&*UHHQSDWLQDLQWDFW 462

 5DQGOHLVWHQGROFK DXV %URQ]H /XULVWDQ    -K Y &KU / FP $XV HLQHP 6W©FN JHJRV VHQ *ULII PLW 5DQGOHLVWHQ XQG KDOEPRQGI¤UPLJHP REHUHQ $E VFKOXVV DP EHUJDQJ ]XP %ODWW HLQH KDOEPRQGI¤UPLJ JHERJHQH /HLVWH ODQ]HWWI¤UPLJHV %ODWW PLW 0LWWHOULSSH XQG ]ZHL VHLWOLFKHQ 5LOOHQ 0LW %HVWLPPXQJV]HWWHO des Sammlers! *U©QH 3DWLQD DP 6FKDIW .OLQJH JU¤gWHQWHLOV PHV VLQJIDUEHQLQWDNW u



Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017. %URQ]H IXOO FDVW GDJJHU /XULVWDQ WK WKFHQWXU\%&*UHHQSDWLQDRQWKH VKDIWEODGHPRVWO\EUDVVFRORUHGLQWDFW :LWKFROOHFWRUyVQRWH

247


464 5DQGOHLVWHQGROFK DXV %URQ]H /XULVWDQ    -K Y &KU / FP $XV HLQHP 6W©FN JHJRVVHQ *ULII PLW 5DQGOHLVWHQ XQG KDOE PRQGI¤UPLJHP REHUHQ $EVFKOXVV HUKDO WHQ VLQG 5HVWH GHU (LQODJH DXV %HLQ "  DP EHUJDQJ ]XP %ODWW HLQ KRUL]RQWDOHU $E VDW] ODQ]HWWI¤UPLJHV %ODWW PLW OHLFKW HUKDEH QHU 0LWWHOULSSH 0LW %HVWLPPXQJV]HWWHO GHV Sammlers! *U¤gWHQWHLOV JU©QEUDXQH 3DWLQD 5HVWHGHU*ULIIHLQODJHHUKDOWHQNOHLQHV/RFK LP*ULIIVRQVWLQWDNW u Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017. %URQ]HIXOOFDVWGDJJHU/XULVWDQWKWKFHQWXU\ %& *UHHQEURZQ SDWLQD WUDFHV RI WKH KDQGOH LQOD\ ERQH" WLQ\KROHLQWKHKDQGOHRWKHUZLVHLQWDFW:LWK FROOHFWRUyVQRWH 464

 $FK”PHQLGLVFKHU %URQ]HGROFK    -K Y &KU / FP .OLQJH PLW SUR}OLHUWHP 0LWWHOJUDW *U©QH 3DWLQD PLW PRGHUQHP +RO]JULII u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ+:HUZRUEHQ bei der Galerie Pax Romana, London; aus einer alten %ULWLVFKHQ6DPPOXQJ $FKDHPHQLG EURQ]H GDJJHU WK  WK FHQWXU\ %& Green patina, with modern wodden handle.



466 %URQ]HQH/DQ]HQVSLW]H9RUGHUDVLDWLVFK -KY&KU/FP*URgHVVSLW]RYDOHV %ODWWGDUDXIEHLGVHLWLJHFNLJHU0LWWHOJUDWGHU QDKWORV LQ GLH UXQGH VFKPDOH XQG HLQVHLWLJ JHVSDOWHWH7©OOHDXVO”XIW$QGHUHQ(QGHHLQH P¤JOLFKHUZHLVH VS”WHU DQJHEUDFKWH 6FKHOOH 6FK¤QHGXQNHOJU©QH3DWLQDLQWDNW u 3URYHQLHQ] $XV GHU ZHVWGHXWVFKHQ 3ULYDWVDPPOXQJ :5 JHNDXIW  DXV GHU QLHGHUUKHLQLVFKHQ 3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ %URQ]HVSHDUKHDG:HVWHUQ$VLDWLFWKWKFHQWXU\ %&1LFHGDUNJUHHQSDWLQDLQWDFW

466

e 'XUFKEURFKHQHU%URQ]H]\OLQGHUPLW6WLHUXQG Wildschaf. :HVWDVLDWLVFK  -W Y &KU + FPkFP%LNRQLVFKHVGXUFKEURFKHQ JHDUEHLWHWHV*HI”gDXV%URQ]HEOHFKPLWPDV VLYHQJHJRVVHQHQ5LQJHQDOVREHUHPXQGXQ WHUHP$EVFKOXVV'LH'DUVWHOOXQJLVWLQGUHL %HUHLFKHJHWHLOW2EHQXQGXQWHQMHZHLOVHLQ %DQGPLW]XQJHQI¤UPLJHQ$XVVSDUXQJHQLQ GHU0LWWHHLQ6WLHUXQGHLQ:LOGVFKDI5HVWH YRQ6LQWHUHWZDVHLQJHGU©FNWDQ]ZHL6WHOOHQ JHEURFKHQNOHLQHV/RFKLQHLQHP6WLHU u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ ([SRUWLHUWPLWGHU$XVIXKUJHQHKPLJXQJGHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ/RV

248


467

468

%LFRQLFDORSHQZRUNHGYHVVHORIEURQ]HVKHHWZLWKWZR massive rings at the ends. In the upper and lower part DNLQGRIWRQJXHVIULH]HLQWKHFHQWHUDEXOODQGDZLOG VKHHS:HVWHUQ$VLDWLFQGPLOOHQLXP%&7UDFHVRI VLQWHUSDUWLDOO\FUXVKHGEURNHQLQWZRSRLQWVRQHWLQ\ hole in the bull.

468 6LOEHUVFKDOH PLW }J©UOLFKHU 'DUVWHOOXQJ /XULVWDQ " -WY&KUkFP*URgH ~DFKH 6FKDOH PLW JHWULHEHQHP 'HNRU 'LH :DQGXQJ PLW QDFK DXgHQ JHWULHEHQHQ 5HLKHQ YRQ 3XQNWHQ VLFK DEZHFKVHOQGHQ +DOENXJHOQ XQG 7URSIHQ VRZLH 5DXWHQ ,P 7RQGR QDFK LQQHQ JHWULHEHQHU }J©UOLFKHU 'HNRULQ)RUPHLQHV0LVFKZHVHQDXVHLQHP PHQVFKOLFKHQ.RSIHLQHU0DVNHXQGHLQHP 6WLHUNRSI ~DQNLHUW YRQ ]ZHL DQWLWKHWLVFKHQ JH~©JHOWHQ 6WHLQE¤FNHQ $XI GHQ +¤UQHUQ GHU 6WHLQE¤FNH GHQ =ZLVFKHUÂ&#x201D;XPHQ VRZLH GHP5DQGGHV7RQGR3XQNWEXFNHO,QWDNW u 3URYHQLHQ]([6DPPOXQJ'U0(EQ¤WKHU6FKZHL] seit 1970er Jahre. )ODWVLOYHUERZOZLWKKDPPHUHGGHFRUDWLRQZLWKURZV RIEXFNOHVDOWHUQDWLQJKHPLVSKHUHVDQGGURSVDQGOR ]HQJHVGULYHQRXWZDUGV,QWKHWRQGR}JXUDOGHFRULQ IRUPRIDPL[HGFUHDWXUHZLWKDKXPDQKHDGDPDVN DQGDEXOOyVKHDG~DQNHGE\WZRDQWLWKHWLFDOZLQJHG LEH[HV,QEHWZHHQRQWKHKRUQVRIWKHLEH[HVDQGRQ WKHERWWRPRIWKHWRQGREXFNOHV7KHGHFRURIWKHWRQ GR GULYHQ LQZDUGV /XULVWDQ "  VW PLOOHQLXP %& ,QWDFW

249


 %URQ]HQH2PSKDORVVFKDOH:HVWDVLDWLVFK -KY&KU+FPkFP$XV JHWULHEHQHU %URQ]H )ODFKH 6FKDOH PLW JHZ¤OEWHU :DQGXQJ XQG DXVJHSUÂ&#x201D;JWHP 2PSKDORVLP=HQWUXPXQGGUHLNRQ]HQ WULVFKHQ.UHLVHQGDUXP5DQGOHLFKWQDFK LQQHQJHERJHQ*U©QH3DWLQDHLQPRGHU QHV $XIKÂ&#x201D;QJXQJVORFK LQ GHU :DQGXQJ VRQVWLQWDNW u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ   /RV  H[ 6DPPOXQJ )$ %D\HUQ H[ +LUVFK1DFKIROJHU$XNWLRQ/RV



6KDOORZ EURQ]H ERZO ZLWK D FHQWUDO RPSKDORV DQGVXUURXQGLQJWKUHHFRQFHQWULFFLUFOHV:HVWHUQ $VLDWLF WK  WK FHQWXU\ %& *UHHQ SDWLQD PRGHUQKROHIRUVXVSHQVLRQRWKHUZLVHLQWDFW

470 %URQ]HQH 6FKDOH $FKÂ&#x201D;PHQGLVFK    -KY&KUkFP+FP$XVJH WULHEHQHU %URQ]H )ODFKHU QDFK LQQHQ OHLFKW HLQJH]RJHQHU %RGHQ PLW NXU]HU VWHLOHU :DQGXQJ GDYRQ DEJHVHW]W GHU QDFKDXgHQNUDJHQGH5DQG$XIGHP%R GHQ HLQ VWUDKOHQI¤UPLJHV =XQJHQPXVWHU PLWHLQHU5RVHWWHLP=HQWUXP*U©QH3D WLQDLQWDNW u 3URYHQLHQ]([3ULYDWVDPPOXQJ+)0©QFKHQLQ GHQHUHU-DKUHQLP.XQVWKDQGHOHUZRUEHQ 6KDOORZ EURQ]H ERZO ZLWK HPERVVHG GHFRUDWLRQ RQ WKH XQGHUVLGH VKRZLQJ D FHQWUDO URVHWWH DQG UDGLDWLQJWRQJXHV$FKDHPHQLGWKWKFHQWXU\ %&*UHHQSDWLQDLQWDFW 470

 Figürliche Spendenschale. $FKÂ&#x201D;PHQL GLVFK-KY&KU/FPkFP 'XQNHOJUDXHU.DONVWHLQ.OHLQH6SHQGHQ VFKDOH PLW GXUFKERKUWHP *ULII LQ )RUP HLQHV/¤ZHQNRSIHV,P*ULIIJHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ :HVWIDOHQHUZRUEHQ]ZLVFKHQELV )LJXUDORIIHULQJERZOPDGHRIGDUNJUH\OLPHVWRQH ZLWK OLRQ KHDG $FKDHPHQLG WK FHQWXU\ %& %URNHQDWWKHKDQGOH 

250


472 Kanne. 8UDUWX-KY&KU(LQKHQ NHOLJH ELNRQLVFKH .DQQH PLW .OHHEODWW P©QGXQJ + FP k FP 5HG %XUQLVKHG:DUHPLWJUDYLHUWHP'HNRULQ )RUP YRQ =XQJHQ DXI GHU 6FKXOWHU XQG ]ZHL5HLKHQYRQGRSSHOWHQ+DOEPRQGHQ ,QWDNW u 3URYHQLHQ] $XV GHU 6DPPOXQJ 'U 60 1LHGHUED\HUQVHLWGHQHU-DKUHQ 2QHKDQGOHGELFRQLFDOMXJZLWKWKUHHIRLOHGVSRXW RI WKH 5HG %XUQLVKHG :DUH 8UDUWX WK  WK FHQWXU\%&2QWKHVKRXOGHUHQJUDYHGGHFRULQ IRUPRIWRQJXHVDQGWZRURZVRIGRXEOHFUHVFHQWV ,QWDFW

472

 GroÃ&#x;er Topf. 5HJLRQ'DVFKWH/XW-W Y&KU+FPkFP+HOOEUDXQHU 7RQPLWURWHUXQGVFKZDU]HU%HPDOXQJ %DXFKLJHU 7RSI PLW NOHLQHU 0©QGXQJ XQG NOHLQHU DXVNUDJHQGHU /LSSH $XI GHU 6FKXOWHU ]ZLVFKHQ URWHQ /LQLHQ YLHU VFKZDU]H 'UHLHFNVEÂ&#x201D;QGHU GDUXQWHU DXI GHP%DXFKEUHLWHURWH/LQLHQMit Quit WXQJGHU*DOHULHLQ)UDQNIXUW .RSLH (LQ :DQGXQJVIUDJPHQW JHEURFKHQ XQG ZLH GHUHLQJHVHW]W]ZHL5LVVH u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ   /RV  DXV GHU 6DPPOXQJ .)7 1RUGUKHLQ:HVWIDOHQ  EHL GHU *DOHULH I©U *ULHFKLVFKH5¤PLVFKHXQG%\]DQWLQLVFKH.XQVW )UDQNIXUWD0HUZRUEHQ Large pot with small mouth and lip. Bright brown WHUUDFRWWDZLWKUHGDQGEODFNSDLQWLQJLQIRUPRI OLQHVDQGURZVRIWULDQJOHV$UHDRIWKH'DVFKWH /XWUGPLOOHQLXP%&2QHIUDJPHQWRIWKHZDOO LVEURNHQDQGUHDWWDFKHGWZRFUDFNV:LWKUHFHLSW RIWKH*DOHULHLQ)UDQNIXUW FRS\ 



251


474

474 Vase mit Tieren. $QDWROLVFK $QIDQJ  -W Y &KU + FP k FP DQ GHU 0©QGXQJ 5RWEUDXQHU 7RQ PLW EHLJHP EHU]XJ XQG %HPDOXQJ LQ URWEUDXQ XQG GXQNHOEUDXQ )ODFKHU %RGHQEDXFKLJHU&RUSXVPLWHLQHP NXU]HQ+DOVXQGDXVNUDJHQGHU0©Q GXQJ$EGHP]ZHLWHQ'ULWWHO%HPD OXQJLQ)RUPYRQ+LUVFKHQ*D]HOOHQ 6WHLQE¤FNHQ6WLHUHQXQG/DXIY¤JHOQ $XI GHP +DOV 5DXWHQPXVWHU GLH 0©QGXQJRKQH%HPDOXQJMit Rech nung und Katalogabbildung der Gale ULH *©QWHU 3XK]H YRQ  .RSLH  0HKUHUH5DQGDXVEU©FKH2EHU~”FKH HWZDVEHULHEHQVRQVWLQWDNW u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ 256, 2018, Los 478; ex Galerie Puhze, Katalog 6, 1986, Nr. 161.



252

%HOOLHG YHVVHO PDGH RI UHGEURZQ FOD\ ZLWK EHLJH VOLS DQG GDUN EURZQ DQG UHGEURZQ SDLQWLQJRQWKHFRUSXVGLIIHUHQWDQLPDOVOLNH deers, gazelles, ibexes, bulls and ratites, lozen JHSDWWHUQDWWKHQHFN$QDWROLDQEHJLQQLQJ RI VW PLOOHQLXP %& 6HYHUDO IUDJPHQWV DW WKHPRXWKPLVVLQJVXUIDFHZRUQRWKHUZLVH LQWDFW:LWKLQYRLFHDQGFDWDORJSXEOLFDWL RQRIWKH*DOHULH*©QWHU3XK]H)UHLEXUJ 


 +HQNHONDQQH+HWKLWLVFKFDY&KU + FP $XV U¤WOLFKHP 7RQ PLW URWHP EHU]XJ $XI NOHLQHP DEJHVHW]WHP %R GHQ PLW EDXFKLJHP &RUSXV PLW .QLFN HLQHP+HQNHOXQGVSLW]HP6FKQDEHODXV JXVV +HQNHO ]XVDPPHQ XQG ZLHGHU DQJHVHW]W $XVJXVV EHVWRgHQ 5HVWH YRQ 6LQWHU u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ 3URI'U-0HUZRUEHQ]ZLVFKHQXQG 2QHKDQGOHMXJRIUHGGLVKFOD\ZLWKUHGVOLSDQG DEHDNHGVSRXW+LWWLWHDERXW%&+DQGOH UHDVVHPEOHGDQGUHDWWDFKHGVSRXWZLWKFKLSVDW WKHHGJHVUHPDLQVRIVLQWHU

476 .UXJPLWJHRPHWULVFKHU%HPDOXQJ3KU\JL HQ-WY&KU+FP$XVU¤WOLFKHP 7RQPLWEHLJHPEHU]XJXQG%HPDOXQJ LQ 5RW XQG 'XQNHOEUDXQ )ODFKHU UXQ GHU6WDQGERGHQEDXFKLJHU&RUSXV.OHH EODWWP©QGXQJ PLW 6FKQDEHODXVJXVV XQG EUHLWHP %DQGKHQNHO *HRPHWULVFKH %H PDOXQJ LQ HLQHP %LOGIHOG DXI GHP &RU SXVXQGGHP+DOVLQ)RUPYRQ6WUHLIHQ XQG =LFN=DFN :LQ]LJH )UDJPHQWH IHK OHQ DP $XVJXVV XQG DP REHUHQ +HQ NHODQVDW]%HVWRgXQJHQDXIGHP&RUSXV u

476

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ 3URI'U-0HUZRUEHQ]ZLVFKHQXQG 2QHKDQGOHMXJRIUHGGLVKFOD\ZLWKEHLJHVOLSDQG JHRPHWULFDOSDLQWLQJLQUHGDQGGDUNEURZQ)ODW ERWWRPHGEHOOLHGMXJZLWKWUHIRLOPRXWKRIZKLFKWKH IURQWOREHLVGUDZQRXWWRDEHDNHUVSRXW3KU\JLDQ VWPLOOHQLXP%&7LQ\FKLSVDWWKHKDQGOHDQG WKHEHDNHUVSRXWWZRFKLSVDWWKHERG\

477 5K\WRQLQ)XgIRUP8UDUWX-WY&KU+ FPkREHQFP/)XgFP+HOO EHLJHU 7RQ PLW %HPDOXQJ LQ RFNHU XQG PLWWHOEUDXQ .RQLVFK ]XODXIHQGHU 6FKDIW PLW 5HVWHQ GHU %HPDOXQJ LQ )RUP YRQ =LFN]DFNXQG/LQLHQ©EHUGHPSODVWLVFK JHVWDOWHWHQ )Xg PLW $QJDEH GHU =HKHQ HLQ :XOVW GHU HLQHQ )XgULQJ GDUVWHOOHQ VROO 'DV 5K\WRQ GLHQWH DOV 7ULQNJHI”g 0LW%HVWLPPXQJV]HWWHOGHV6DPPOHUVXQG Unterlagen der Galerie Grunow! $Q ]ZHL NOHLQHQ6WHOOHQEHVWRgHQVRQVWLQWDNW u Provenienz: Ex Slg. V. S., Berlin, erworben bei Galerie Grunow Liste 31, 1993, Nr. 1090. &OD\UK\WRQLQVKDSHRIDFKLOGyVIRRWZLWKDEXOJH DERYHWKHDQNOHLPLWDWLQJDIRRWULQJ8UDUWXVW PLOOHQLXP%&7ZRWLQ\VSRWVZRUQRIIWUDFHVRI SDLQWLQJRWKHUZLVHLQWDFW:LWKFROOHFWRUyVQRWH DQGGRFXPHQWVRIWKH*DOHULH*UXQRZ

477

253


478

478 'RSSHOJHI”g-WY&KUkFP%FDFP$XVJUDXHP7RQ =ZHLNOHLQHELNRQLVFKH*HI”gHPLW~DFKHP%RGHQXQGDXVNUD JHQGHU0©QGXQJGLHPLWHLQDQGHUYHUEXQGHQVLQG0LW%HVWLP mungszettel des Sammlers! 5HVWHYRQ6LQWHUZLQ]LJH)UDJPHQWH IHKOHQLQWDNW u Provenienz: Ex Sammlung V.S., Berlin, 1980er Jahre bis 2017.

NXU]HP+DOVXQG6FKQDEHODXVJXVV$XIGHU6FKXOWHUHLQJHULW]WHU =LFN=DFN'HNRUGHU]XP+DOVKLQPLW5LOOHQDEVFKOLHgW5HVWH YRQ 6LQWHU LQWDNW G  + FP .OHLQHU 7RSI PLW EDXFKLJHP &RUSXV NOHLQHU QDFK LQQHQ JHZ¤OEWHU 6WDQG~”FKH NXU]HP +DOV XQG DXVNUDJHQGHU 0©QGXQJ $XI GHP &RUSXV JHULW]WHU =LFN=DFN'HNRU5LOOHQVRZLHYLHU1RSSHQ,QWDNW6W©FN u

'RXEOHYHVVHORIJUH\FOD\VWPLOOHQLXP%&7UDFHVRIVLQWHUWLQ\IUDJPHQWV PLVVLQJLQWDFW:LWKFROOHFWRUyVQRWH

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3URI'U-0HUZRUEHQ ]ZLVFKHQXQG

 6DPPOXQJ<RUWDQ*HI”gHY&KU$XVEHLJHP7RQ PLWVFKZDU]HPRGHUJUDXHPEHU]XJD +FP(LQKHQNHOLJHU .UXJ PLW EDXFKLJHP &RUSXV RKQH 6WDQG~”FKH NXU]HP +DOV XQGUXQGHP$XVJXVVPLW~DFKHP5DQGVRZLHGUHLSODVWLVFKHQ YHUWLNDOHQ5LSSHQDXIGHP&RUSXV=ZHL5DQGIUDJPHQWHZLHGHU DQJHVHW]W E  + FP (LQKHQNHOLJHU .UXJ PLW EDXFKLJHP &RUSXV~DFKHU6WDQG~”FKHNXU]HP+DOVXQGWULFKWHUI¤UPLJHP $XVJXVV$XIGHP&RUSXVHLQJHULW]WHU=LFN=DFN'HNRUVRZLH DP+DOVYLHUNOHLQH1RSSHQ5HVWHYRQ6LQWHULQWDNWF +FP (LQKHQNHOLJHU.UXJPLWEDXFKLJHP&RUSXV~DFKHU6WDQG~”FKH

&ROOHFWLRQRI<RUWDQFHUDPLFVD 2QHKDQGOHMXJZLWKWKUHHYHUWLFDOULEV7ZR IUDJPHQWVRIWKHPRXWKUHDWWDFKHGE 2QHKDQGOHMXJZLWKFDUYHG]LJ]DJ DQGIRXUNQREVDWWKHQHFN7UDFHVRIVLQWHULQWDFWF 2QHKDQGOHMXJZLWK EHDNHGVSRXWDQGFDUYHG]LJ]DJDQGJURRYHV7UDFHVRIVLQWHULQWDFWG 6PDOO YHVVHOZLWKFDUYHG]LJ]DJJURRYHVDQGIRXUNQREV,QWDFW%& SLHFHV

480 6DPPOXQJ <RUWDQ*HI”gH    Y &KU $XV U¤WOLFKHQ RGHUEHLJHP7RQPLWVFKZDU]HPRGHUJUDXEUDXQHPEHU]XJ D  + FP (LQKHQNHOLJHU .UXJ PLW EDXFKLJHP &RUSXV RKQH



254


480

WLQ\ULPIUDJPHQWPLVVLQJFKLSVDWWKHPRXWKG 7ZRKDQGOHYHVVHOZLWK FDUYHG]LJ]DJDQGOLQHV7UDFHVRIVLQWHUFKLSVDWWKHPRXWKWLQ\ULPIUDJPHQW PLVVLQJH 2QHKDQGOHMXJ&KLSVDWWKHVSRXW%&SLHFHV

6WDQG~”FKHNXU]HP+DOVXQGDXVNUDJHQGHU0©QGXQJ.OHLQH %HVWRgXQJHQE +FP=ZHLKHQNHOLJHU7RSIPLWEDXFKLJHP &RUSXV RKQH 6WDQG~”FKH XQG ]ZHL 1RSSHQ DXI GHU 6FKXOWHU LQGHQ+HQNHOQMHZHLOV]ZHL$XIK”QJHO¤FKHU5HVWHYRQ6LQWHU ZLQ]LJHV5DQGIUDJPHQWIHKOWF +FP=ZHLKHQNHOLJHU7RSI PLWEDXFKLJHP&RUSXV~DFKHU6WDQG~”FKHNXU]HPNRQLVFKHQ +DOV XQG DXVNUDJHQGHU 0©QGXQJ $XI GHP &RUSXV HLQJHULW] WHU =LFN=DFN'HNRU 5HVWH YRQ 6LQWHU 0©QGXQJ EHVWRgHQ HLQZLQ]LJHV5DQGIUDJPHQWIHKOWG +FP=ZHLKHQNHOLJHU 7RSIPLWEDXFKLJHP&RUSXV~DFKHU6WDQG~”FKHNXU]HP+DOV XQGDXVNUDJHQGHU0©QGXQJ$XIGHP&RUSXVHLQJHULW]WHU=LFN =DFN'HNRUDXIGHP+DOV6WULFNGHNRU5HVWHYRQ6LQWHU0©Q GXQJ EHVWRgHQ HLQ ZLQ]LJHV 5DQGIUDJPHQW IHKOW H  + FP (LQKHQNHOLJHU.UXJPLW]\OLQGULVFKHP+DOV$QGHU0©QGXQJ EHVWRgHQ6W©FN u

 .OHLQH .HUDPLN6DPPOXQJ $ODFD +¤\©N  -W Y &KU D  + FP$XVU¤WOLFKHQ7RQPLWURWHPEHU]XJ%LNRQLVFKHU7RSI PLW~DFKHUUXQGHU6WDQG~”FKHXQGNXU]HP]\OLQGULVFKHP+DOV +DOVLQPHKUHUH)UDJPHQWHJHEURFKHQXQGZLHGHUDQJHVHW]WE  +FP$XVEHLJHP7RQPLWEHLJHPEHU]XJ/HLFKWELNRQL VFKHU7RSIPLW]ZHLNOHLQHQ1RSSHQDXIGHU6FKXOWHUXQGZHL WHU0©QGXQJ$P5DQGPLQLPDOEHVWRgHQF +FP$XV EHLJHP7RQPLWU¤WOLFKHPEHU]XJ%DXFKLJHU7RSIPLWZHLWHU 0©QGXQJ$P5DQGPLQLPDOEHVWRgHQ6W©FN u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3URI'U-0HUZRUEHQ ]ZLVFKHQXQG

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3URI'U-0HUZRUEHQ ]ZLVFKHQXQG

&ROOHFWLRQRI$ODFD+¤\©NFHUDPLFVD %LFRQLFDOYHVVHO1HFNUHDVVHPEOHGE  %LFRQLFDOYHVVHOZLWKWZRNQREVDWWKHVKRXOGHU7LQ\FKLSVDWULPF %HOOLHG YHVVHO7LQ\FKLSVDWULPWKPLOOHQLXP%&SLHFHV

&ROOHFWLRQRI<RUWDQFHUDPLFVD 2QHKDQGOHMXJ7LQ\FKLSVE 7ZRKDQGOH YHVVHO ZLWK WZR NQREV DQG KROHV LQ WKH KDQGOH 7UDFHV RI VLQWHU WLQ\ ULP IUDJPHQWPLVVLQJF 7ZRKDQGOHYHVVHOZLWKFDUYHG]LJ]DJ7UDFHVRIVLQWHU



255


8581')5+*(6&+,&+7(

482

482 9LQFD,GROFDY&KU+FP'XQNHOEUDXQHU7RQ PLW5LW]GHNRU6WHKHQGHZHLEOLFKH)LJXUPLW$UPVWXPPHOQMit 7/$QDO\VH.RSILP+DOVJHEURFKHQXQGZLHGHUDQJHVHW]W u

256

3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ-66©GGHXWVFKODQGHUZRUEHQHU ELVHU-DKUHLPHQJOLVFKHQ.XQVWKDQGHO )HPDOH9LQFDLGROPDGHRIGDUNEURZQFOD\ZLWKLQFLVHGJHRPHWULFDOGHFRU $ERXW%&+HDGDWWKHQHFNEURNHQDQGUHDWWDFKHG:LWK7/ DQDO\VLV


483

483 Bronzearmreif mit Ritzdekor. Mitteleuropa, Bronze ]HLW-KY&KUkFDFP%URQ]HJXVV0DVVL YHU$UPUHLIPLWNRQLVFK]XODXIHQGHQRIIHQHQ(QGHQ XQGUHLFKHP5LW]GHNRULQ)RUPYRQJHRPHWULVFKHQ 0XVWHUQDXIGHUJHVDPWHQ$XgHQVHLWHPrachtexem plar! 'XQNHOJU©QH 3DWLQD ]ZHL ZLQ]LJH /¤FKHU DQ GHQ(QGHQ u Provenienz: Ex Privatsammlung S.W., Chiemgau, in den 1980er Jahren im Münchner Kunsthandel erworben. Massive bronze bracelet with open endings and rich engraved decoration with geometric patterns. Middle Europe, Bronze $JHWKWKFHQWXU\%&'DUNJUHHQSDWLQDWLQ\KROHDWHDFK ending. 9HU\}QHH[DPSOH

484 Bronzearmreif. 0LWWHOHXURSD %URQ]H]HLW    -K Y &KU k FP %URQ]HJXVV 0DVVLY PLW NRQLVFK ]XODXIHQGHQ©EHUHLQDQGHUOLHJHQGHQ(QGHQXQG5LH IHOGHNRU'XQNHOJU©QH3DWLQDLQWDNW u

484

Provenienz: Ex Privatsammlung S.W., Chiemgau, in den 1980er Jahren im Münchner Kunsthandel erworben. Massive bronze bracelet with ribbed decoration. Middle Europe, %URQ]H$JHWKWKFHQWXU\%&'DUNJUHHQSDWLQDLQWDFW

 Bronzearmreif mit Dekor. *HRPHWULVFK-KY&KU k FP 3UR}OLHUWHU 5HLI GHU VLFK ]X GHQ (QGHQ YHUM©QJWDXIJHERJHQXQGPLWJHRPHWULVFKHP5LW]GH NRUYHUVHKHQLVW'LHRIIHQHQ(QGHQOLHJHQ©EHUHLQ DQGHUBekannter geometrischer Typus!6FK¤QHJU©QH 3DWLQDLQWDNW u 3URYHQLHQ] ([ 3ULYDWVDPPOXQJ 'U *0 0©QFKHQ H[ Privatsammlung S.W., Chiemgau, in den 1990er Jahren erworben. 9JO 0HWURSROLWDQ 0XVHXP RI $UW 1HZ <RUN $FFHVVLRQ Number 1998.25.



%URQ]H EUDFHOHW ZLWK RYHUODSSLQJ DQG VOLJKWO\ WDSHULQJ HQGV DQGHQJUDYHGJHRPHWULFSDWWHUQ*HRPHWULFWKFHQWXU\%& Attractive green patina, intact. :HOONQRZJHRPHWULFW\SH

257


486 %URQ]H$UPUHLI .HOWLVFK /D 7Â&#x2122;QH-KY&KUkFP 0DVVLYHU 5HLI DXV WRUGLHUWHP 'UDKW PLW GUHL 5LQJHQ XQG .X JHOGHNRU*UŠQH3DWLQDDQHLQHP 5LQJJHNOHEW5HLIDQHLQHU6WHOOH DQJHEURFKHQ u Provenienz: Ex sĂźddeutsche Privat sammlung M.S., 1980er Jahre. Massive bronze bracelet of twisted wire with three rings and decoration in form of VSKHUHV&HOWLF/D7Â&#x2122;QHWKQGFHQWXU\ %&*UHHQSDWLQDRQHULQJUHDVVHPEOHG EUDFHOHWZLWKVPDOOFUDFN

486

 Torques aus Bronze. Bronzezeit OLFKY&KUkFP $XV UXQGHP 'UDKW GHU DQ GHU Â?IIQXQJ]XHLQHP+DNHQXQGHL QHU Â?VH DXIJHERJHQ LVW XQG GHV VHQ (QGHQ VSLUDOLJ DXIJHZLFNHOW VLQG*UŠQEODXH3DWLQDLQWDNW u Provenienz: Ex sĂźddeutsche Privat sammlung M.S., 1980er Jahre. 7RUTXH RI EURQ]H ZLUH ZLWK KRRN DQG H\H FORVXUH DQG VSLUDO HQGLQJV %URQ]H $JH%&*UHHQEOXHSDWLQD intact.



488 â&#x20AC;˘ Paar Fibeln aus Bronze. (WUXV NLVFK  -K Y &KU / FP 0DVVLYHUJHERJHQHU]XGHQ(Q GHQ VFKPDOHU ZHUGHQGHU %ŠJHO PLW ]ZHL OLQVHQDUWLJHQ 6FKHLEHQ XQG 5LOOHQGHNRU 6SLUDONRQVWUXN WLRQJURgHUIDVWUHFKWHFNLJHU~D FKHU 1DGHOKDOWHU PLW JHULW]WHP 5DXWHQPXVWHU *UŠQEUDXQH 3DWL QD ZLQ]LJHV )UDJPHQW EHL HLQHU )LEHOIHKOW u Provenienz: Ex Shlomo Moussaieff Coll HFWLRQ([SRUWLHUWPLWGHU Ausfuhrgenehmigung der israelischen $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ/RV 488

258

3DLU RI PDVVLYH EURQ]H }EXODH ZLWK LQ cised decor on the bow and the rectangu lar needleholder, with spiral construction. (WUXVFDQWKFHQWXU\%&*UHHQEURZQ SDWLQDWLQ\IUDJPHQWRIRQH}EXODPLV sing.


489



489 Eisenzeitliche Pektorale und Fibeln. %DONDQFD-KY&KU=ZHL 3HNWRUDOHPLWJHRPHWULVFKHU9HU]LHUXQJ %E]ZFPEHL GHPLWVFK¤QHU3DWLQDHLQ6W©FNPLWJHEURFKHQHP+DNHQ HLQH 'RSSHOVSLUDO}EHO %FPZLHGHU]XVDPPHQJHVHW]W XQGHLQH NHOWLVFKH%©JHO}EHO %FP 4 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQEHL $$0©QFKHQ]ZLVFKHQXQG 7ZR,URQ$JHEURQ]HSHFWRUDOVDGRXEOHVSLUDOEURQ]H}EXOD %DONDQVWK FHQWXU\%& DQGD&HOWLF}EXODSLHFHV

 Früheisenzeitlicher Bronzegürtel. 6©GRVWHXURSDFD-KY&KU /FDFPFD(OHPHQWH+MHFDFP=XP$XI]LHKHQ DXI/HGHUULHPHQPLWMHZHLOVYLHU%XFNHOQPLW=ZLVFKHQVWHJHQ DXIGHQHQSUR}OLHUWH4XHUVWUHLIHQDXIVLW]HQ$XIGHU5©FNVHLWH PLWWLJ 5LHPHQVFKODXIHQ 'D]X ]ZHL (QGVW©FNH PLW GUHL VHQ $XI .XSIHUGUDKW JHI”GHOW KHUYRUUDJHQG HUKDOWHQ PLW JU©QHU 3DWLQDDOOH7HLOHLQWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0©QFKHQ]ZLVFKHQXQG 9JO$OEDQLHQ6FK”W]HDXVGHP/DQGGHU6NLSHWDUHQ$XVVWHOOXQJ0©QFKHQ  61U  HOHPHQWV RI DQ (DUO\ ,URQ $JH EURQ]H EHOW 6RXWKHDVW (XURSH FD WK FHQWXU\%&*UHHQSDWLQDDOOSLHFHVLQWDFW

259






 Bronzener Zügelring. .HOWLVFK-KY&KU/FP5HFKW HFNLJH JHZ¤OEWH )XgSODWWH PLW HLQHU VH LQQHQ GDUDQ HLQ NXU]HU SUR}OLHUWHU 6WHJ PLW SHOWHQI¤UPLJHP 5LQJ )UDJPHQWH GHU)XgSODWWHIHKOHQPrachtexemplar mit herrlicher Patina! u 3URYHQLHQ]([3ULYDWVDPPOXQJ6:&KLHPJDX,QGHQHU-DKUHQLP Münchner Kunsthandel erworben. %URQ]HEULGOHULQJ&HOWLFUGVWFHQWXU\%&)UDJPHQWVRIWKHEDVHSODWH missing. ([FHOOHQWSDWLQD

 %URQ]H$QK”QJHUPLW3XQ]GHNRU%URQ]H]HLW-KY&KU/ FP6LFKHOI¤UPLJHV%URQ]HEOHFKPLWEHLGVHLWLJHQJHSXQ]WHQ .UHLVSXQNWHQ2EHQDQVHW]HQGHLQHVHPLWHLQHPODQJHQSUR }OLHUWHP6WDE6FK¤QHJU©QH3DWLQD5HVWHYRQ6LQWHULQWDNW u

493

260

3URYHQLHQ]([3ULYDWVDPPOXQJ6:&KLHPJDX,QGHQHU-DKUHQLP Münchner Kunsthandel erworben. 6LFNOHVKDSHGSHQGDQWZLWKSXQFKHGFLUFOHVRQERWKVLGHV%URQ]H$JHWK WKFHQWXU\%&$WWUDFWLYHJUHHQSDWLQDWUDFHVRIVLQWHULQWDFW

493 Eisenschwert. :LNLQJHU    -K Q &KU / JHVDPW FP / .OLQJH FP 'LUHNW XQWHU GHU *ULIIDQJHO DXI GHU .OLQJH EHLGVHLWLJHLQH*UDYXULQ)RUPHLQHVJHVFKZXQJHQHQ2UQDPHQWV 2EHU~”FKHPLW.RUURVLRQVSXUHQVRQVWLQWDNW u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ+:%D\HUQHUZRUEHQLQKROO”QGLVFKHU $XNWLRQ ,URQVZRUGZLWKHQJUDYHGRUQDPHQWV9LNLQJWKWKFHQWXU\$':LWK corrosion, otherwise intact.


493

494 Keltische Waffengarnitur aus Eisen.    -K Y &KU D /DQ ]HQVSLW]H / FP /DQ]HWWI¤UPLJ PLW EUHLWHU 0LWWHOULSSH XQG NRQLVFKHU 7©OOH E 6FKZHUW / FP 6FKPDOH ODQ]HWWI¤UPLJH .OLQJHPLW*ULIIPLWGUHL6FKHLEHQ*ULIIXQG.OLQJHDXVHLQHP 6W©FN JHVFKPLHGHW ,P *ULII JHEURFKHQ F .OLQJH / FP 0LWJHVFKZXQJHQHU6FKQHLGH.OLQJHQIRUWVDW]DQGHU6SLW]HJH EURFKHQG=ZHL7©OOHQ/XQGFP:LQ]LJH5DQGIUDJ PHQWHIHKOHQ5 Stück!$OOH6W©FNHSURIHVVLRQHOOUHVWDXULHUW u

PLVVLQJ  &HOWLF WK  QG FHQWXU\ %& $OO LWHPV SURIHVVLRQDOO\ UHVWRUHG SLHFHV

3URYHQLHQ]([1DFKODVV('VWHUUHLFKHU-DKUH

3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV

&ROOHFWLRQRILURQZHDSRQVLQFOXGLQJDVSHDUKHDG LQWDFW DVZRUG KDQGOH EURNHQ DQGDEODGH WLSRISLQPLVVLQJ DQGWZRJURPPHWV WLQ\ULPIUDJPHQWV

%URQ]HD[H&HQWUDO(XURSH0LGGOHRU/DWH%URQ]H$JH%& *UHHQSDWLQDWUDFHVRIVLQWHULQWDFW:LWKFROOHFWRUyVQRWH

 $EVDW]EHLO PLW VSLW]HU 5DVW DXV %URQ]H Mitteleuropa, Mittlere ELVVS”WHUH%URQ]H]HLWY&KU/FP*HUDGHU 1DFNHQLP0LWWHOWHLOQDFKLQQHQHLQELHJHQGHVLFKDXIZ¤OEHQGH 5DQGOHLVWHQ GLH YI¤UPLJ DEVFKOLHgHQ DXVVFKZLQJHQGH DEJH UXQGHWH6FKQHLGHMit Bestimmungszettel des Sammlers! *U©QH 3DWLQD5HVWHYRQ6LQWHULQWDNW u

494



261


496



3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV

498 Verzierter Topf. %RGURJNHUHV]W¦U*UXSSH 8QJDUQ  XP   -KY&KU+FP*UDXHU7RQPLWGXQNOHPEHU]XJ %LNRQLVFKHUYLHUHFNLJHU.¤USHUPLWEUHLWHP]\OLQGULVFKHP+DOV XQG]ZHLVHQKHQNHOQ'HUJDQ]H.¤USHUXQGGLH+HQNHOVLQG PLW*LWWHUXQG3XQNWE”QGHUQGHNRULHUWDQGHQ(FNHQMH]ZHL PHKUUHLKLJH 'RSSHOYROXWHQ 0LW 7/$QDO\VH (LQ 6SUXQJ LP XQWHUHQ7HLODP5DQGEHVWRgHQ u

%URQ]HD[HKHDGZLWKSODVWLFGHFRU&HQWUDO(XURSHODWH%URQ]H$JH %&*UHHQEURZQSDWLQDWLQ\KROHDWWKHPRXWKRWKHUZLVHLQWDFW:LWK FROOHFWRUyVQRWH

3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU 9JO 1 .DOLF] *¤WWHU DXV 7RQ  'DV 1HROLWKLNXP XQG GLH .XSIHU]HLW LQ 8QJDUQ  $EE

496 Tüllenbeil aus Bronze. 0LWWHOHXURSD-©QJHUHELVVS”WHUH%URQ ]H]HLWY&KU/FP%HLOPLWVHLWOLFKDEJHVHW]WHQ %UHLWVHLWHQ VHLWOLFKHU VH XQG 5LSSHQGHNRU DXI GHU %UHLWVHLWH Mit Bestimmungszettel des Sammlers! *U©QEUDXQH3DWLQDNOHL QHV/RFKDQGHU0©QGXQJVRQVWLQWDNW u

 Sammlung bronzezeitliche Waffen. 'DUXQWHU HLQH EURQ]HQH 6SHHUVSLW]HPLWDEJHVHW]WHP0LWWHOJUDW /FPVS”WH%URQ ]H]HLW u Y&KU LQWDNW  HLQ SDUDOOHOVHLWLJJHVFKZHLIWHV 5DQGOHLVWHQEHLODXV%URQ]H /FPIU©KH%URQ]H]HLWXP Y&KU PLQLPDOH .RUURVLRQ LQ GHU 0LWWH LQ /RFK DQWLNH *H EUDXFKVVSXUHQ  XQG HLQ REHUVW”QGLJHV /DSSHQEHLO DXV %URQ]H /FPVS”WH%URQ]H]HLWY&KUJU©QH3DWLQD LQWDNW 3 Stück! u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJ6SHHUVSLW]HHUZRUEHQ EHL+LUVFK1DFKI$XNWLRQH[/RV5DQGOHLVWHQEHLOHUZRUEHQ EHL*RUQ\ 0RVFK$XNWLRQ/RV/DSSHQEHLOHUZRUEHQXP  Collection of Bronze Age weapons comprising a bronze arrow head, a bronze ~DQJHGD[HDQGDEURQ]HZLQJHGD[H%URQ]H$JHDERXW%& ,QWDFWWKH~DQJHGD[HZLWKKROHSLHFHV

%LFRQLFDO VTXDUH FOD\ SRW ZLWK GDUN JOD]H KDQGOHV DQG ULFK RUQDPHQWDO GHFRUDWLRQ%RGURJNHUHV]W¦U&XOWXUHDURXQGUGQGFHQWXU\%&$ }VVXUHLQERWWRPVSOLQWHUVDWULP:LWK7/DQDO\VLV

499 Trichterhalskanne. +DOOVWDWW.XOWXU FD    Y &KU + FPk0©QGXQJFP$XVEUDXQVFKZDU]HPSROLHUWHP 7RQ)ODFKHUUXQGHU%RGHUGDU©EHU~DFKHUELNRQLVFKHU&RUSXV PLWHLQHPWULFKWHUI¤UPLJHQ+DOVXQGHLQHP~DFKHQ%DQGKHQNHO $XIGHP&RUSXV.UHLVRUQDPHQWH,QWDNW u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUZRUEHQEHL+LUVFK 1DFKIROJHU$XNWLRQ/RVH[6DPPOXQJ'U6LHJIULHG=LPPHU -XJ ZLWK ELFRQLFDO ~DW FRUSXV DQG IXQQHOVKDSHG QHFN RI EODFNEURZQ SROLVKHGFOD\RQWKHFRUSXVFLUFOHRUQDPHQWV+DOOVWDWW&XOWXUHDERXW %&,QWDFW

 Schale mit Noppen. +DOOVWDWW.XOWXU FD    Y &KU +FPk0©QGXQJFP$XVEUDXQVFKZDU]HPSROLHU WHP 7RQ )ODFKHU UXQGHU %RGHQ GDU©EHU ~DFKHU ELNRQLVFKHU 262


498

&RUSXV PLW HLQHP NXU]HQ ]\OLQGULVFKHQ +DOV $XI GHP +DOV GUHL=LHUULOOHQDXIGHU6FKXOWHUHLQVFKZDFKDXVJHELOGHWHU1RS SHQNUDQ])XQGRUW%XW]RZ %UDQGHQEXUJ Beinhaltet alte Sammlernotizen und Etiketten!,QWDNW u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUZRUEHQEHL+LUVFK 1DFKIROJHU $XNWLRQ   /RV  H[ 6DPPOXQJ 'U 6LHJIULHG =LPPHU %LFRQLFDO~DWERZOZLWKVKRUWF\OLQGULFDOQHFNRIEODFNEURZQSROLVKHGFOD\ RQWKHFRUSXVWKUHHJURRYHVDQGZHDNO\ZRUNHGRXWNQREVDWWKHVKRXOGHU /RFDWLRQ%XW]RZ %UDQGHQEXUJ +DOOVWDWW&XOWXUHDERXW %&,QWDFW:LWKROGFROOHFWRUyVQRWLFHDQGODEHOV



499

 Schale der Lausitzer Keramik. -WY&KUkFP$XV VFKZDU]HPSROLHUWHP7RQ)ODFKHUUXQGHU%RGHQGDU©EHU~D FKHUELNRQLVFKHU&RUSXVPLWNXU]HP+DOV,QGHUREHUHQ+Â&#x201D;OIWH JHRPHWULVFKHU5LW]GHNRULQ)RUPYRQ'UHLHFNXQG:LQNHOEÂ&#x201D;Q GHUQ,QWDNW u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUZRUEHQEHL+LUVFK 1DFKIROJHU$XNWLRQ/RVH[6DPPOXQJ'U6LHJIULHG=LPPHU %LFRQLFDO ~DW ERZO RI EODFN SROLVKHG FOD\ LQ WKH XSSHU SDUW JHRPHWULFDO LQFLVLRQLQIRUPRIWULDQJOHVDQGDQJOHV/XVDWLDQ&XOWXUHQGVWPLOOHQLXP %&,QWDFW



263


 )U©KQHROLWKLVFKHV 7RQJHIÂ&#x201D;g + FP k ELV FP $XV EHL JHP 7RQ +DQGJHIRUPWHV NRQL VFKHV *HIÂ&#x201D;g PLW ~DFKHP %RGHQ XQG HLQJHGU©FNWHU 3XQNWUHLKH DXgHQXQWHUGHP5DQG,QWDNW u Provenienz: Aus der westdeutschen 3ULYDWVDPPOXQJ:5JHNDXIWDXV der niederrheinischen Privatsammlung 03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ (DUO\ 1HROLWKLF KDQGPRXOGHG FRQLFDO vessel with row of punctures below the ULP,QWDFW



 6DPPOXQJ EURQ]H]HLWOLFKH *HIÂ&#x201D; gH 8UQHQIHOGHU]HLW VSÂ&#x201D;WHV  -W Y &KU D  + FP k FP URWEUDXQHU 7RQ *URgHV RIIH QHV*HIÂ&#x201D;gPLWEUHLWHUDEJHVHW]WHU 0©QGXQJEUHLWHP%DXFKXNOHL QHU 6WDQG~Â&#x201D;FKH E  + FP k FP URWEUDXQHU 7RQ 2IIHQHV *HIÂ&#x201D;gPLWEUHLWHU0©QGXQJDXV ODGHQGHP %DXFK X 6WDQG~Â&#x201D;FKH F  + FP k FP KHOOEUDX QHU 7RQ .OHLQHU HLQKHQNHOLJHU 1DSI PLW VHQNUHFKWHU :DQGXQJ X NOHLQHP )Xg 3 Stück! Ge NOHEWH 6FKHUEHQ PLW HUJÂ&#x201D;Q]WHQ 6WHOOHQ NOHLQHU $XVEUXFK DQ GHU /LSSHGHVJU¤gHUHQ*HIÂ&#x201D;gHV u 

3URYHQLHQ]([6DPPOXQJ)7%DGHQ :©UWWHPEHUJ ([ *RUQ\  0RVFK $XNWLRQ   /RV  'DYRU saarländische Privatsammlung. Collection of two pots and one small bowl ZLWKRQHKDQGOHEURZQFOD\/DWHEURQ]H DJH 8UQ}HOG FXOWXUH &HQWUDO (XURSH /DWHQGPLOOHQQLXP%&5HDVVHPEOHG SLHFHV

 $[W 'Â&#x201D;QHPDUN QHROLWKLVFK XP Y&KU/FP$XVEHLJHP )HXHUVWHLQ,QWDNW u Provenienz: Ex belgische Privatsammlung 0' H[ GHXWVFKH 3ULYDWVDPPOXQJ GHU 1990er Jahre. )OLQW KDQG D[H 'HQPDUN QHROLWKLF DERXW%&,QWDFW



264


 Sammlung Sicheln. 1RUGHXURSD QHROLWKLVFK    -W Y &KU / FP+HOOXQGGXQNHOJUDX HU)HXHUVWHLQ3 Stück!,QWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ   /RV  HUZRUEHQ DXV Sammlung A.A., München, zwischen XQG &ROOHFWLRQRI~LQWVWRQHVLFNOHV1RUWKHUQ (XURSH QHROLWKLF WK  UG PLOOHQLXP %&,QWDFWSLHFHV



 Sammlung Sicheln. 1RUGHXUR SD QHROLWKLVFK    -W Y &KU / FP $XV KHOOEUDXQHP EHLJHP XQG JUDXRFNHUIDUEHQHP )HXHUVWHLQ3 Stück!,QWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ   /RV  HUZRUEHQ DXV Sammlung A.A., München, zwischen XQG &ROOHFWLRQRI~LQWVWRQHVLFNOHV1RUWKHUQ (XURSH QHROLWKLF WK  UG PLOOHQLXP %&,QWDFWSLHFHV



 6DPPOXQJ 0HLgHO 1HROLWKLNXP /FP$XV)HOVXQG)HX HUVWHLQ 5 Stück! Darunter ausge fallene Stücke!,QWDNW u Provenienz: Ex Sammlung J.H., Westfa len, seit 1980. &ROOHFWLRQRIFKLVHOVRI~LQWVWRQH1HROL WKLF,QWDFWSLHFHV$PRQJWKHPH[ WUDRUGLQDU\SLHFHV 

265


 6DPPOXQJ $EEDXJHUÂ&#x201D;WH XQG 6WHLQKÂ&#x201D;PPHU 1HROLWKLNXP ELV %URQ]H]HLW /   FP =ZHL )DXVWNHLOHDXVMXQJVWHLQ]HLWOLFKHP )HXHUVWHLQ XQG GUHL GXUFKERKU WH +Â&#x201D;PPHU ]XU 6WHLQEHDUEHLWXQJ PLW W\SLVFKHQ 6FKODJPDUNHQ 5 Stück! 0LW *HEUDXFKVVSXUHQ LQ WDNW u Provenienz: Ex Sammlung Westfalen, seit 1980. 

J.H.,

Collection of two hand axes of neolithic ~LQWVWRQH DQG WKUHH VWRQH D[HV ZLWK KROH IRU WKH VKDIW ZLWK W\SLFDO WUDFHV RI XVDJH1HROLWKLF%URQ]H$JH,QWDFW5 SLHFHV

 Neolithische Reibeplatte mit Rei bestein. =HQWUDOH 6DKDUD    -W Y &KU / FD FP % PD[ FP + FD FP *URgH KDOE UXQGH 3ODWWH DXV U¤WOLFKJHOEHP 4XDU]LWXQGHLQVFKHLEHQI¤UPLJHU 5HLEHVWHLQ /FDFP ,QWDNW u 3URYHQLHQ]([6DPPOXQJ(+%D\HUQ seit 1980ger Jahren. Neolithic stone grinding plate and pestle. &HQWUDO6DKDUDWKWKPLOOHQLXP%& ,QWDFW



 Neolithische Reibeplatte mit Rei bestein.    -W Y &KU / FD FP%PD[FP+FDFP *URgHOÂ&#x201D;QJVRYDOH3ODWWHDXVU¤WOL FKHP6DQGVWHLQXQGHLQVFKHLEHQ I¤UPLJHU 5HLEHVWHLQ k FD FP  DXV U¤WOLFKHP 4XDU]LW $Q GHU 3ODWWH.DONVLQWHUVSXUHQLQWDNW u Provenienz: Ex Sammlung Westfalen, seit 1980.

J.H.,

Neolithic stone grinding plate and pestle. WKWKPLOOHQLXP%&,QWDFW



266


%<=$1=



 6LOEHUQHV(QNROSLRQPLW1LHOOR'HNRU6S”WE\]DQWLQLVFK -KQ&KU[FP6LOEHUPLW1LHOOR'HNRU9RUGHUVHLWH,P =HQWUXPHLQ0HGDLOORQPLW.UHX]DXIGHQ.UHX]DUPHQMHZHLOV HLQ 3DDU QLPELHUWHU %©VWHQ PLW HLQHP .UHX] GD]ZLVFKHQ $XI GHPYHUWLNDOHQ.UHX]DUP,QVFKULIW,&;&1,.0+;$,LI GABRH  LNFHLO& VLF  -HVXV &KULVWXV VLHJW 0LFKDHO *DEULHO   5©FNVHLWH ,P =HQWUXP HLQ 0HGDLOORQ PLW HLQHU QLPELHUWHQ &KULVWXVE©VWH XQG GHU ,QVFKULIW ,&  ;&  -HVXV &KULVWXV $XIGHQ.UHX]DUPHQMHZHLOVHLQ(U]HQJHO:LQ]LJHV )UDJPHQWGHUVHQEHIHVWLJXQJIHKOWLQWDNW u

3URYHQLHQ]([0©QFKQHU3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 6LOYHUHQNROSLRQZLWKQLHOORGHFRUDWLRQGHSLFWLQJRQWKHIURQWVLGHLQWKHFHQWHU a cross, on each crossarm a pair of haloed busts with cross between them and inscription ,&;&1,.0+;$,LI GABRH  L N F H L O & and on WKHEDFNVLGHWKHKDORHGEXVWRI&KULVWDQGWKHLQVFULSWLRQ,&;& -HVXV &KULVW DQGDQDUFKDQJHORQHDFKFURVVDUP/DWH%\]DQWLQH3HULRGWK WKFHQWXU\$'7LQ\IUDJPHQWDWWKHH\HOHWPLVVLQJLQWDFW

267




 Bronzenes Enkolpion. 0LWWHOE\]DQWLQLVFK    -K Q &KU [FP%URQ]HJXVVPLW*UDYXU$XIGHU9RUGHUVHLWH'HU JHNUHX]LJWH &KULVWXV PLW 1LPEXV GDU©EHU HLQH WDEXOD DQVDWD PLW;I©U&KULVWRVVRZLHGHU%XFKVWDEH QI©U7KHRV]ZLVFKHQ 6RQQHXQG0RQGGDUXQWHUDXIGHPKRUL]RQWDOHQ.UHX]DUPGLH ,QVFKULIW ,+ &2< & ;3 ,&72 & 1+.$  -HVXV &KULVWXV VLHJW XQGDQGHQ(QGHQGLH)LJXUHQYRQ0DULDXQG-RKDQQHV $XIGHU5©FNVHLWH'LH*RWWHVPXWWHUDOV0DULD2UDQVXPJHEHQ YRQ YLHU 0HGDLOORQV PLW GHQ %©VWHQ GHU (YDQJHOLVWHQ GLH PLW %XFKVWDEHQEH]HLFKQHWVLQGDXIGHQYHUWLNDOHQ.UHX]DUPHQ L I©U/XNDVXQG,I©U-RKDQQHVDXIGHQKRUL]RQWDOHQ.UHX]DUPHQ

268

0I©U0DUNXVXQG0DWWK”XV1HEHQGHU*RWWHVPXWWHU09Q9  0+7+3 Q(29  $XI GHU VH XQG GHP 6FKDUQLHU 'HNRU LQ )RUP YRQ JHSXQ]WHQ .UHLVSXQNWHQ 'XQNHOJU©QH 3DWLQD LQWDNW u 3URYHQLHQ]([0©QFKQHU3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]H HQNROSLRQ ZLWK HQJUDYHG GHFRUDWLRQ GHSLFWLQJ RQ WKH IURQWVLGH WKH FUXFL}HG&KULVWZLWK0DULDDQG6DLQW-RKQDQGLQVFULSWLRQRQWKHEDFNVLGH Maria Orans and four medallions with the busts of the evangelists and LQVFULSWLRQ0LGGOH%\]DQWLQH3HULRGWKWKFHQWXU\$''DUNJUHHQ patina, intact.




 Bronzenes Enkolpion. 0LWWHOE\]DQWLQLVFK    -K Q &KU [FP%URQ]HJXVVPLW*UDYXU$XIGHU9RUGHUVHLWHGLH ,QVFKULIW0+Q9 0+7+3Q(2< VRZLH0DULD2UDQVUHFKWV XOLQNVDXIGHQKRUL]RQWDOHQ.UHX]DUPHQMHZHLOVHLQ)LVFK$XI GHU5©FNVHLWHGLH,QVFKULIW,2$1,& -RKDQQHV GHU+HLOLJH -RKDQQHVDOV2UDQWPLWHUKREHQHQ+”QGHQUHFKWVXOLQNVDXI GHQ KRUL]RQWDOHQ .UHX]DUPHQ MHZHLOV HLQ )LVFK %UDXQJU©QH 3DWLQDXQWHUHU6SOLQWIHKOWVRQVWLQWDNW u

3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]HHQNROSLRQZLWKHQJUDYHGGHFRUDWLRQGHSLFWLQJRQWKHIURQWVLGH0DULD ~DQNHGE\WZR}VKDQGWKHLQVFULSWLRQ0+Q9RQWKHEDFNVLGH6DLQW-RKQ ~DQNHGE\WZR}VKDQGWKHLQVFULSWLRQ,2$1,&0LGGOH%\]DQWLQH3HULRG WKWKFHQWXU\$'%URZQJUHHQSDWLQDORZHUVSOLQWPLVVLQJRWKHUZLVH intact.

269




 Bronzenes Enkolpion. 0LWWHOE\]DQWLQLVFK-KQ&KU[ FP%URQ]HJXVVPLW*UDYXU$XIGHU9RUGHUVHLWH'LHVWLOLVLHUWH )LJXUGHV+HLOLJHQ6WHIDQPLW1LPEXVLP$GRUDQWHQJHVWXVPLW HUKREHQHQ +Â&#x201D;QGHQ ~DQNLHUW YRQ HLQHP (LPHU PLW 6WHLQHQ XQGHLQHP6WDEGDU©EHU,QVFKULIW2$G+2&&7(F$12& $XIGHU5©FNVHLWH'LHVWLOLVLHUWH)LJXUGHV+HLOLJHQ*HRUJPLW 1LPEXV LP $GRUDQWHQJHVWXV PLW HUKREHQHQ +Â&#x201D;QGHQ GDU©EHU ,QVFKULIW2$G+2&&GEORGHO& u 3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[0©QFKQHU 3ULYDWVDPPOXQJ06VHLWHU-DKUHQ =XGHQ$WWULEXWHQGHVKHLOLJHQ6WHIDQJHK¤UWHQ6WHLQHXQGHLQ3DOP]ZHLJ'HU +HLOLJH*HRUJLVWGLHDXI(QNROSLRQNUHX]HQDPKÂ&#x201D;X}JVWHQGDUJHVWHOOWH)LJXU %URQ]HHQNROSLRQZLWKHQJUDYHGGHFRUDWLRQGHSLFWLQJRQWKHIURQWVLGH6DLQW 6WHSKHQZLWKDEXFNHWRIVWRQHVDQGDURGDQGWKHLQVFULSWLRQ2$G+2& &7EF$12&DQGRQWKHEDFNVLGH6DLQW*HRUJHZLWKWKHLQVFULSWLRQ2 $G+2&&GEORGH2&0LGGOH%\]DQWLQH3HULRGWKWKFHQWXU\ $'%URZQJUHHQSDWLQDORZHUVSOLQWPLVVLQJRWKHUZLVHLQWDFW

 Bronzenes Enkolpion. )U©KE\]DQWLQLVFK    -K Q &KU  [ FP %URQ]HJXVV PLW 5HOLHIGHNRU $XI GHU 9RUGHUVHLWH &KULVWXVDP.UHX]XQGGLH%©VWHQGHUYLHU(YDQJHOLVWHQDQGHQ .UHX]DUPHQGHQ$XIGHU5©FNVHLWH&KULVWXVLQ2UDQWHQKDOWXQJ PLWHUKREHQHQ$UPHQXQGGLH%©VWHQGHUYLHU(YDQJHOLVWHQDQ GHQ.UHX]DUPHQGHQ*U©QH3DWLQDLQWDNW u 3URYHQLHQ]([6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]H HQFROSLRQ ZLWK &KULVW DQG WKH EXVWV RI WKH IRXU HYDQJHOLVWV (DUO\ %\]DQWLQH3HULRGWKWKFHQWXU\$'*UHHQSDWLQDLQWDFW

270




 Bronzenes Enkolpion. 0LWWHOE\]DQWLQLVFK -KQ&KU[FP%URQ]HJXVVPLW *UDYXUXQG*ODVHLQODJHQDXIGHU5©FNVHLWH $QGHQ(FNHQGHU.UHX]DUPH5XQGHOQ$XI GHU9RUGHUVHLWHGLH,QVFKULIW Q(272.2& *RWWHVJHE”UHULQ%HLQDPHYRQ0DULD VR ZLHGLH0XWWHU*RWWHVPLW.LQG~DQNLHUWYRQ ]ZHL%©VWHQ$XIGHU5©FNVHLWHGLH,QVFKULIW ,2$1,&  -RKDQQHV  GHU +HLOLJH -RKDQ QHVDOV2UDQWPLWHUKREHQHQ+”QGHQVRZLH UXQGHRSDNH*ODVHLQODJHQDQGHQ(QGHQGHU .UHX]DUPH'XQNHOJU©QH3DWLQDPLWHLQLJHQ URWEUDXQHQ(LQVSUHQJVHOQ]ZHL*ODVHLQODJHQ IHKOHQ/RFKLQ$XIK”QJH¤VHVRQVWLQWDNW u Provenienz: Ex Münchner Privatsammlung M.S., seit HU-DKUHQ %URQ]HHQNROSLRQZLWKHQJUDYHGGHFRUDWLRQDQGJODVV LQOD\V DW WKH EDFNVLGH DQG URXQGHOV RQ WKH FRUQHUV depicting on the frontside Maria with child and two busts and the inscription Q(272.2&, on the EDFNVLGH 6DLQW -RKQ DQG WKH LQVFULSWLRQ ,2$1,& DQGJODVVLQOD\V0LGGOH%\]DQWLQH3HULRGWKWK FHQWXU\$''DUNJUHHQSDWLQDZLWKVRPHUHGEURZQ VSULQNOLQJVWZRJODVVLQOD\VPLVVLQJKROHLQWKHH\HOHW otherwise intact. 

 Bronzenes Enkolpion. 5XVVODQG    -KQ&KU[FP%URQ]HJXVVPLW5H OLHIGHNRU X SRO\HGHUI¤UPLJHU VH ,QVFKULI WHQLQ.LUFKHQVODZLVFK$XIGHU9RUGHUVHLWH GHU JHNUHX]LJWH &KULVWXV XPJHEHQ YRQ YLHU 0HGDLOORQV PLW %©VWHQ GLH PLW ,QVFKULIWHQ EHQDQQW VLQG 1LFKRODV +HLOLJHU 0XWWHU *RWWHV*HRUJLRV GDU©EHU,&;&LQJULH FKLVFKHQ%XFKVWDEHQXQWHUGHQ.UHX]DUPHQ YRQ&KULVWXV,QVFKULIWHQ€'DV.UHX]LVWXQ VHU7URVWy€'DV.UHX]LVWXQVHU5XKPy$XI GHU5©FNVHLWHGLH0XWWHU*RWWHVDOV2UDQWHQ }JXUPLWGHU,QVFKULIW€+HLOLJH0XWWHU*RWWHV KLOI XQVy XPJHEHQ YRQ YLHU 0HGDLOORQV PLW ,QVFKULIWHQ I©U 3HWUXV 'DPLDQRV .RVPDV XQG%DVLO*U©QH3DWLQDREHUHUXQGXQWHUHU 6SOLQWIHKOHQVRQVWLQWDNW u Provenienz: Ex Süddeutsche Privatsammlung M.S., VHLWHU-DKUHQ 9JO+&(YDQV:':L[RP +UVJ 7KH*ORU\RI %\]DQWLXP$UWDQG&XOWXUHRIWKH0LGGOH%\]DQWLQH (UD$'$XVVWHOOXQJ1HZ<RUN   61U %URQ]HHQNROSLRQZLWKUHOLHIGHFRUDWLRQDSRO\KHGULFDO H\HOHWDQGPRVWO\6ODYRQLFLQVFULSWLRQVGHSLFWLQJRQWKH IURQWVLGHWKHFUXFL}HG&KULVWZLWKD*UHHNLQVFULSWLRQ DQG WKH EXVWV RI 6DLQW 1LFKRODV D 6DLQW WKH +RO\ 0RWKHU DQG 6DLQW *HRUJH DQG RQ WKH EDFNVLGH WKH +RO\0RWKHUDQG6DLQW3HWHU'DPLDQRV.RVPDVDQG %DVLO5XVVLDWKWKFHQWXU\$'*UHHQSDWLQD upper and lower splint missing, otherwise intact.



271


 Bronzekreuz mit Punzdekor. %\]DQWLQLVFK    -K Q &KU  [ FP .UHX] PLW DXVVFKZLQJHQGHQ .UHX ]DUPHQ XQG EUHLWHU UHOLH}HUWHU VH REHQ $P 5DQG XPODXIHQG JHSXQ]WH .UHLVH $XI GHU 9RUGHUVHLWH LP =HQWUXP HLQH 5RVHWWH LQ ]ZHL .UHLVHQ XQG JHSXQ]WH .UHLVHLQGHQ=ZLVFKHQU”XPHQVRZLHDXIGHPYHUWLNDOHQ .UHX]DUPHLQJUDYLHUWHV6WXIHQNUHX]XQG]ZHL'UHLHFNH GLHGHQ%HUJGHV3DUDGLHVHVGDUVWHOOHQ$XIGHU5©FNVHL WHLP=HQWUXPHLQ6WUDKOHQNUDQ]DXVJHSXQ]WHQ.UHLVHQ *U©QH 3DWLQD DXI GHU 9RUGHUVHLWH ]ZHL .UDW]HU VRQVW LQWDNW u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ   /RV  HUZRUEHQDXV6DPPOXQJ$$0©QFKHQ]ZLVFKHQXQG %URQ]HFURVVSHQGDQWZLWKORRSDQGSXQFKHGGHFRUDWLRQ%\]DQWLQH WKWKFHQWXU\$'*UHHQSDWLQDRQWKHIURQWVLGHWZRVFUDWFKHV otherwise intact.

 Bronzenes Enkolpion. )U©KE\]DQWLQLVFK    -K Q &KU  [ FP %URQ]HJXVV 'HNRU PLW JHSXQ]WHQ .UHLVSXQNWHQ XPODXIHQG DP 5DQG XQG LQ GHQ )HO GHUQLQ)RUPYRQ.UHX]HQDXIHLQHU(QNROSLRQ+”OIWH %UDXQJU©QH 3DWLQD XQWHUHU 6SOLQW IHKOW LQ HLQHU +”OIWH NOHLQHV/RFK u 

3URYHQLHQ]([+HUPDQQ+LVWRULFD$XNWLRQ/RVH[ 6©GGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]HHQNROSLRQZLWKSXQFKHGFLUFOHV(DUO\%\]DQWLQH3HULRGWK WKFHQWXU\$'%URZQJUHHQSDWLQDORZHUVSOLQWPLVVLQJWLQ\ hole in one half.

 .DVWHQVFKORVV PLW }J©UOLFKHP 'HNRU VWOLFKHV 0LWWHO PHHUJHELHW-KQ&KU6FKORVVNDVWHQ[ E]ZPLW5LHJHOI©KUXQJFP5LHJHO[FP%URQ ]HPLWJUDYLHUWHPXQGSXQ]LHUWHP'HNRU$XIGHP.D VWHQDXIHLQHU6HLWHHLQH+HLOLJHQJHVWDOWPLW1LPEXVDXI GHU DQGHUHQ 6HLWH HLQ 9RJHO 'HU 5LHJHO LVW LP REHUHQ %HUHLFKLQ*HVWDOWHLQHV7LHUHVJHELOGHW=DKOUHLFKH9HU ]LHUXQJHQ LQ )RUP YRQ )OHFKWE”QGHUQ =LFN]DFN XQG .UHLVRUQDPHQWHQ 'XQNHOJU©QH 3DWLQD NOHLQH $XVEU© FKHDP.DVWHQUDQG u 3URYHQLHQ] $XV GHU 6DPPOXQJ &6 0©QFKHQ H[ +HUPDQQ +LVWRULFD$XNWLRQ/RV 

272

%R[VKDSHGORFNPDGHRIEURQ]HZLWKEROWDQGHQJUDYHGDQGSXQFKHG GHFRU(DVWHUQ0HGLWHUUDQHDQWKWKFHQWXU\$''HFRULQ IRUPRI6DLQWZLWKQLPEXVELUGDQGVHYHUDORUQDPHQWV7RSRIWKH EROWLQIRUPRIDSODVWLFVKDSHGDQLPDO*UHHQSDWLQDOLWWOHIUDJPHQWV at the edges are missing.




 Polykandelon. Â?VWOLFKHV 0LWWHOPHHUJHELHW    -K Q &KU + FP k FP %URQ]H 5XQGH LQ 'XUFKEUXFKVDUEHLW JHVWDOWHWH +DOWHUXQJ IŠU VHFKV /HXFKWHU DQ HLQHU GUHLWHLOLJHQ 6WDEDXIKÂ&#x201D;QJXQJ 'HU Â&#x201D;XgHUH 5LQJ LVW DXgHQ JH]DFNW DXI GHP LQQHUHQ 5LQJ GLH SXQ]LHUWH ,QVFKULIW ;$3,& Q<   *QDGH *RWWHVw 'XQNHOJUŠQH3DWLQDLQWDNW u Provenienz: Aus der Sammlung C.S., MĂźnchen, erworben vor 2000. 2SHQZRUNHGGLVNVKDSHGSRO\FDQGHORQPDGHRIEURQ]HZLWKWKHSXQFKHG inscription ;$3,&QY(DVWHUQ0HGLWHUUDQHDQWKWKFHQWXU\$'*UHHQ patina, intact.





273


 Ikone mit Hl. Markus. 5XVVLVFK XP  + FP % FP 2YDOH +DUWKRO]SODWWH 7HPSHUD DXI .UHLGH GHU +LQWHUJUXQG YHUJROGHW ,Q GHU RYDOHQ'DUVWHOOXQJGHXWHW0DUNXVPLWGHU)HGHU LQ GHU 5HFKWHQ DXI HLQH =HLOH LP (YDQJHOLXP ,KP ]XU /LQNHQ VLW]W HLQ JH~©JHOWHU /¤ZH PLW PHQVFKHQÂ&#x201D;KQOLFKHP $QWOLW] Mit ausführlicher Beschreibung des Vorbesitzers! %HVWRgXQJHQ DQ GHU .DQWH 0DOHUHL SDUWLHOO HWZDV DEJHULHEHQ UHVWDXULHUW u 3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ EHL *RUQ\  0RVFK$XNWLRQ/RVH[3ULYDWVDPPOXQJ 6.0©QFKHQHUZRUEHQLQGHQHU-DKUHQ Oval icon representing Saint Marcus with the winged lion. 7HPSHUDRQZRRGSDQHOZLWKJROGHQXQGHUWRQH5XVVLDQ DERXW3DUWLDOO\FKLSSHGFRUQHUVDQGVOLJKWO\UXEEHG off paint, restored. :LWK D GHWDLOHG GHVFULSWLRQ RI WKH IRUPHURZQHU



 Statuette der thronenden Muttergottes mit Chri stuskind. 6SÂ&#x201D;WE\]DQWLQLVFK    -K Q &KU +FP%FP7FP/HLFKWJHOEOLFKHU 6DQGVWHLQ)URQWDOWKURQHQGH0DULDPLW0DSKR ULRQ DXI LKUHP 6FKRg VLW]W GHU NLQGOLFKH &KUL VWXVGHQ.RSIOHLFKWQDFKUHFKWVJHZDQGW,QGHU /LQNHQ KÂ&#x201D;OW HU HLQHQ .RGH[ ZÂ&#x201D;KUHQG HU VHLQH 5HFKWHDXIHLQHQ*OREXVOHJWGHQ0DULDLQLKUHU UHFKWHQ +DQG KÂ&#x201D;OW 6HLWOLFK DP 7KURQ XQG DXI GHU5©FNVHLWHJHJOÂ&#x201D;WWHW:HQLJHZLQ]LJHEHULHEH QH6WHOOHQVRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5 JHNDXIWDXVGHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ 03 YRQ GHVVHQ 9DWHU LQ GHQ HU  HU -DKUHQ erworben. 9JO]X7\SXVXQG)XQNWLRQGLH-XQJIUDXYRQ6RNROLFDDXV dem gleichnamigen Kloster im heutigen Kosovo, die jedoch LP*HJHQVDW]]XXQVHUHP6W©FNHKHUHLQHQSURYLQ]LHOOHQ 6WLO DXIZHLVW ,Q LKUHU 0DFKDUW VHKU YLHO QÂ&#x201D;KHU VWHKHQ 6NXOSWXUHQDXVGHP8PNUHLVYRQ.RQVWDQWLQRSHOZLH]XP Beispiel die Heiligendarstellungen auf einem Kapitell, das VLFKKHXWHLQ&OXQ\EH}QGHW=XU-XQJIUDXYRQ6RNROLFDV +&(YDQV +UVJ %\]DQWLQXP)DLWKDQG3RZHU   $XVVWHOOXQJ1HZ<RUN  6IPLW$EE zum dem Kapitell s. ebenda S. 109 f. mit Abb.



274

Statuette of the enthroned Virgin with Christ as child on her ODS+HLVKROGLQJDFRGH[DQGOD\LQJKLVULJKWKDQGRQD JOREHLQWKHULJKWKDQGRIKLVPRWKHU/DWH%\]DQWLQHWK WKFHQWXU\$'6OLJKWO\\HOORZLVKOLPHVWRQH([FHSWRI IHZWLQ\FKLSVZKLFKDUHPLVVLQJWKHVWDWXHWWHLVLQVSOHQGLG condition.


 Figur aus Bein. %\]DQWLQLVFK RGHU NRSWLVFKXP]ZHLWH+”OIWHGHV-WV Q&KU+FP6WLOLVLHUWHP”QQOL FKH )LJXU ]\OLQGULVFKHU .¤USHU XQ WHQPLWNRQLVFKHP$QVDW].RSIPLW DQJHGHXWHWHQ $XJHQEUDXHQ 1DVH XQG JURE JHVFKQLW]WHP 0XQG ]\OLQ GULVFKH.RSIEHGHFNXQJPLW=RSIPX VWHU $Q GHQ 6FKXOWHUQ YRQ EHLGHQ 6HLWHQ MHZHLOV GXUFK ]ZHL +RO]Q”JHO DQJHEUDFKWH $UPH GLH DQJHZLFNHOW VLQG(LQ/RFKLP5©FNHQ8QWHUWHLO XQGUHFKWHU$UPZLHGHU]XVDPPHQ JHVHW]W u Provenienz: Ex Sammlung Erich Wunderlich, .DUOVUXKHHUZRUEHQLQGHQHU-DKUHQ $VW\OL]HGPDOH}JXUHRIERQHZLWKGHFRUDWHG KHDG SLHFH DQG EHQGHG DUPV %\]DQWLQH RU coptic, around second half of 1st millenium $'/RZHUSDUWDQGULJKWKDQGUHDWWDFKHG DKROHLQWKHEDFN



 Tonkachel mit Löwe. %\]DQWLQLVFK -KQ&KU[FP5¤WOLFKHU7RQ PLW EHLJHP EHU]XJ 4XDGUDWLVFKHU HUKDEHQHU 5DKPHQ XP HLQHP HUKDEHQHQ .UHLV LQ GHQ =ZLFNHOQ 3XQNWH ,P .UHLV HLQ /¤ZH QU PLW HUKREHQHP 6FKZDQ] GHU VHLQHQ .RSIQDFKOLQNVXPZHQGHW:LQ]LJH 6SOLWWHUIHKOHQ u 3URYHQLHQ] ([ *RUQ\  0RVFK $XNWLRQ /RVDXVGHP%HVLW]YRQ93 erworben zwischen 1995 und 2005. 7HUUDFRWWDWLOHZLWKEHLJHVOLSGHSLFWLQJDOLRQ %\]DQWLQH WK FHQWXU\ $' 7LQ\ VSOLQWHUV missing.



275


 Tonkachel mit Rebhuhn. %\]DQWLQLVFK  -KQ&KU[FP5¤WOLFKHU7RQPLW EHLJHPEHU]XJ4XDGUDWLVFKHUHUKDEH QHU5DKPHQXPHLQHPHUKDEHQHQ.UHLV LQGHQ=ZLFNHOQSODVWLVFKH'UHLHFNH,P .UHLV HLQ DQ HLQHP 6WUDXFK SLFNHQGHV 5HEKXKQQU:LQ]LJH6SOLWWHUIHKOHQ u 3URYHQLHQ] ([ *RUQ\  0RVFK $XNWLRQ  2015, Los 252, aus dem Besitz von V.P., erworben zwischen 1995 und 2005. 7HUUDFRWWDWLOHZLWKEHLJHVOLSGHSLFWLQJDSLFNLQJ SDUWULJH%\]DQWLQHWKFHQWXU\$'7LQ\VSOLQWHUV missing.

 Tonkachel mit Ziegenbock. %\]DQWLQLVFK -KQ&KU[FP5¤WOLFKHU7RQ PLW EHLJHP EHU]XJ 4XDGUDWLVFKHU OHLFKW HUKDEHQHU 5DKPHQ PLW ]ZHL /HL VWHQ UHFKWV XQG OLQNV GDULQ HLQ QU VSULQJHQGHU =LHJHQERFN GDU©EHU HLQ VHFKVWUDKOLJHU 6WHUQ XQG GDUXQWHU HLQ UXQGHV YLHUSDVVDUWLJHV ~RUDOHV (OHPHQW :LQ]LJH6SOLWWHUIHKOHQ u 

3URYHQLHQ] ([ *RUQ\  0RVFK $XNWLRQ  2015, Los 251, aus dem Besitz von V.P., erworben zwischen 1995 und 2005. 7HUUDFRWWDWLOHZLWKEHLJHVOLSGHSLFWLQJDMXPSLQJ JRDWDQG~RUDOHOHPHQWV%\]DQWLQHWKFHQWXU\ $'7LQ\VSOLQWHUVPLVVLQJ

 Tonkachel mit Pferd. %\]DQWLQLVFK  -KQ&KU[FP5¤WOLFKHU7RQ PLW EHLJHP EHU]XJ 4XDGUDWLVFKHU OHLFKW HUKDEHQHU G©QQHU 5DKPHQ PLW ]ZHL /HLVWHQ UHFKWV XQG OLQNV DP 5DQG GHU.DFKHOGDULQHLQQOODXIHQGHV3IHUG GDKLQWHU ]ZHL 3DOP]ZHLJH $EULHE DQ YHUVFKLHGHQHQ6WHOOHQ u 3URYHQLHQ]([6DPPOXQJ76/RQGRQHUZRU EHQLQGHQHU-DKUHQLQ/RQGRQ 7HUUDFRWWDWLOHZLWKEHLJHVOLSGHSLFWLQJDUXQQLQJ KRUVHDQGSDOPEUDQFKVEHKLQGLW%\]DQWLQHWK WKFHQWXU\$'6RPHDEUDLVRQV

 Tonkachel mit Hirsch. %\]DQWLQLVFK -KQ&KU[FP5¤WOLFKHU7RQPLW EHLJHP EHU]XJ 4XDGUDWLVFKHU OHLFKW HUKDEHQHUG©QQHU5DKPHQPLW]ZHL/HL VWHQUHFKWVXQGOLQNVDP5DQGGHU.DFKHO GDULQ HLQ QU ODXIHQGHU +LUVFK GDKLQWHU ]ZHL =ZHLJH $EULHE DQ YHUVFKLHGHQHQ 6WHOOHQREHQDP5DQGIUDJPHQWLHUW u



3URYHQLHQ] ([ 6DPPOXQJ 76 /RQGRQ HUZRUEHQLQGHQHU-DKUHQLQ/RQGRQ 7HUUDFRWWDWLOHZLWKEHLJHVOLSGHSLFWLQJDGHHUDQG

276






WZREUDQFKHVEHKLQGLW%\]DQWLQHWKWKFHQWXU\$'6RPHDEUDLVRQV and the top of the frame is fragmented.

ULQJVZLWKVPDOOEXOOHWV%\]DQWLQHWKWKFHQWXU\$'3DUWO\VHGLPHQWV and abraison.

 Tonkachel mit Gesichtsmaske. %\]DQWLQLVFK    -K Q &KU [FP5¤WOLFKHU7RQPLWEHLJHPEHU]XJ(LQHUKDEHQHU 3HUONUHLV ]ZLVFKHQ ]ZHL ~DFKHQ IDUELJHQ 3HUOULQJHQ ,Q GHQ .UHLVHQ HLQH *HVLFKWVPDVNH PLW GXQNOHQ $XJHQ XQG VSLW]HP %DUW7HLOZHLVH$EULHEXQG$EODJHUXQJHQ u

 Tonkachel mit Sonne. %\]DQWLQLVFK-KQ&KU[ FP5¤WOLFKHU7RQPLWEHLJHPEHU]XJ(LQ*HVLFKWLQ0LWWHQ HLQHV HUKDEHQHQ 6WUDKOHQNUDQ]HV 6WDUNHU $EULHE 6SXUHQ YRQ )DUEUHVWHQ u

3URYHQLHQ]([6DPPOXQJ76/RQGRQHUZRUEHQLQGHQHU-DKUHQ in London. 9JO / :DPVHU +UVJ  'LH :HOW YRQ %\]DQ]  (XURSDV ¤VWOLFKHV (UEH $XVVWHOOXQJ0©QFKHQ  6$EE 7HUUDFRWWDWLOHZLWKEHLJHVOLSGHSLFWLQJDIDFHPDVNLQWKHPLGGOHRIWKUHH



3URYHQLHQ]([6DPPOXQJ76/RQGRQHUZRUEHQLQGHQHU-DKUHQ in London. 9JO / :DPVHU +UVJ  'LH :HOW YRQ %\]DQ]  (XURSDV ¤VWOLFKHV (UEH $XVVWHOOXQJ0©QFKHQ  6$EE 7HUUDFRWWD WLOH ZLWK EHLJH VOLS GHSLFWLQJ D IDFH LQ PLGGOH RI DQ DXUHROH %\]DQWLQHWKWKFHQWXU\$'6WURQJDEUDLVRQWUDFHVRIFRORXU



277


,6/$0





e Stehender Widder. -KQ&KU/FP%URQ]HKRKOJXVV $XJHQXQG6WUXNWXUGHV)HOOVLQ)RUPYRQ)LVFKJUÂ&#x201D;WPXVWHULQ .DOWDUEHLWDQJHJHEHQ*U©QEUDXQH3DWLQD6FKZDQ]JHEURFKHQ HLQH +RUQVSLW]H IHKOW HLQ %HLQ ZLHGHUDQJHVHW]W XQWHUH +LQWHUOÂ&#x201D;XIHZLHGHUDQJHVHW]WHLQXQWHUHU9RUGHUODXIIHKOW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK$XNWLRQ/RV 9JO7KH'DYLG&ROOHFWLRQ.RSHQKDJHQ,QY %URQ]H UDP ,VODPLF WK  WK FHQWXU\ $' *UHHQEURZQ SDWLQD WDLO EURNHQ WLS RI RQH KRUQ PLVVLQJ RQH OHJ UHDWWDFKHG WKH ORZHU KLQG OHJV reattached, one foreleg missing.

278

 Sammlung islamischer Fliesen. -KQ&KU'DUXQWHUHLQ JURgHVUHFKWHFNLJHV6W©FN FD[FP*HUDKPWJHEURFKHQ XQGWHLOZHLVHHUJÂ&#x201D;Q]W PLWGLDJRQDOHQ:HOOHQEÂ&#x201D;QGHUQXQG%O©WHQ $XgHUGHP]ZHLZHLWHUHJHUDKPWH6W©FNH [FPE]Z [ FP MHZHLOV PLW 5DKPHQ  PLW EODXHQ %O©WHQ XQG %OÂ&#x201D;WWHUQ HLQTXDGUDWLVFKHV6W©FN [FPHLQH(FNHJHEURFKHQ PLW %O©WHQGHNRULQ%ODX*U©QXQG5RWXQGHLQNOHLQHUHV6W©FNPLW DUDELVFKHU6FKULIW [FP 'LHEHLGHQOHW]WHUHQ6W©FNHPLW )LO]DXIGHU8QWHUVHLWH5 Stück! u 3URYHQLHQ] ([ 1DFKODVV .DULQ .RUWH %D\HUQ GDYRU )DPLOLHQEHVLW] LQ 'HXWVFKODQGVHLWGHQHU-DKUHQ &ROOHFWLRQRIRWWRPDQWLOHVPDLQO\,]QLNWKWKFHQWXU\$'7KUHHLQ DZRRGHQIUDPHWZRZLWKIHOWRQWKHEDFNVLGHSLHFHV


35$(.2/80%,6&+(.8167



 *URgH9DVHPLW0DLVJ¤WWHUQ0D\D &KDPD .ODVVLVFKH3HULRGH FLUFD    Q &KU + FP 7RQ PLW URWHU RUDQJHU XQG VFKZDU]HU %HPDOXQJ DXI FUHPHIDUEHQHP *UXQG +RKH ]\OLQGULVFKH9DVHPLWJODWWHP%RGHQPLWGHU'DUVWHOOXQJYRQ]ZHL 0DLVJ¤WWHUQGLHMHZHLOVYRQHLQHPYHUWLNDOHQ+LHURJO\SKHQEDQG JHWUHQQW VLQG (LQ ZHLWHUHV +LHURJO\SKHQEDQG ]LHUW GHQ 5DQG 9RU MHGHP 0DLVJRWW VWHKW HLQH NOHLQH NRUSXOHQWH )LJXU PLW UHLFKHP)HGHUVFKPXFN'LHGHWDLOOHUHLFKH%HPDOXQJLVWÂ&#x201D;XgHUVW IHLQXQGTXDOLWÂ&#x201D;WYROO0LW7/*XWDFKWHQYRP'H]HPEHU und Kopie des Kaufbelegs!)DFKPÂ&#x201D;QQLVFKUHVWDXULHUW u

3URYHQLHQ]([3ULYDWVDPPOXQJ6/%DGHQ:©UWWHPEHUJHUZRUEHQEHLGHU *DOHULH3HUXDQD8OULFK+RIIPDQQDP0Â&#x201D;U] +LJKGHOLFDWHO\SDLQWHG0D\D9DVHGHSLFWLQJWZRFRUQJRGVDQGWKHLUDGRUDQWV 7KHGHFRUDWLRQLVYHU\W\SLFDORIWKHQDWXUDOLVWLFVW\OHRI&KDPDZKHUHWKH }QHVW0D\DYDVHSDLQWLQJZDVSURGXFHG([SHUWO\UHVWRUHGIURPVHYHUDOSLHFHV $':LWK7/$QDO\VLVDQGFRS\RIWKHVDOHVUHFHLSW

279






 *ROGHQHU *UHLIYRJHO 9HUDJXDV FD    Q &KU J +FP%FP*ROGJHJRVVHQXQGJHK”PPHUW*UHLIYRJHO PLW KHUYRUWUHWHQGHP 6FKQDEHO XQG .ODXHQ 5DQNHQZHUN DP .RSIGLH)O©JHOZHLWDXVJHEUHLWHWGLH6FKZDQ]IHGHUQWHLOHQVLFK ZHLWDXVHLQDQGHUGold.$XIK”QJHVHDP5©FNHQLQWDNW u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV $9HUDJXDVJROGDYLDQELUGSHQGDQWZLWKSURWUXGLQJEHDNDQGWDORQVWKH KHDGGHFRUDWHGZLWKVFUROOZRUNFUHVWV7KHUDSWRUKDVDUFKLQJORQJZLQJVDQG DORQJELIXUFDWHGWDLO$VXVSHQVLRQORRSDWWKHEDFNRIWKHQHFN,QWDFWFD $'

 Goldenes Lama. 9LFXV FD    Q &KU / FD FP + FPJ*ROGEOHFKJHO¤WHW6WHKHQGHU/DPDKHQJVWGold. (LQGUXFNDXIGHU1DVHNOHLQHV/RFKDP+DOVVRQVWVHKUJXWH (UKDOWXQJ u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. Statuette of a standing male Lama made from hammered gold. Minor punch DWQRVHWLQ\KROHRWKHUZLVHYHU\JRRGFRQGLWLRQ9LFXVFD$'



 Goldener Papagei. 7DLURQD FD    Q &KU + FP J *ROG 6WDWXHWWH HLQHV 3DSDJHLV GHU YHUPXWOLFK DOV /LSSHQVFKPXFNGLHQWH'HWDLOVZLH$XJHQXQG1DFNHQJH}HGHU LQ IHLQHQ =LVHOLHUXQJHQ XQG 6SLUDOHQ DQJHJHEHQ 8QWHU GHP 6FKQDEHOVHGold.,QWDNW u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. 7DLURQDJROGOLSSOXJVKDSHGDVDSDUURWGHFRUDWHGZLWKRSHQZRUNFLUFOHVDQG }QHVWRUQDPHQWV,QWDFW$'

280






 'UHLJROGHQH$QK”QJHU7DLURQDQ&KUD J/ FDFP*ROG.OHLQHU)URVFK©EHUGHQ5©FNHQIHLQ]LVHOLHUWHV %DQGPXVWHUODXIHQG$XJHQXQG1DVHQO¤FKHUDOVNOHLQH3HUOHQJH VWDOWHWGLH9RUGHUI©gHLQ]ZHLVHQDXVODXIHQG,QWDNWE J/ FP*ROG6LW]HQGH0DXVGLH9RUGHUSIRWHQDOV]ZHLNOHLQHVHQ JHDUEHLWHW,QWDNWF J/FP*ROG2SRVVXPPLWNOHL QHP.RUEDXIGHP5©FNHQXQWHUGHU6FKQDX]HVHGold.,QWDNW 3 Stück! u

3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. *ROG PLQLDWXUH 7XPL GHFRUDWHG ZLWK }QHO\ FKLVHOOHG VFUROOZRUN ,QWDFW 7DLURQD$'

3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. &ROOHFWLRQRIWKUHHJROG7XPEDJDSHQGDQWVD )URJZLWKKHUULQJERQHVWULS GRZQWKHEDFN7KHIRUHIHHWVKDSHGDVORRSV,QWDFWE 6HDWHGPRXVHIRUHIHHW ORRSV,QWDFWF 2SRVVXPEHDULQJDEDVNHWRQLWVEDFN/RRSEHORZWKHPRXWK ,QWDFW7DLURQD$'SLHFHV

 Kleine Goldmaske. 9LFXV FD  Y   Q &KU + FP J*ROG.OHLQH*HVLFKWVPDVNHPLWERKQHQI¤UPLJHQ$XJHQ HLQHUYRUVSULQJHQGHQ1DVHXQGEUHLWHQ/LSSHQ©EHUGHU6WLUQ HLQJHVWULFKHOWHU+DDUNUDQ]=ZHL$XIK”QJH¤VHQEHLGHUVHLWVGHU Stirn. Gold.$XIGHUUHFKWHQ6HLWHHWZDVEHVFK”GLJWVRQVWVHKU JXWHUKDOWHQ u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. $9LFXVJROGIDFHPDVNZLWKDSURWUXGLQJQRVHDQGDGDVKHGKDLUIULQJH 0LQRUGDPDJHRQWKHULJKWKDOIRIWKHIDFHRWKHUZLVHYHU\JRRGFRQGLWLRQ %&$'



 *ROGHQHV 0LQLDWXU7XPL 7DLURQD    Q &KU + FP J *ROG 0LQLDWXU7XPL PLW VHKU IHLQ ]LVHOLHUWHU %DQGGHNRUDWLRQDXIGHQ6SLW]HQGHVKDOEPRQGI¤UPLJHQ7XPLV MHZHLOVHLQHNOHLQH$XIK”QJHVHGold.,QWDNW u

281






 *ROGHQHU/LSSHQS~RFN0RFKHFDQ&KUJ/FP/LSSHQS~RFNDXVJHZDO]WHP ]XVDPPHQJHUROOWHP XQG YHUO¤WHWHP *ROGEOHFK DQ EHLGHQ (QGHQ 5LQJ DXV NOHLQHQ UXQGHQ 6FKHLEFKHQDXIJHOHJWGold.,QWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ0.%D\HUQ *ROGOLSRUQDPHQWPDGHIURPFROGUROOHGVKHHGDSSOLHGZLWKWLQ\URXQGVOLFHV0RFKHFD$',QWDFW

 Zwei goldene Nasenringe. 9LFXV FD    Q &KU k FP JXQGkFPJ*ROG EOHFK =ZHL KDOEPRQGI¤UPLJH JODWWH1DVHQULQJHGold. 6W©FN ,QWDNW u 3URYHQLHQ]6DPPOXQJ+:%D\HUQ erworben in den 1980er Jahren, ex Sammlung M. B., Hamburg. 7ZR9LFXVFUHVFHQWVKDSHQRVHRUQDPHQWV PDGHIURPKDPPHUHGJROG,QWDFWFD $'SLHFHV

 6DPPOXQJ YRQ *HZDQG$SSOL ken. &KLP¦ FD    Q &KU / FP .XSIHU*ROG /HJLHUXQJ .OHLQH JHKÂ&#x201D;PPHUWH *HZDQGDSSOLNHQ GLH 5RFKHQ ODQJVFKQÂ&#x201D;EHOLJH 9¤JHO 5DXENDW ]HQ XQG PHQVFKOLFKH *HVLFKWHU ]HLJHQXQGXPHLQHQKDOEPRQG I¤UPLJHQ1DVHQULQJGUDSLHUWVLQG Gold. 6W©FN,QWDNW u 3URYHQLHQ]6DPPOXQJ+:%D\HUQ erworben in den 1980er Jahren, ex Sammlung M. B., Hamburg.



282

&ROOHFWLRQ RI HPERVVHG 7XPEDJR DS SOLTXÂ&#x2DC;]RRPRUSKLFRUQDPHQWVGHSLFWLQJ ELUGVVNDWHVMDJXDUVKXPDQKHDGVDQG a crescent shaped nose ornament. All in YHU\ JRRG FRQGLWLRQ &KLP¦ FD   $'SLHFHV


 Zwei Bronzeköpfchen. 0RFKH FD    Y &KU D  % FD FP %URQ]HEOHFK .OHLQHU.RSIPLWHLQJHOHJWHQ$XJHQHL QHP KDOE HUKDOWHQHQ .RSISXW] XQG 5H VWHQHLQHVVSXOHQI¤UPLJHQ2KUULQJVOLQNV =ZHL %HIHVWLJXQJV/¤FKHU DP .LQQ JU©QH 3DWLQD JXW HUKDOWHQ E  % FP %URQ]HEOHFK.OHLQHU.RSIPLWQXUOLQNV HUKDOWHQHU.RSIEHGHFNXQJ=ZHL%HIHVWL JXQJV/¤FKHU DP .LQQ *XW HUKDOWHQ  Stück!*XWHUKDOWHQ u



3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQ in den 1980er Jahren, ex Sammlung M. B., Hamburg. 'LHVH .¤SIFKHQ ZDUHQ HLQPDO %HVWDQGWHLO HLQHV %UXVWVFKPXFNHV 7ZRHDUO\0RFKLFDPLQLDWXUHFRSSHUKHDGVRQFH DWWDFKHG WR D QHFNODFH (DFK ZLWK D SURPLQHQW QRVHODUJHH\HV RQHVWLOOSUHVHUYLQJLWVVKHOOLQOD\V  DQGODUJHHDUVWRWKHVLGH9HU\ZHOOSUHVHUYHGFD %&SLHFHV

 Darstellung eines Gottes in zoomorpher Gestalt. *UDQ&KLULTXLFDQ &KU + FD FP % FP %URQ]H PLW 5HVWHQ YRQ 9HUJROGXQJ 'DUVWHOOXQJ HL QHV *RWWHV RGHU 6FKDPDQHQ"  PLW GHP .RSI HLQHV *UHLIYRJHOV PLW ]ZHL .RSI )HGHUQ DXVJHEUHLWHWHQ )O©JHOQ XQG HL QHPPHQVFKOLFKHQ.¤USHUGHUDXIHLQHU VLFKHODUWLJHQ %DVLV VWHKW $XIKÂ&#x201D;QJHYRU ULFKWXQJ KLQWHQ DP .RSI UHFKWH )HGHU DP.RSIIHKOWHWZDVSRU¤VVRQVWLQWDNW u



3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLW PLQGHVWHQV &RSSHU}JXUDOSHQGDQWZLWKHPERVVHGGHFRUDWLRQV DQGUHPQDQWVRIJLOGLQJ,WGHSLFWVDVWDQGLQJJRG RUVKDPDQ" ZLWKWKHKHDGRIDQDYLDQELUGDQG DKXPDQERG\VWDQGLQJRQDVLFNOHVKDSHGEDVH $ ORRS IRU VXVSHQGLQJ DW QHFN ULJKW IHDWKHU RI WKHKHDGPLVVLQJSRURXVVSRWV*UDQ&KLULTXLFD $'

 .HWWH PLW JURgHP $QKÂ&#x201D;QJHU 3UH&KDYLQ ]ZHLWH +Â&#x201D;OIWH  -DKUWDXVHQG Y &KU / FP *URgH VFKZHUH .HWWH PLW .X JHOQDXV%HUJNULVWDOOJHVFKQLW]WHP6WHDWLW 7©UNLVHQXQG%URQ]H*URgHUUHFKWHFNL JHU$QKÂ&#x201D;QJHUDXIGHPHLQVWDUNVWLOLVLHU WHU5DXENDW]HQ.RSIGDUJHVWHOOWLVW5HVWH YRQ*ROG©EHU]XJDXIGHP$QKÂ&#x201D;QJHULQ WDNW u



3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQ in den 1980er Jahren, ex Sammlung M. B., Hamburg. /DUJHQHFNODFHPDGHIURPFKU\VWDOVWRQHWXUTXR ise and bronze beads with a rectangular bronze SHQGDQWGHSLFWLQJDIHOLQHyVKHDGLQDULJRURXVO\ VW\OL]HGIRUP7UDFHVRIJLOGLQJLQWDFW3UH&KDYLQ 2nd half 1st millenium B.C.

283




 6DPPOXQJ YHUVFKLHGHQHU SUDHNROXPELVFKHU %URQ]HREMHNWH D  + MHZHLOV FD FP %URQ]H PLW 5HVWHQ YRQ *ROG©EHU]XJ 9LHU S\UDPLGHQI¤UPLJ JHGUHFKVHOWH 5DVVHOQ 7HLOZHLVH NOHLQH $XVEU©FKHVRQVWLQWDNW0RFKHFDQ&KUE kFP %URQ]H 6WHUQI¤UPLJHU .HXOHQDXIVDW] *U©QH 3DWLQD HWZDV NRUURGLHUW ,QND  Q &KU F  + FD FP %URQ]H 6WDEDXIVDW]PLWYLHU6FKHOOHQHLQHIHKOW'HQREHUHQ5DQG]LHUHQ GLH DXVJHVFKQLWWHQHQ )LJXUHQ YRQ YLHU NQLHQGHQ .ULHJHUQ PLW JURgHQ KDOEPRQGI¤UPLJHQ .RSIEHGHFNXQJHQ *U©QH 3DWLQD HWZDV NRUURGLHUW &KLP¦ FD  Q &KU G  + MHZHLOV FD FP %URQ]H =ZHL LQ 7UHLEDUEHLW JHVWDOWHWH PHQVFKOLFKH .¤SIHDOV*HZDQG$SSOLNDWLRQHQ*U©QH3DWLQDLQWDNW&KLP¦ FD  Q &KU H  + FP XQG FP %URQ]H =ZHL (XOHQN¤SIH HLQHU MDQXVN¤S}J XQG PLW 5DVVHOIXQNWLRQ GHU DQGHUH(XOHQPDVNH*U©QHXQGU¤WOLFKH3DWLQDLQWDNW&KLP¦ FDQ&KUI /FP%URQ]H/DQJH*HZDQGQDGHO REHUHU $EVFKOXVV WHOOHUI¤UPLJH UXQGH 6FKHLEH *U©QH 3DWLQD ,QWDNW ,QND  Q &KU J  / MHZHLOV FP %URQ]H =ZHL*HZDQGQDGHOQGHUREHUH$EVFKOXVVMHZHLOVDOVVWLOLVLHUWHU )LVFKNRSIJHVWDOWHW*U©QH3DWLQDPLW5HVWHQYRQ*ROG©EHU]XJ 0XLVFD  Q &KU K  + FP %URQ]H .OHLQHV 7XPL GHVVHQ REHUHU $EVFKOXVV LQ ]ZHL 9ROXWHQ DXVOÂ&#x201D;XIW



284

*U©QH3DWLQDLQWDNW7ROLPDFDQ&KUL /FP 5¤KUHQNQRFKHQ)UDJPHQWHLQHU)O¤WHPLWGUHL/¤FKHUQDXIGHU 5©FNVHLWHJHVFKQLW]WHUJHRPHWULVFKHU'HNRU~DQNLHUWYRQ]ZHL 5DXEWLHUHQ&KDYLQY&KU6W©FN u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. &ROOHFWLRQRIVHYHUDO3UHFROXPELDQEURQ]HREMHFWVD )RXUS\UDPLGLFDOUDWWOHV 0RFKH$'E 6WDUVKDSHGPDFHKHDG,QFD$' F )LQLDORIDVWDIIZLWKIRXUEHOOV RQHPLVVLQJ WKHWRSFORVXUHEXLOWE\IRXU ZDUULRUVPDGHLQRSHQZRUN&KLP¦$'G 7ZRFRSSHUKHDG RUQDPHQWV&KLP¦H 7ZRRZOPDVNVRQH-DQXVIDFHGZLWKUDWWOHIXQFWLRQ &KLP¦I &ORDNSLQ,QFDJ 7ZRFORDNSLQVZLWKVW\OL]HG}VKKHDGV0XLVFD $'K 0LQLDWXUH7XPL~DQNHGE\YROXWHV7ROLPD $'L )UDJPHQWHG~XWHPDGHIURPDKROORZERQHZLWKFDUYHGGHFRUDWLRQ &KDYLQ%&SLHFHV

 Kette aus Jade. *XDQDFDVWHQ&KU/FP3ROLHUWHU GXQNHOJU©QHU XQG KHOOHU -DGHLW .HWWH DXV DEZHFKVHOQG DXIJHUHLKWHQ UXQGHQ XQG ]\OLQGHUI¤UPLJHQ *OLHGHUQ LQ GHU 0LWWHHLQ]DSIHQI¤UPLJH$QKÂ&#x201D;QJHU$XIPRGHUQHQ1\ORQIDGHQ DXIJH]RJHQH[]HOOHQWH(UKDOWXQJ u


3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLW PLQGHVWHQV -DGHQHFNODFH'HHSJUHHQMDGHEHDGQHFNODFHZLWK DODUJHVPRRWKSROLVKHGFRQHVKDSHGSHQGDQW*X DQDFDVWH$',QH[FHOOHQWFRQGLWLRQ

 =ZHL JURgH $QK”QJHU 1LFR\D *XDQDFD VWH    Q &KU D  / FP 3R OLHUWHU JHVSUHQNHOWHU GXQNOHU *U©QVWHLQ -DGHLW  %HLOI¤UPLJHV ,GRO VRJ $[W JRWWw  PLW HLQJHULW]WHQ /LQLHQ GLH HLQ JUREHV *HVLFKW HLQ +DDUEDQG XQG ©EHU GHQ /HLE JHOHJWH +”QGH ]HLJHQ KLQWHQ 6”JHVWHJ $P .RSIWHLO TXHU GXUFKERKUW LQWDNW E  / FP 3ROLHUWHU KHOOHU JH VSUHQNHOWHU-DGHLW%HVFKUHLEXQJZLHD Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLW PLQGHVWHQV 7ZR ODUJH FDUYHG DQG SROLVKHG MDGH $[H*RG SHQGDQWV7KHLQFLVHGKDQGVFODVSHGDJDLQVWWKH FKHVW VXQNHQ WKLQ JURRYHV LQGLFDWLQJ WKH IDFLDO IHDWXUHVDQGVXUPRXQWHGE\DKDWFKHGKHDGEDQGV 3DOHJUHHQPRWWOHGVWRQHSLHUFHGDWWKHQHFNVIRU VXVSHQVLRQ([FHOOHQWFRQGLWLRQFD$' SLHFHV 

 9LHU-DGH$QK”QJHU1LFR\D*XDQDFDVWH FD    Q &KU D  / FP 3R OLHUWHUKHOOHUJHVSUHQNHOWHUXQGJH”GHUWHU *U©QVWHLQ -DGHLW  0HVVHUI¤UPLJHV ODQ JHV $QK”QJHU,GRO VRJ $[WJRWWw  PLW HLQJHULW]WHQ /LQLHQ GLH HLQ JUREHV *H VLFKW HLQ +DDUEDQG XQG ©EHU GHQ /HLE TXHU XQG VFKU”J JHOHJWH $UPH ]HLJHQ KLQWHQ 6”JHVWHJ $P .RSI GXUFKERKUW LQWDNWE /FP3ROLHUWHU~DVFKHQJU© QHU -DGHLW $OV 3DSDJHLHQYRJHO EHLGVHLWLJ JHVWDOWHWHU NOHLQHU $QK”QJHU =ZHLIDFK GXUFKERKUW NOHLQH %HVFK”GLJXQJ F  / FP3ROLHUWHUKHOOHUJHVSUHQNHOWHU-D GHLW /”QJOLFKHU JHUXQGHWHU  $QK”QJHU PLWHLQHP9RJHOJHVLFKWXQGKRKHP$XI VDW] LP .RSIWHLO TXHU GXUFKERKUW G  / FP3ROLHUWHUKHOOHUJHVSUHQNHOWHU-D GHLW.OHLQHUEUHWWDUWLJHU$QK”QJHURKQH %LQQHQ]HLFKQXQJ GDV .RSIWHLO ]DFNLJ DXVJHV”JW+LQWHQ6”JHVWHJYRUQHNOHLQHV /RFK XQG LP +DOVEHUHLFK OLQNV NOHLQHV /RFK]XU$XIK”QJXQJ,QWDNW4 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLW PLQGHVWHQV Collection of four carved and polished jade SHQGDQWV D  6OHQGHU EODGHVKDSHG SHQGDQW UHSUHVHQWLQJDQ$[H*RGE )ODW%LUGSHQGDQWw PDGHIURPGHHSJUHHQSROLVKHGMDGHF 5RXQGHG REORQJIRUPHGELUGSHQGDQWwG $[H*RGZLWK URXQGHG~DWEODGHDQGDMDJJHGGHVLJQDWWKHWRS *XDQDFDVWH    $' $OO LQ H[FHOOHQW FRQGLWLRQSLHFHV



285






 .OHLQH .ULHJHU}JXU 0RFKH FD    Q &KU + FP +HOOJU©QHUJHVSUHQNHOWHU7©UNLV.XQVWYROOJHDUEHLWHWHJULPPLJ EOLFNHQGH.ULHJHU}JXUPLWHLQHP%HLQDP%RGHQNQLHQGLQGHU 5HFKWHQ.HXOHDXVEODXZHLgHP6WHLQKDOWHQG©EHUGHP$UP NOHLQHU 5XQGVFKLOG DXV 6SRQ\OXV0XVFKHONDON XP GHQ +DOV EUHLWH .HWWH DXV URWHQ XQG EODXHQ 6WHLQHQ GLH $XJHQPXOGHQ ZDUHQ HLQJHOHJW (U WUÂ&#x201D;JW HLQH ~DFKH .DSSH GLH +DDUH IDOOHQ KDOEODQJLQGHQ1DFNHQ6HOWHQHV2EMHNW u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. 6PDOONQHHOLQJZDUULRU}JXULQHPDGHIURPPRWWOHGJUHHQWXUTXRLVH+HZHDUV DUHGDQGEOXHQHFNODFHDQGKROGVFOXEDQGVKLHOGLQWKHULJKW+LVH\HVZHUH RQFHODLGLQ,QWDFW0RFKLFDFD$'

286

 Krieger aus Holz. 0RFKHFDQ&KU+FP'XQNOHV +RO] .XQVWYROO JHVFKQLW]WH JULPPLJ EOLFNHQGH .ULHJHU}JXU PLWHLQHP%HLQDP%RGHQNQLHQGLQGHU5HFKWHQ.HXOHKDOWHQG ©EHUGHPOLQNHQ$UPNOHLQHQ5XQGVFKLOGEHLGHDXV6SRQG\ORV 0XVFKHONDON GLH $XJHQ PLW ZHLgHP 0XVFKHONDON HLQJHOHJW ]ZHL JURgH 6FKHLEHQRKUULQJH DXV 0XVFKHONDON PLW 7©UNLVHQ $XI GHP .RSI WUÂ&#x201D;JW GHU .ULHJHU HLQH .DSSH LQ )RUP HLQHV NDXHUQGHQ-DJXDUVGHVVHQ6FKZDQ]VLFKQDFKKLQWHQ]XHLQHU 6FKODXIHHLQULQJHOW6HOWHQHV2EMHNW u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. :RRGHQ VNLOIXOO\ FDUYHG ZDUULRU ZHDULQJ FOXE DQG VKLHOG PDGH IURP VSRQG\OXVVKHOODVZHOODVKLVGLVFVKDSHGHDUULQJVZLWKWXUTXRLVHLQOD\VDQG KLVH\HV+HZHDUVDODUJHFDSLQIRUPRIDFURXFKLQJMDJXDU0RFKLFDFD $'




 Jaguarpaar. 7HRWLKXDFDQ0H[LFRFDQ&KU/ XFP+FP$XVJU©QOLFKHP.DO]LW=ZHLOLHJHQGH7LH UHPLWJH¤IIQHWHQ0”XOHUQVRGDVVMHZHLOV]ZHLJURgH5HLg]”K QHVLFKWEDUVLQG1DVHQO¤FKHUXQG7DW]HQVLQGPLWGHP%RKUHU DQJHGHXWHW%HLEHLGHQ7LHUHQYHUO”XIWGXUFKJHKHQGYRP0DXO ELV]XP+LQWHUWHLOHLQHURKUDUWLJHIIQXQJ kXPFP YHU PXWOLFK XP :DVVHU DEODXIHQ ]X ODVVHQ (LQHU GHU -DJXDUH KDW HLQHQ ZXFKWLJHUHQ .RSI XQG HLQHQ XP GDV +LQWHUWHLO JHOHJWHQ 6FKZDQ] ŠXgHUVW VHOWHQ %HLOLHJHQG HLQ *XWDFKWHQ YRQ $QWRQ 6FKQHOOGHU.RSLHGHU5HFKQXQJGHV*HP”OGH+DXVHVVRZLHGLH RULJLQDOH3XEOLNDWLRQYRQ&XHVWD'RPLQJR 6W©FN3DUWLHOOZLH GHU]XVDPPHQJHVHW]WXQG6S©QJHLP6WHLQ u

3URYHQLHQ]$XVGHUV©GGHXWVFKHQ3ULYDWVDPPOXQJ3%HUZRUEHQEHL 'DV*HP”OGH+DXV0©QFKHQ]XYRULQ3ULYDWVDPPOXQJ/X]HUQ 3XEOL]LHUW0&XHVWD'RPLQJR$P˜ULFD3UHKLVS‘QLFD7LHPSR\&XOWXUD D&G&  6XQG$EE $SDLURIO\LQJMDJXDUVPDGHIURPOLJKWJUHHQ&DOFLWHZLWKRSHQHGPRXWKV DQG D URXQG RSHQLQJ JRLQJ DORQJ WKH ERG\ OLNH D ZDWHU SLSH 3DUWLDOO\ UHDWWDFKHG DQG FUDFNV ([WUHPO\ UDUH $FFRPSDQLHG E\ DQ H[SHUWLVH E\ $QWRQ6FKQHOODFRS\RIWKHLQYRFHRI*HP”OGH+DXV0XQLFKDQGWKH RULJLQDOSXEOLFDWLRQE\&XHVWD'RPLQJRSLHFHV

 =HUHPRQLDO.HXOHQNRSI*XDQDFDVWH Q&KU+FP+HOOJU©QHU6WHLQ YHUVLQWHUW .HXOHQNRSI LQ )RUP HLQHV 9RJHONRSIHV,QWDNW u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLW PLQGHVWHQV 6WRQHHI}J\PDFHKHDGLQIRUPRIDVW\OL]HGELUGyV head. Pale green stone with sinterings, intact. *XDQDFDVWH$'



287




 *URgH6WHLQYDVH8OXD7DOQ&KU+FPkFP *HOEOLFKHU 0DUPRU +RKHV ]\OLQGULVFKHV *HIÂ&#x201D;g PLW ~DFKHP %RGHQ XQG HLQHP XPODXIHQGHQ OHLFKW HUKDEHQHP 5LQJ GLH Â&#x201D;XgHUH :DQG UHLFK UHOLH}HUW PLW 5DQNHQZHUN LQ GHVVHQ 0LWWH DXI MHGHU 6HLWH HLQ MDQXVN¤S}JHV PHQVFKOLFKHV *HVLFKW GDUJHVWHOOWLVW'HUREHUH5DQGLVWYRQGHU5HOLHI]RQHGXUFKHLQ ~DFKHVXQUHOLH}HUWHV%DQGJHWUHQQW'LHVHLWOLFKHQ+HQNHOVLQG DOV 0LVFKZHVHQ KDOE 0HQVFK KDOE 5DXENDW]H JHVWDOWHW Mit .RSLH HLQHV =HLWXQJVDUWLNHOV ©EHU GLHVHV *HIÂ&#x201D;g $XVEU©FKH DP REHUHQ5DQGHLQLJH$EVFK©UIXQJHQXQGNOHLQH$EODJHUXQJHQ NOHLQHV/RFKLP%RGHQVRQVWLQWDNW u

288

3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV &\OLQGULFDOPDUEOHYHVVHORQD~DWERWWRPZLWKULQJEDVHWKHZDOOVFDUYHGLQ UHOLHIRQERWKVLGHVE\RSSRVHGVFUROOZRUNLQWKHPLGGOHRIZKLFKDSSHDUVD -DQXVIDFHGKXPDQKHDG7KHKDQGOHVDUHIRUPHGDVFUHDWXUHVPL[HGRIPDQ DQGMDJXDU2XWEUHDNDWULPVRPHDEUDVLRQVDQGVHGLPHQWVVPDOOKROHLQ WKHERWWRPRWKHUZLVHLQWDFW8OXD9DOOH\FD$'


556

556 Steinvogel. *URgH$QWLOOHQ7DLQRQ&KU+ FP'XQNHOJUDXHU6WHLQ6NXOSWXUHLQHVDEVWUDNWJHVWDOWHWHQ9R JHOVDP.RSIGHQ)O©JHOQXQGGHQ%HLQHQHLQJHULW]WHJHRPHWUL VFKH9HU]LHUXQJHQ$XIGHU5©FNVHLWHLVWGLH:LUEHOVÂ&#x201D;XOHGXUFK HLQH YHUWLNDOH /LQLH PLW HLQJHWLHIWHQ 3XQNWHQ GDUJHVWHOOW 0LQL PDOH%HVWRgXQJHQXQG.UDW]HUVRQVWDXVJH]HLFKQHWHU=XVWDQG u Provenienz: Ex süddeutsche Sammlung, erworben in der Galerie Christophe 9DURVL%U©VVHO]ZLVFKHQ $UDUH7DLQRVWRQH}JXUHRIDELUG7KHVSUHDGZLQJVWKHKHDGDQGWKHOHJV GHFRUDWHGZLWKJHRPHWULFDOLQFLVLRQVFD$'Tiny bruises, otherwise excellent condition!

557 Sitzende Figur mit Pilzkopf. 0D\D3UÂ&#x201D;NODVVLVFKH3HULRGH Y&KU+FP*UDXHU6WHLQ0HQVFKOLFKH)LJXUPLW]\OLQ GULVFKHP.¤USHUGHU.RSISLO]DUWLJJHELOGHW$UPHXQG%HLQH VLQGSODVWLVFKKHUDXVPRGHOOLHUWGLH+Â&#x201D;QGHKDOWHQHLQHQUHFKWHN NLJHQ*HJHQVWDQGXPNODPPHUWSehr selten!,QWDNW u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV 6WRQHLGROLQIRUPRIDVHDWHGKXPDQZLWKFDUYHGOLPEVWKHKHDGGHVLJQHGDV DPXVKURRP7KHKDQGVFODVSLQJDUHFWDQJXODUREMHFW,QWDFW0D\D3UHFODVVLF 3HULRGFD%&

557

289


 Hockender Mann. $WODQWLVFKH$EGDFKXQJVS”WH3HULRGHFD Q&KU+FP*UDXHU7XIIVWHLQ+RFNHQGHU0DQQ GLHYHUVFKU”QNWHQ$UPHDXIVHLQH.QLHJHOHJWGHQ©EHUJURgHQ .RSIPLWGHU.XU]KDDUIULVXUOHLFKWDQJHKREHQ,QWDNW u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV $VHDWHGPDQ VKDPDQw ZHOOFDUYHGIURPWXIDVWRQHKLVFURVVHGDUPVUHVWLQJ RQKLVNQHHV,QWDFW$WODQWLF:DWHUVKHG/DWH3HULRGFD$'

559 Zwei Männer und der Kopf eines Jaguars. $WODQWLVFKH $EGD FKXQJ FD    Q &KU D  + FP *UDXHU 7XIIVWHLQ 6WHKHQGHU 0DQQ PLW HLQHP QHW]DUWLJHQ 6FKXU] EHNOHLGHW ,P DQJHZLQNHOWHQOLQNHQ$UPWU”JWHUGHQDEJHVFKODJHQHQ.RSIHL QHV)HLQGHVGLHHUKREHQH5HFKWHKLHOWZRKOHLQH:DIIH'DV~” FKLJH*HVLFKWPLWGHUNHLOI¤UPLJHQ1DVHXQGGHPEUHLWHQ0XQG ZLUGYRQHLQHU.XU]KDDUIULVXUXPUDKPW.OHLQH$EVFK©UIXQJHQ DPUHFKWHQ(OOERJHQXQGDQGHQ=HKHQVRQVWLQWDNWE +FP *UDXEUDXQHU7XIIVWHLQ+RFNHQGHU0DQQPLWDXIJHVW©W]WHPOLQ NHQ%HLQDXIGHPGLHOLQNH+DQGUXKW'LHUHFKWH+DQGKDWHU DXIGHQ.RSIJHOHJW%UXVWXQG5©FNHQPXVNXODWXUVLQGGXUFK 5LW]OLQLHQ DQJHJHEHQ 'DV VLFKWEDUH OLQNH 2KU LVW GXUFKERKUW 0LQLPDOH $EVFK©UIXQJHQ VRQVW LQWDNW F  / FP + FP *UDXHU 7XIIVWHLQ .RSI HLQHV -DJXDUV PLW JURgHQ 5HLg]”KQHQ XQG©EHUGLPHQVLRQDOHQ$XJHQ3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV 7ZR PDOH VWRQH }JXUHV IURP WKH $WODQWLF :DWHUVKHG UHJLRQ RQH RI WKHP FURXFKLQJWKHRWKHUKROGLQJWKHFXWRIIKHDGRIDQHQHP\LQKLVOHIWDUP,Q DGGLWLRQWKHKHDGRIDMDJXDUZLWKIRXUODUJHIDQJV$OOZHOOSUHVHUYHGFD $'3 pieces!



559

290


560 0LQLDWXU -DJXDU0HWDWH *XDQDFDVWH1LFR\D FD    Q &KU / FD FP + FP *UDXEUDXQHU 9XONDQVWHLQ 0HWDWH PLW HLQJHWLHIWHP UHFKWHFNLJHQ )HOG HLQHP JXW DXVJHDUEHLWHWHQ -DJXDUNRSI XQG GLFNHP 6FKZDQ] GHU HLQHQ +HQNHO ELOGHW ,QWDNW u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV $PLQLDWXUH-DJXDUw0HWDWHIURPWKH*XDQDFDVWH1LFR\D5HJLRQRIOLJKW EURZQYROFDQLFVWRQHVXSSRUWLQJDUHFWDQJXODU~DWERZO7KHMDJXDUyVKHDG LV GHFRUDWHG ZLWK LQFLVHG H\HV DQG JHRPHWULFDO  SDWWHUQV WKH WDLO LV FXUOHG GRZQZDUGIRUPLQJDKDQGOH,QWDFWFD$' 560

561 Ritualbeil mit Januskopf. *URgH$QWLOOHQ7DLQRFD Q&KU+FDFP6FKZDU]HU6WHLQ.HLOI¤UPLJHV5LWXDOEHLO REHQ YRQ MDQXVN¤S}JHP *HVLFKW PLW WLH~LHJHQGHQ $XJHQ EUHLWHP JH¤IIQHWHQ 0XQG NHLOI¤UPLJHU 1DVH XQG ZXOVWLJHP +DDUNUDQ]DEJHVFKORVVHQ,QWDNW u 3URYHQLHQ]([:60©QFKHQ$XVV©GGHXWVFKHU3ULYDWVDPPOXQJHUZRUEHQ LQGHQHU-DKUHQLP.XQVWKDQGHO $VWRQH7DLQRGRXEOHKHDGHGFHUHPRQLDOD[H(DFKIDFHZLWKGHHSVHWH\HV DEURDGRSHQPRXWKDQGDZHGJHVKDSHGQRVH,QWDFWFD$'

 .OHLQH6WHLQ}JXU.XOWXUYRQ6DQ$XJXVWLQFDQ&KU +FDFP*UDXHU6WHLQ.OHLQH6WHLQ}JXUPLW~DFKVNXOSWLHU WHQ$UPHQXQG+”QGHQGLHYRUGLH%UXVWJHOHJWVLQGXQGHLQHQ ~DFKHQ NDXP PHKU HUNHQQEDUHQ *HJHQVWDQG KDOWHQ 'HU IDVW TXDGUDWLVFKH .RSI PLW GHU EUHLWHQ 1DVH GHQ VFKU”JJHVWHOOWHQ

561

$XJHQXQGGHPEUHLWHQ0XQGLVWYRP5XPSIGXUFK]ZHL.HU EHQDEJHVHW]W$XIGHP.RSIWU”JWGLH)LJXUHLQH~DFKH.DS SHGLH2KUHQVLQGDOVVHLWOLFKH=DSIHQJHDUEHLWHW+LQWHQLVWGLH )LJXU~DFKXQGJUREEHKDQGHOWSehr seltenes Objekt!:LQ]LJH %HVWRgXQJHQVRQVWVHKUJXWHUKDOWHQ u 3URYHQLHQ]$XVED\HULVFKHU3ULYDWVDPPOXQJ6$LQGHQHUQHUZRUEHQ 9JOGD]XGHQ7H[WEHL)$QWRQ'LH.XQVWGHU*ROGO”QGHU  6 1U1HEHQGHQYLHOHQJURgHQ6NXOSWXUHQIDQGHQVLFKDOOHUGLQJVK¤FKVW VHOWHQLQ6DQ$XJXVWLQZHQLJH0LQLDWXUHQGLHP¤JOLFKHUZHLVHDOV0RGHOO I©UJU¤gHUH%LOGQLVVHGLHQWHQYLHOOHLFKWDOV*UDEEHLJDEHQRGHUQXUDOV6W¤gHO I©U0DLVN¤UQHUEHQXW]WZRUGHQVLQGw $VWRQH}JXUHRIWKH6DQ$XJXVWLQFXOWXUHDUPVKHOGXSWRWKHFKHVWZLWKKDQGV FODVSLQJDUHFWDQJXODUREMHFW0LQRUEUXLVHVRWKHUZLVHYHU\JRRGFRQGLWLRQ Very rare object!



291


 Steinerne Zeremonialaxt. *URgH $QWLOOHQ 7DLQR.XOWXU FD    Q &KU + FD FP *UDXEUDXQHU 6WHLQ 5XQG OLFKH6WHLQVNXOSWXULQ)RUPHLQHUPHQVFKOLFKHQ)LJXUPLWHLQHP DEVWUDNWHQ *HVLFKW GDV PXOGHQI¤UPLJH ©EHUJURgH $XJHQ HL QHQ~HLVFKLJHQ0XQGXQGHLQHNHLOI¤UPLJH1DVH]HLJW'LH2K UHQVLQGVHLWOLFKDXVJHIRUPWGDV+DDUOLHJWLQGLFNHQ6WUÂ&#x201D;KQHQ LP 1DFNHQ 'LH DXI GHP /HLE ]XVDPPHQJHOHJWHQ $UPH VLQG GXUFKODQJH5LW]OLQLHQDXVJHGU©FNW6WHLQSDUWLHOOHWZDVYHUZLW WHUWVRQVWLQWDNW u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ-66©GGHXWVFKODQGLQGHQHU HU-DKUHQLPHQJOLVFKHQ.XQVWKDQGHOHUZRUEHQ &DUYHGVWRQHFHUHPRQLDOD[HIURPWKH7DLQR&XOWXUHZLWKDQDEVWUDFWIDFH WKHDUPVPDUNHGE\LQFLVHGOLQHV6WRQHSDUWLDOO\ZHDWKHUHGRWKHUZLVHLQWDFW $'

564 Vier kleine SteingefäÃ&#x;e. &KDYLQFDY&KUD +FP 6WHDWLW.XQVWYROOUHOLH}HUWHUNOHLQHU%HFKHUPLWGHU'DUVWHOOXQJ HLQHV-DJXDUVPLWKHUDXVKÂ&#x201D;QJHQGHURUQDPHQWLHUWHU=XQJHXQG HLQHP*XLOORFKH0RWLY,QWDNWE +FP6WHDWLW.OHLQH9DVH PLWUXQGHP%RGHQIHLQUHOLH}HUWPLWGHPRUQDPHQWDOJHVWDOWHWHQ %LOGHLQHV0HQVFKHQ,QWDNWF kFP6WHDWLW.OHLQHUXQGH 6FKDOHRUQDPHQWDOUHOLHI}HUW.OHLQHU6SUXQJVRQVWLQWDNWG k FP.OHLQHUXQGH6FKDOHPLW'DUVWHOOXQJPHQVFKOLFKHU.¤SIH XQG+Â&#x201D;QGH,QWDNW4 Stück! u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ 6DPPOXQJ0%+DPEXUJ



)RXU&KDYLQVWHDWLWHYHVVHOV}QHO\FDUYHGZLWKVW\OL]HGFUHDWXUHVDQGJXLOORFKH RUQDPHQWV([FHOOHQWFRQGLWLRQFD%&4 pieces!

564

292


565 GroÃ&#x;es GefäÃ&#x; mit Truthahnkopf. *XDQDFDVWH PLWWOHUH SRO\FKUR PH 3KDVH  FD    Q &KU+FP%HPDOWHU7RQ+R KHV HLI¤UPLJHV *HIÂ&#x201D;g DXI HLQHP URW EHPDOWHQ NRQLVFKHQ 6WDQG ULQJ,PREHUHQ%HUHLFKVLQGGHU .RSI HLQHV 7UXWKDKQV PLW VHLW OLFKHQ )O©JHOQ XQG HLQHP KRFK DXIJHULFKWHWHQ 6FKZDQ]JH}HGHU GDV ]XJOHLFK DXFK DOV W©OOHQI¤U PLJHU $XVJXVV GLHQW SODVWLVFK DQPRGHOOLHUW 'HQ *HIÂ&#x201D;gN¤USHU EHGHFNW HLQH XPODXIHQGH 0DOH UHLLQ2FNHUXQG6FKZDU]GLHHLQ HFKVHQÂ&#x201D;KQOLFKHV )DEHOZHVHQ PLW PHQVFKOLFKHQ *OLHGHUQ GDUVWHOOW 0LW 7/$QDO\VH %UXFK LP %H UHLFKGHU6FKZDQ]IHGHUQXQGGHU %DXFK]RQHIDFKPÂ&#x201D;QQLVFKUHVWDX ULHUW u 3URYHQLHQ] ([ 6DPPOXQJ ( :©UIHO %D\HUQVHLWPLQGHVWHQV /DUJHHJJVKDSHGSRO\FKURPHYDVHZLWK ~DUHGEDVHDQGLQFXUYLQJULP0RGHOHG KHDGZLQJVDQGWDLOIHDWKHUVRIDWXUNH\ FRFN 3URIHVVLRQDO UHVWDXUDWLRQ LQ WKH WDLODQGEHOO\DUHD*XDQDFDVWH 0LGGOH 3RO\FKURPH 3HULRG  FD    $'7KHORWLVDFFRPSDQLHGE\D7/ Analysis!

565

566 Runde FuÃ&#x;schale. *XDQDFDVWH 6SÂ&#x201D;WSRO\FKURPH (SRFKH 6DQ WD $QD3KDVH  FD    Q &KU + FP k GHU 6FKDOH FP %HPDOWHU 7RQ 5XQGH ~DFKH6FKDOHPLWGUHLDP5DQG DSSOL]LHUWHQ K\EULGHQ -DJXDU N¤SIHQ 6LH VLW]W DXI HLQHU WUDSH ]RLGHQ %DVLV GLH DXI GUHL 6HLWHQ GUXFKEURFKHQ LVW XQG DQ ]ZHL (QGHQ ZLHGHUXP PLW NOHLQHQ UDXENDW]HQÂ&#x201D;KQOLFKHQ .¤SIFKHQ JHVFKP©FNWLVW'DVJDQ]H*HIÂ&#x201D;g LVW EHLJH JUXQGLHUW XQG PLW 3LN WRJUDPPHQ XQG JHRPHWULVFKHQ 0XVWHUQLQ6FKZDU]XQG2UDQJH EHGHFNW 0HKUHUH JHNOHEWH %U© FKHDQGHU6FKDOHXQGGHU%DVLV u 3URYHQLHQ] ([ 6DPPOXQJ ( :©UIHO %D\HUQVHLWPLQGHVWHQV 9JOGD]X5:LOOH\'DVDOWH$PHULND 3URS\OÂ&#x201D;HQ.XQVWJHVFKLFKWH 1DFKGU  )DUEWDI;;,, A round Guanacaste tripod plate with cut out trapezoidal support and applications RIK\EULGMDJXDUKHDGV3DLQWHGZLWKSLF tograms and geometric patterns in orange DQGEODFNRQDEHLJHFRDW6HYHUDOUHVWRU HG JOXHG EUHDNDJHV /DWH 3RO\FKURPH 3KDVHFD$'

566

293


567 Gefäß mit Jaguarkopf. *XDQDFDVWH VS”WHSRO\FKURPH 3KDVH XPQ&KU+FP7RQPLWU¤WOLFKHP EHU]XJ +RKHV EDXFKLJHV *HI”g DXI GUHL 6WDQGEHLQHQLQ)RUPHLQHVDQWKURSRPRUSKHQ*RWWHV PLWGHP.RSIHLQHV-DJXDUV5DQGXQG%DXFK]RQH VRZLH GLH YRUGHUHQ %HLQH PLW 'DUVWHOOXQJHQ YRQ )DEHOZHVHQXQGJHRPHWULVFKHQ0XVWHUQLQ6FKZDU] 2FNHUXQG5RWEHPDOW,QWDNW u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV  /DUJHSRO\FKURPHMDJXDUWULSRGYHVVHO&OD\ZLWKUHGGLVKFRDW Geometrical designs painted in red, ochre and black ornate WKHULPWKHEHOO\DUHDDQGWKHOHJV,QWDFW*XDQDFDVWH/DWH SRO\FKURPHSHULRGDERXW$'

 Zwei Schalen und ein Zwerg. *UDQ &KLULTXL 6S”WH 3HULRGH  XP  Q &KU D  + FP k FP 7RQPLWEHLJHPEHU]XJ)XgVFKDOHPLW%HPDOXQJ LQ 5RW XQG 6FKZDU] LP ,QQHUHQ GLH VWDUN VWLOLVLHU WH'DUVWHOOXQJ]ZHLHUVLFKJHJHQ©EHUVWHKHQGHU0HQ VFKHQ PLW ODQJHQ $UPHQ XQG NOHLQHQ .¤SIHQ GLH 6FKDOHQI©gHDOVPHQVFKOLFKH*HVLFKWHUJHVWDOWHW,Q WDNWE +FPkFP7RQPLWU¤WOLFKHPEHU]XJ .XJHOLJH 6FKDOH PLW GUHL 5DVVHOI©gHQ LQ )RUP YRQ 9RJHON¤SIHQDXgHQPLWVFKZDU]HQXQGURWHQ/LQL HQ EHPDOW LQQHQ VWLOLVLHUWHV PHQVFKOLFKHV *HVLFKW ,QWDNWF +FP7RQPLWEHLJHPEHU]XJ.OHL QHV*HI”gPLWUXQGHP%RGHQLQ)RUPHLQHVKRFNHQ GHQ=ZHUJHVGDV*HVLFKWXQGGLH$UPHPRGHOOLHUW 'HWDLOVLQ'XQNHOEUDXQXQG5RWJHPDOW3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV  567

7KUHHFOD\REMHFWVIURPWKH*UDQ&KLULTXL&XOWXUH7ZRWULSRG bowls, painted in red and dark brown, and a small vessel in IRUP RI D FURXFKLQJ GZDUI $OO LQWDFW DERXW  $' 3 pieces!



294


569 Zwei zoomorphe Gefäße. D  + FP %HPDOWHU 7RQ PLW KHOOEUDXQHU (QJREH %DXFKLJHV *HI”g PLW GUHL NOHLQHQ 6WDQGI©gHQLQ)RUPHLQHVKRFNHQGHQ0HQVFKHQPLWDQ PRGHOOLHUWHP.RSIGHUHLQH+DXEHWU”JW2EHUVFKHQNHO XQG$UPHVLQGLQ6FKZDU]XQG5RWDXIJHPDOWHEHQVR ZLHHLQDXIGHU%UXVWK”QJHQGHVUXQGHV3HNWRUDO+LQWHQ LVWHLQHJURgHURWH6FKOHLIHLQ0DOHUHLDQJHJHEHQDXIGHQ 6HLWHQLVWMHZHLOVHLQHJURgH5RVHWWHGDUJHVWHOOW0DOHUHL HWZDVDEJHULHEHQOHLFKWH9HUVLQWHUXQJVVSXUHQVRQVWLQ WDNW *XDQDFDVWH VS”WH SRO\FKURPH 3HULRGH FD  Q&KUE +FP7RQPLWURWEUDXQHPEHU]XJ XQG5LW]GHNRULQJHRPHWULVFKHQ0XVWHUQ.XJHOLJHV*H I”gLQ)RUPHLQHVVLW]HQGHQ(QWHQPDQQHVwPLWEUHLWHP 6FKQDEHO GLH SODVWLVFKHQ NRQ]HQWULVFKHQ $XJHQ VRZLH HLQ6WLUQEDQGDQPRGHOOLHUW9RUGHUWHLOGHV6FKQDEHOVJH EURFKHQXQGZLHGHUDQJHVHW]WVRQVWLQWDNW*XDQDFDVWH /LQHDU'HFRUDWHG3HULRGFDQ&KU2 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Two Guanacaste anthropomorphic vessels: a) Globular tripod bowl ZLWK D PRGHOHG KXPDQ KHDG DQG OHJV 6XUIDFH VOLJKWO\ ZRUQ RII RWKHUZLVHLQWDFW/DWH3RO\FKURPH3HULRGFD$'E  6PDOOFKRFRODWHZDUHYHVVHOLQIRUPRIDGXFNPDQwGHFRUDWHGZLWK GHWDLOHGOLQHDQG]LJ]DJPRWLIVLQFLVHGRQWKHVXUIDFH%HDNSDUWO\ EURNHQDQGJOXHGVPDOOEUHDNDWUHDUVXSSRUWRWKHUZLVHLQWDFW&D $'2 pieces!

570 Figurengefäß eines Würdenträgers. &KDQFD\ FD    Q &KU + FP 5¤WOLFKHU 7RQ PLW %HPDOXQJ LQ &UHPHXQG'XQNHOJUDX)LJXUHQJHI”gHLQHVPLWXQWHUJH VFKODJHQHQ%HLQHQVLW]HQGHQ:©UGHQWU”JHUVPLWKRKHP .RSISXW] 2KUHQVFKHLEHQ XQG %DUWPDVNHw ,P %UXVW EHUHLFK WU”JW HU HLQ 3HNWRUDO LP 3XQNWGHNRU .OHLQHUH $ESODW]XQJHQVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$ %HUOLQ'HXWVFKODQGHU-DKUHELV

569

$&KDQFD\]RRPRUSKLFYHVVHOLQIRUPRIDVHDWHGGLJQLWDU\ZHDULQJDKLJKKHDGGUHVV DQGODUJHVSRROHDUULQJV6PDOOHUDUHDVRIVSDOOLQJRWKHUZLVHLQWDFW$'

571 Deckel mit sitzender Figur. 0DQWHQRFDQ&KUkFP + GHU )LJXU FP *UDXHU 7RQ 'HFNHO PLW 5HOLHIPXVWHU GDUDXI VLW]HQGH )UDX EHLGH +”QGH DXI GLH .QLH JHOHJW 'HFNHO WHLOZHLVH DXV )UDJPHQWHQ]XVDPPHQJHVHW]W u 3URYHQLHQ]$XVGHU6DPPOXQJ+:%D\HUQVHLWGHQHU-DKUHQHUZRUEHQLQ GHQHU-DKUHQH[6DPPOXQJ0%+DPEXUJ 0DQWHQREODFNZDUHOLGZLWKVHDWHGZRPDQ/LGIUDJPHQWHGFD$'

570

571

295


 Schildkröte. /D7ROLWDFDYQ&KU / FP + FP 5¤WOLFKHU 7RQ *HI”g LQ )RUPHLQHU6FKLOGNU¤WHPLWOHLFKWHUKREHQHP .RSIDXIGHP5©FNHQUXQGHU$XVJXVV'H WDLOVDOVDXIPRGHOOLHUWH3XQNWHXQG%”QGHUDQ JHJHEHQ GLH $XJHQ LQ .DIIHHERKQHQ)RUP %HVFK”GLJXQJ DP $XVJXVV XQG DP UHFKWHQ +LQWHUEHLQVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ ( :©UIHO %D\HUQ VHLW PLQGHVWHQV $UDUH]RRPRUSKLFYHVVHOLQWKHIRUPRIDWXUWOHZLWKDQ H[SDQGLQJWDLOWKHKHDGWLOWHGVOLJKWO\XSZDUG'DPDJHV DWULPDQGULJKWKLQGOHJRWKHUZLVHLQWDFW/D7ROLWD FD%&$'



 Zwei zoomorphe Gefäße. D  / FP + FD FP5¤WOLFKHU7RQ/DQJRYDOHV*HI”gGHV VHQ 9RUGHUWHLO LQ HLQHP K\EULGHQ .RSI PLW )LVFKPDXO XQG 2KUHQ DXVO”XIW $P 5©FNHQ UXQGHU VHKU ZHLWHU $XVJXVV XQG HLQ EUHL WHU %DQGKHQNHO ,QWDNW &KRUUHUD FD  Q&KUE +FPkFP5¤WOLFKHU 7RQ+RKHVHLI¤UPLJHV*HI”gDXINRQLVFKHP 6WDQGIXg $Q HLQHU 6HLWH GHU .RSI HLQHV 2SRVVXPV GDV VHLQH 3IRWHQ XQWHU GDV .LQQ JHOHJWKDWXQGHLQH)UXFKWLP0DXOK”OWDQ PRGHOOLHUW ,QWDNW 1LFR\D 6S”WSRO\FKURPH 3HULRGHQ&KU2 Stück! u 3URYHQLHQ] ([ 6DPPOXQJ ( :©UIHO %D\HUQ VHLW PLQGHVWHQV



7ZR ]RRPRUSKLF FOD\ YHVVHOV D  (ORQJDWHG YHVVHO LQIRUPRID}VKZLWKDZLGHRSHQVSRXWDQGDVWUDS KDQGOH,QWDFW&KRUUHUDFD%&$'E  /DUJHHJJVKDSHGPRQRFKURPHYDVHZLWK~DUHGEDVH DQGLQFXUYLQJULP:LWKPRGHOHGRSRVVXPyVKHDGRQ RQHVLGH1LFR\D/DWH0RQRFKURPH3HULRGFD $'2 pieces!

574 =\OLQGULVFKHV 7ULQNJHI”g 0D\D VS”WNODVVL VFKH3HULRGHFDQ&KU+FP k FP 7RQ PLW U¤WOLFKHP EHU]XJ =\ OLQGULVFKHV *HI”g PLW U¤WOLFKHP EHU]XJ 'LH %HPDOXQJ LQ 5RW XQG 6FKZDU] ]HLJW DQ GHU$XgHQZDQGGUHLYRQJHRPHWULVFKHQ0X VWHUQ HLQJHUDKPWH )HOGHU LQ GHUHQ =HQWUXP MHZHLOV HLQ PHQVFKOLFKHU .RSI PLW UHLFKHP )HGHUVFKPXFN HUNHQQEDU LVW 8QWHU GHP 5DQGYHUO”XIWHLQ)ULHVYRQZHLWHUHQ.¤SIHQ PLW )HGHUVFKPXFN ,QQHQ PLW URWHQ 6WUHLIHQ XQG HLQHP JHRPHWULVFKHQ )ULHV EHPDOW ,Q GHU 5DQG]RQH PHKUHUH JHNOHEWH %U©FKH HLQ )UDJPHQWHUJ”Q]W u 3URYHQLHQ] ([ 6DPPOXQJ ( :©UIHO %D\HUQ VHLW PLQGHVWHQV

574

296

$ 0D\DQ SRO\FKURPH F\OLQGHU YHVVHO RI VOLJKW EDUUHO shape, the wall painted in red and black showing three geometrical decorated panels, each enclosing a human KHDGZHDULQJDWXUEDQZLWKSOXPHVSURMHFWLQJIURPWKH IURQW6HYHUDOJOXHGEUHDNV/DWH&ODVVLF3HULRGFD $'


575 Große Vase. 0D\DVS”WNODVVLVFKH3HULRGHFDQ&KU +FPkFP7RQPLWU¤WOLFKEUDXQHPEHU]XJ+RKHV ]\OLQGULVFKHV*HI”gGLH$XgHQZDQGLQI©QI=RQHQLQ5RW%HLJH XQG6FKZDU]EHPDOW,QGHU0LWWH]ZHL3DQHHOHLQGHQHQ]ZHL P\WKRORJLVFKH 9RJHOZHVHQ VLW]HQ =ZHL $XVEU©FKH DP 5DQG )DUEHHWZDVYHUULHEHQVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV $ ODUJH 0D\DQ SRO\FKURPH F\OLQGHU YHVVHO WKH VWUDLJKW ZDOOV SDLQWHG LQ }YH]RQHVZLWKWZRSDQHOVGHSLFWLQJP\WKRORJLFDOELUGV7ZREUHDNVDWULP RWKHUZLVHLQWDFWFD$'

576 Zwei sitzende Fruchtbarkeitsgöttinnen und eine Schale. D  + FP+RKO}JXUDXV7RQPLWKHOOEUDXQHPEHU]XJ6LW]HQGH )UDXPLWNXU]HQGLFNHQ%HLQHQGLHDXIJHVWHOOWHQ)©gHHLQZ”UWV JHGUHKW.RSI*HVLFKW$UPH%U©VWHXQG%DXFKQDEHOVLQGSOD VWLVFK PRGHOOLHUW 'HWDLOV GHU %HNOHLGXQJ LQ 5RW XQG 'XQNHO EUDXQDXIJHPDOWGHU.RSIPLWHLQHP]\OLQGULVFKHQ$XIVDW]ZLH EHLHLQHP*HI”gREHQRIIHQ.RSIDEJHEURFKHQXQGZLHGHUUH VWDXULHUW VRQVW LQWDNW &KLULTXL'LTXLV    Q &KU  E  +FDFP+RKO}JXUDXV7RQPLWKHOOEUDXQHPEHU]XJ6LW ]HQGH)UDXPLWNXU]HQGLFNHQ%HLQHQGLH$UPHLQGLH+©IWHQ JHVWHPPW .RSI *HVLFKW $UPH %U©VWH XQG %DXFKQDEHO VLQG SODVWLVFKPRGHOOLHUW'HWDLOVGHU%HNOHLGXQJLQ5RWXQG'XQNHO EUDXQDXIJHPDOW,QWDNW&KLULTXL'LTXLVQ&KUF  +FPkFP7RQPLW%HPDOXQJ.OHLQH'UHLIXgVFKDOHPLW OLQHDUHU%HPDOXQJLQ6WUHLIHQXQGJHRPHWULVFKHQ0XVWHUQPLW 5RW XQG 6FKZDU] DXI EHLJHP *UXQG ,QWDNW 1LFR\D *XDQD FDVWHOLQHDUH'HNRUDWLRQVSKDVHFDQ&KU3 Stück! FPLW7/$QDO\VH6HOWHQLQGLHVHU(UKDOWXQJ u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV 7ZRVHDWHGSRO\FKURPHIHPDOHKROORZFOD\}JXUHVIURPWKH'LTXLVFXOWXUH DQGDERZOD +HDGEURNHQRIIDQGUHVWRUHGRWKHUZLVHLQWDFWE &RORXU VOLJKWO\ZRUQRIILQWDFW$'F 3RO\FKURPHWULSRGERZOZLWK OLQHDUSDLQWLQJLQEODFNUHGDQGFUHDPZLWKUDWWOHIXQFWLRQ,QWDFW1LFR\D *XDQDFDVWH/LQHDU'HFRUDWHG3HULRG$'3 pieces! Rare in this FRQGLWLRQF ZLWK7/DQDO\VLV

575

576

297


577 Fisch. &KLP¦    Q &KU + FP$QWKUD]LWIDUEHQJHEUDQQWHU7RQ *HI”gLQ)RUPHLQHVUXQGOLFKHQ)LVFKHV PLW SODVWLVFKHU 5©FNHQ XQG 6FKZDQ] ~RVVH DP .RSI PLW GHQ UXQGHQ $XJHQ XQGGHPNOHLQHQ0DXOVLQGGLH%UXVW~RV VHQ PLW O”QJOLFKHQ 6WULFKHQ DQJHJHEHQ (LQ EUHLWHU %DQGKHQNHO YHUELQGHW GHQ .¤USHUPLWGHPKRKHQ$XVJXVVDXIGHP 5©FNHQ([]HOOHQWH(UKDOWXQJ u 3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ HUZRUEHQHU-DKUHELVJHNDXIWDP 6HSWHPEHUEHL1HLUL]1RQ(XURSHDQ$UW .XUI©UVWHQGDPP%HUOLQ 577

&KLP¦VWLUUXSYHVVHOLQIRUPRID}VK,QWDFWFD $'

 Zoomorphes Gefäß mit Raubkatzenkopf. &KLP¦ Q¤UGOLFKH .©VWH    Q &KU + FD FP *UDXHU 7RQ PLW EUDXQEHLJHU (QJREH 2YDO JHIRUPWHV %DQGKHQNHOJHI”g PLW HLQHP DXIJHOHJWHQ 'HNRUYRQZLQ]LJHQ3DSDJHLHQ9RUGHP $XVJXVV VLW]W HLQ -DJXDUNRSI PLW ]ZHL PHQVFKOLFKHQ+”QGHQ,QWDNW u Provenienz: Ex Sammlung Everett Burton Helm, 0LQQHDSROLV86$%HUOLQ'HXWVFKODQGHU -DKUHELV A Chimú oval shaped vessel with strap handle and DMDJXDUyVKHDGDWWKHIURQW,QWDFW $'

579 =ZHL}J©UOLFKH*HI”gH*XDQDFDVWHVS”WH 3HULRGHFDQ&KUD +FP 5¤WOLFKHU7RQPLWGXQNHOEUDXQHPEHU ]XJXQG5LW]GHNRU*HI”gLQ)RUPHLQHU VWLOLVLHUWHQPHQVFKOLFKHQ)LJXUGLHDXIHL QHU%DQNRGHU0HWDWHPLW9RJHODSSOLND WLRQHQVLW]WXQGLQGHUUHFKWHQ+DQGHLQ UXQGHV*HI”gK”OW'HUEUHLWHKDOEUXQGH .RSI LVW REHQ ~DFK PLW HLQHP 1RSSHQ IHOGDEJHVFKORVVVHQREHQNOHLQHUUXQGHU $XVJXVV ,QWDNW E  + FP 5¤WOLFKHU 7RQ PLW GXQNHOEUDXQHP EHU]XJ XQG 5LW]GHNRU.OHLQHPHQVFKOLFKH)LJXUDXI HLQHP KDOEUXQGHQ *HI”g VLW]HQG LQ GHU OLQNHQ +DQG UXQGHV *HI”g KDOWHQG GHU EUHLWH.RSIZLUGYRQHLQHPGHNRULHUWHQ %DQGJHVFKP©FNWREHQ$XVJXVVORFK,Q WDNW2 Stück! Selten in dieser Erhaltung! u



3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLW PLQGHVWHQV 579

298

7ZR *XDQDFDVWH &KRFRODWH :DUHw KXPDQ }JXULQHVLQH[FHOOHQWFRQGLWLRQ/DWH3HULRGFD $'2 pieces!


 GefäÃ&#x; mit Reliefschmuck. 7DLURQDFDQ &KU + FD FP 7RQ %DXFKLJH .DQQH PLW ]ZHL NOHLQHQ +HQNHOQ DQ GHU 6FKXOWHU XQG KRKHP $XV JXVV,QGHU6FKXOWHUXQG%DXFK]RQHGUHLPLW0R GHOQ DXIJHEUDFKWH 5HOLHI]RQHQ GLH VWLOLVLHUWH )LVFKH XQG 9¤JHO ]HLJHQ 5HVWDXULHUXQJHQ DP $QVDW] GHV $XVJXVVHVNOHLQHU$XVEUXFKDP5DQGVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV 86$%HUOLQ'HXWVFKODQGHU-DKUHELV 7DLURQDMXJZLWKWKUHHUHOLHI]RQHVGHSLFWLQJVW\OL]HG}VKHVDQG ELUGV5HSDLUHGDWIRRWRIVSRXWFKLSDWULPRWKHUZLVHLQWDFW $'

 Drei GefäÃ&#x;e. D  + FP 7RQ PLW FUHPHIDUEHQHU XQGU¤WOLFKHU%HPDOXQJ*ORFNHQI¤UPLJHUKRKHU%H FKHUDXIGUHLNRQLVFKHQ6WDQGI©gHQGLHDOVPHQVFK OLFKH *HVLFKWHU JHVWDOWHW VLQG $XI GHU $XgHQZDQG GUHL GXUFK FUHPHIDUEHQH 6WUHLIHQ DEJHVHW]WH 3DQHH OHLQGHQHQGUHLEHLQLJH9RJHOZHVHQGDUJHVWHOOWVLQG 0HKUHUH %U©FKH IDFKJHUHFKW UHVWDXULHUW *UDQ &KL ULTXL  Q &KU E  + FP 5¤WOLFKHU 7RQ =\OLQGULVFKHU%HFKHUPLW~DFKHP%RGHQDXgHQPLW URWHP /LQLHQPXVWHU XQG ;'HNRU YHU]LHUW =ZHL ZLQ]LJH $XVEU©FKH DP 5DQG VRQVW LQWDNW *XDQD FDVWH ELFKURPH 3KDVH FD  Y Q &KU F  + FP 5¤WOLFKHU 7RQ =RRPRUSKHU 'UHLIXg%HFKHU PLWGHPSODVWLVFKDXVPRGHOOLHUWHQXQGURWEHPDOWHQ *HVLFKWHLQHU5DXENDW]H0HKUHUHJHNOHEWH%U©FKH DWODQWLVFKH$EGDFKXQJQ&KU3 Stück! u



3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV 7KUHH0LGGOH$PHULFDFOD\YHVVHOVD +LJKEHOOVKDSHGWULSRGYHVVHOSDLQWHGLQFUHDPDQG UHG$IHZEUHDNVQHDWO\UHVWRUHG*UDQ&KLULTXL$'E &\OLQGULFDOERZO SDLQWHGZLWKOLQHSDWWHUQV7ZRFKLSVDWULPRWKHUZLVHLQWDFW*XDQDFDVWHELFKURPH3HULRG FD%&$'F 6PDOOF\OLQGULFDO]RRPRUSKLFWULSRGFXSZLWKDIHOLQHSUHGDWRUyV IDFH$IHZEUHDNJOXHG$WODQWLFZDWHUVKHG$'3 pieces!



299






 Statuette eines Mannes. 4XLPED\DFDQ&KU5¤WOLFKHU 7RQ PLW URWEUDXQHU (QJREH 6WHKHQGH PÂ&#x201D;QQOLFKH +RKO}JXU PLW EUHLWHP VWDUN DEJH~DFKWHP .RSI XQG $UPVWXPPHOQ DQ GHQ6HLWHQGHU0XQGLVWGXUFKHLQH(LQULW]XQJGDUJHVWHOOWGLH VWXPSIH 1DVH PLW ]ZHL JURgHQ 1DVHQO¤FKHUQ UDJW QDFK REHQ 5HVWDXULHUW u 3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$%HUOLQ 'HXWVFKODQGHU-DKUHELV 6WDQGLQJKROORZPDOH}JXUHRIUHGGLVKFOD\ZLWKUHGEURZQVOLS4XLPED\D DERXW$'5HVWRUHG



300

 Statuette einer betenden Priesterin. 1RSLORD VSÂ&#x201D;WH NODVVLVFKH =HLWQ&KU+FP+RKO}JXUDXVEHLJHP7RQDXV HLQHP0RGHOJHIRUPW.OHLQH6WDWXHHLQHUVWHKHQGHQPLWHLQHU 7XQLND EHNOHLGHWHQ )UDX GLH EHLGH +Â&#x201D;QGH HUKREHQ KDW 'DV *HVLFKWPLWGHQHQJVWHKHQGHQ$XJHQXQGGHPKDOEJH¤IIQHWHQ 0XQGZLUGYRQVFKXOWHUODQJHPJHVWUÂ&#x201D;KQWHQ+DDUHLQJHUDKPW DXIGHP.RSIWUÂ&#x201D;JWGLH)UDXHLQHKDOEPRQGI¤UPLJHYROXPLQ¤VH +DXEH 'DV *HZDQG LVW LP %UXVWEHUHLFK RUQDPHQWDO YHU]LHUW XQG ]HLJW JDQ] VFKZDFKH 5HVWH GHU XUVSU©QJOLFKHQ %HPDOXQJ GLHJURgHQ)©gHVWHKHQZHLWKHUYRU$XVPHKUHUHQ)UDJPHQWHQ ]XVDPPHQJHVHW]W u




3URYHQLHQ] $XV GHU 0©QFKQHU 3ULYDWVDPPOXQJ & ) HUZRUEHQ LQ GHQ HU-DKUHQLPZHVWGHXWVFKHQ.XQVWKDQGHO

3URYHQLHQ]([6DPPOXQJ96%HUOLQH[*RUQ\ 0RVFK$XNWLRQ /RV

$1RSLORDPROGPDGHIHPDOHSULHVWVWDQGLQJZLWKKDQGVKHOGXS6KHZHDUV DWXQLFDQGDQHODERUDWHGKHDGGUHVV+HUIDFHZLWKWKHFORVHO\VHWH\HVDQG WKHSDUWHGOLSVLVHQFLUFOHGE\VWULDWHGKDLU5HVWRUHGIURPVHYHUDOIUDJPHQWV $'

(DUO\0RFKLFD 9LFXV }JXUDOYHVVHO&OD\FRYHUHGUHGGLVKEURZQ6HDWHG }JXUHZLWKIHHWSODQWHGVTXDUHO\DQGKDQGVUHVWLQJRQKLVNQHHV+HZHDUVD ORQJSDWWHUQHGFDSHDQGVWULDWHGKDLUVKDSHGOLNHDFDS'HWDLOVDUHSDLQWHG LQFUHDPOLQHV6PDOOGDPDJHVVSRXWUHDWWDFKHGRWKHUZLVHLQWDFW $':LWK7/DQDO\VLVUHSRUW

 Lastenträger. &KRUUHUDYQ&KU+FDFP+HOO EUDXQHU7RQPLWURWEUDXQHU(QJREHXQGSDUWLHOOHUFUHPHIDUEH QHU %HPDOXQJ *HI”g LQ )RUP HLQHV KRFNHQGHQ 0DQQHV GLH $UPHYRUGHU%UXVWDQJHZLQNHOW'DV+DDUI”OOWLQODQJHQ6WU”K QHQ DXI GHQ 5©FNHQ GHU 6FKHLWHO LVW DXVUDVLHUW GLH VFKOLW]I¤U PLJHQ$XJHQKDOEJHVFKORVVHQ(UWU”JWHLQH:DVVHU~DVFKHDXI GHP 5©FNHQ %HVWRgXQJHQ DQ GHQ +”QGHQ XQG DQ GHU 1DVH )DUEHSDUWLHOOOHLFKWYHUULHEHQ u 3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ JHNDXIW DP  -DQXDU  EHL 1HLUL]1RQ(XURSHDQ$UW.XUI©UVWHQGDPP%HUOLQ &KRUUHUD}JXUDOYHVVHOLQWKHIRUPRIDURWXQGVHDWHGFDUJDGRUZLWKKDQGV FURVVHGLQIURQWRIWKHFKHVWWRKROGWKHFDUU\VWUDSRIWKHZDWHUWDQNRQKLV EDFN3DLQWHGLQUHGGLVKEURZQDQGFUHDPVPDOOGDPDJHVDWKDQGVDQGQRVH FRORXUSDUWLDOO\ZRUQRII&D%&$'

 Hockender Mann. 0RFKHIU©KH3KDVH 9LFXV Q&KU + FP 7RQ PLW URWEUDXQHU PDWWJO”Q]HQGHU (QJREH 6WHLJ E©JHOJHI”g LQ )RUP HLQHV KRFNHQGHQ 0DQQHV GHU PLW HLQHU ~DFKHQ.DSSHHLQHP8PKDQJXQGHLQHPQLFKWQ”KHUEHVWLPP EDUHQ8QWHUJHZDQGEHNOHLGHWLVW'HWDLOVGHU)LJXUVLQGGXUFK FUHPHIDUEHQH/LQLHQDQJHJHEHQ0LW7/*XWDFKWHQYRP0DL /HLFKWH%HVWRgXQJHQ$XVJXVVJHNOHEWVRQVWLQWDNW u

 Vier Gefäße. 1LFR\D*XDQDFDVWH3HULRGHGHUOLQHDUHQ'HNRUD WLRQFDQ&KUD +FP7RQPLWGXQNHOEUDXQHP EHU]XJ+RKHVLFKQDFKREHQYHUM©QJHQGH9DVHPLWOHLFKWJH UXQGHWHP %RGHQ XQWHU GHP 5DQG 5LW]YHU]LHUXQJ LP )OHFKW EDQGPXVWHU :LQ]LJHU $XVEUXFK DP 5DQG VRQVW LQWDNW E  + FP7RQPLWGXQNHOEUDXQHPEHU]XJ9DVHLQELNRQLVFKHU )RUPPLW6WDQGIXgHLQHPSODVWLVFKDXVJHDUEHLWHWHQPHQVFKOL FKHQ*HVLFKWXQG]ZHL%”QGHUQPLW5LW]GHNRULQJHRPHWULVFKHQ 0XVWHUQ*HNOHEWHU%UXFKDP$XVJXVVVRQVWLQVHKUJXWHP=X VWDQGF +FP7RQPLWVFKZDU]EUDXQHPEHU]XJ.RSIJHI”g PLW5LW]GHNRU*HVLFKW1DVHXQG0XQGSODVWLVFKDXVJHDUEHLWHW ,QWDNWG +FP7RQPLWVFKZDU]EUDXQHPEHU]XJ.XJHOL JHV*HI”gPLWUXQGHP$XVJXVV,QWDNW4 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV )RXU YHU\ ZHOO SUHVHUYHG &KRFRODWH :DUHw YHVVHOV IURP WKH *XDQDFDVWH &XOWXUH/LQHDU'HFRUDWHG3HULRGFD$'4 pieces!



301


 'UHL NOHLQH 'UHLIXg6FKDOHQ D  + FP *UDXHU 7RQ PLW WHLOZHLVH GXQNHOEUDXQHU *ODVXU .XJHOLJHU %HFKHU PLW EUHLWHU IIQXQJDXIGUHLKRKHQNRQLVFKHQXQJODVLHUWHQ)©gHQGLHLP REHUHQ 7HLO PLW DQPRGHOOLHUWHQ .U¤WHQ}JXUHQ GHNRULHUW VLQG .OHLQH %HVFK”GLJXQJHQ DQ GHQ $SSOLNDWLRQHQ VRQVW LQWDNW *UDQ&KLULTXLFDQ&KUE +FP*UDXHU7RQ PLWWHLOZHLVHEUDXQHPEHU]XJXQG5LW]GHNRU%DXFKLJH6FKDOH DXIGUHLXQJODVLHUWHQJHGUXQJHQHQ)©gHQ'HUEUHLWH5DQGLVW JH]DFNWXQGDQHLQHU6HLWHPLWHLQHPSODVWLVFKDQPRGHOOLHUWHQ 7LHUNRSI YHUVHKHQ ,QWDNW /LQHD 9LHMD FD  Q &KU F +FDFP*UDXHU7RQPLWWHLOZHLVHEUDXQHPEHU]XJ .XJHOLJHV *HI”g PLW KRKHP +DOV XQG EUHLWHP $XVJXVV DXI GUHL KRKHQ )©gHQ GLH PLW )DEHOZHVHQ LQ $SSOLNDWLRQVWHFKQLN JHVFKP©FNW VLQG 0HKUHUH JHNOHEWH %U©FKH XQG NOHLQH %HVFK”GLJXQJHQDQGHQ$SSOLNDWLRQHQ/LQHD9LHMDQ &KU3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV 

7KUHHZHOOSUHVHUYHGWULSRGERZOVIURPWKH*UDQ&KLULTXL FD $' DQG/LQHD9LHMDFXOWXUH FD$' 3 pieces!

 Kugelige Flasche. &KLP¦    Q &KU + FP 'XQNHOEUDXQJHVFKPDXFKWHU7RQ.XJHOLJH)ODVFKHPLWNXU]HP $XVJXVV GHU .¤USHU PLW HLQHP 3XQNWGHNRU YHU]LHUW 9LHU 5HOLHIIHOGHU GXUFK EUHLWH 6HLWHQVWUHLIHQ YRQHLQDQGHU DEJHWHLOW ]HLJHQHLQ~RUDOHV0RWLY$XIGHU6FKXOWHU]ZHL$XIK”QJHVHQ ,QWDNW u

 Sitzender Cocabauer. &DUFKL    Q &KU + FP % GHU 3OLQWKH FP +RKO}JXU DXV 7RQ PLW U¤WOLFKEUDXQHU (QJREHXQGVFKZDU]HU%HPDOXQJ$XIHLQHPQLHGULJHQ6FKHPHO VLW]HQGHU 0DQQ GLH +”QGH DXI GLH .QLH JHOHJW EHNOHLGHW PLW HLQHP/HQGHQVFKXU]XQGHLQHU©EHU6FKXOWHUXQG%UXVWJHI©KUWHQ 6FK”USHwDXVJHIDOWHWHP6WRII(UKDWGHQUXQGOLFKHQ.RSIPLW GHU .XU]KDDUIULVXU LQ GHQ 1DFNHQ JHOHJW GHU 0XQG PLW GHQ .RNDEO”WWHUQ LQ GHU HWZDV DXIJHVFKZROOHQHQ OLQNHQ :DQJH LVW KDOEJH¤IIQHW'DV*HVLFKWLVWYRQ'HNRUDWLRQVQDUEHQEHGHFNW GLH DOV VFKZDU]H 6WULFKH HUVFKHLQHQ 0LQLPDOH $ESODW]XQJHQ XQGOHLFKWHU$EULHEGHU2EHU~”FKHVRQVWLQWDNW u

3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV 6SKHULFDOYHVVHOIURPWKH&KLP¦&XOWXUHFRYHUHGLQDSXQFWDWHSDWWHUQZLWK IRXUFDUWRXFKHVGHSLFWLQJD~RUDOPRWLYH,QWDFW$'



302

3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQ *RUQ\ 0RVFK $XNWLRQ H[6DPPOXQJ:HVWHUPDQQ'HXWVFKODQGHU-DKUH


&OD\KROORZ}JXUHRIDVHDWHG&RFDFKHZHUFRDWHGZLWKUHGGLVKEURZQDQG UHPDLQVRIEODFNSDLQWLQJ6XUIDFHVOLJKWO\UXEEHGRIIRWKHUZLVHLQWDFW&RTXHUR &DUFKL1RUWKHUQ+LJKODQGVRI(FXDGRUFD$'

590 Trinkgefäß in Fußform. 0RFKHFDQ&KU+FP 5¤WOLFK EUDXQHU JHEUDQQWHU 7RQ )LJ©UOLFK JHVWDOWHWHV *HI”g LQ )RUP HLQHV QDFNWHQ )XgHV LQ HLQHU 6DQGDOH GLH ©EHU GHP .Q¤FKHO JHEXQGHQ LVW 'LH 6RKOH ]HLJW HLQ 3UR}O DXV ]ZHL JH JHQVW”QGLJHQ6SLUDOHQ0LW7/$QDO\VHYRP.OHLQH %HVFK”GLJXQJHQDP5DQGVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELVH[ *RUQ\ 0RVFK$XNWLRQ/RVH[6OJ'U(UQVW-)LVFKHU 3XEOL]LHUWLQ+''LVVHOKRII/HEHQLPDOWHQ3HUX  6'HU*ODQ] SHUXDQLVFKHU+RFKNXOWXUHQ-DKUH3HUX'LH,QNDXQGLKUH9RUIDKUHQ 6DPPOXQJ'U(UQVW-)LVFKHU*DOHULHLP$OWHQ5DWKDXVLQ:LWWOLFK 1RYHPEHU$SULO6XQWHQ



5HGGLVKEURZQYHVVHOLQIRUPRIDIRRWUROOHGLQWRDVDQGDO0RFKHFD $'0LQRUFKLSSLQJDWWKHHGJHRWKHUZLVHLQWDFW:LWK7/DQDO\VLV from 1984! Published twice!

590

590

591 Sitzende Frau mit Schlange. -DPD&RDTXHYQ&KU +FP+HOOHU7RQPLWSDUWLHOOHUU¤WOLFKHU%HPDOXQJ6WDWXHWWH HLQHU QDFNWHQ VLW]HQGHQ )UDX PLW NXU]HQ XQWHUJHVFKODJHQHQ %HLQHQGLH+”QGHUXKHQDXIGHQ2EHUVFKHQNHOQ$XIGHP.RSI WU”JWVLHHLQHKRKHREHQJHUXQGHWH+DXEHLQURWHU)DUEHDXI GLHHLQ6FKODQJHQV\PEROLP~DFKHQ5HOLHIDXIJHOHJWLVWJURgH 2KUVSXOHQ VFKP©FNHQ GLH 2KUHQ EHU GLH %UXVW GHU )UDX ULQJHOWVLFKHLQHJURgH6FKODQJHSeltene Darstellung!,QWDNW u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ 6DPPOXQJ0%+DPEXUJ $QDNHG-DPD&RDTXH}JXULQHSUHVHQWLQJDZRPDQZHDULQJDGRRPHGUHG FRORXUHGKHDGGUHVVZLWKDVQDNHV\PERO$ORQJVQDNHZLQGVRQKHUFKHVW ,QWDFW%&$'Rare!

591

303




 Drei schwarze TongefäÃ&#x;e. D  + FP 6FKZDU] JHVFKPDXFKWHU 7RQ(LQKHQNHOLJH.DQQHPLWNXJHOLJHP.¤USHUDXIHLQHPPLW JHRPHWULVFKHQ 5HOLHIV YHU]LHUWHP 6WDQGIXg KRKHP $XVJXVV XP GHQ HLQ 5HOLHIEDQG OÂ&#x201D;XIW 'HU $QVDW] GHV $XVJXVVHV ZLUG ~DQNLHUWYRQ]ZHLSODVWLVFKDXIJHEUDFKWHQ)URVFK}JXUHQ.OHLQH %HVFKÂ&#x201D;GLJXQJHQ DP $XVJXVV VRQVW LQWDNW /DPED\HTXH  Q&KUE +FDFP6FKZDU]JHVFKPDXFKWHU7RQ3IHLI JHIÂ&#x201D;g=ZHLNXJHOLJH*HIÂ&#x201D;gHDXINRQLVFKHQ)©gHQGXUFKHLQHQ

%DQGKHQNHOYHUEXQGHQDXIGHPKLQWHUHQ*HIÂ&#x201D;gKRKHUVSLW]HU $XVJXVVGDVYRUGHUHWUÂ&#x201D;JWGLH)LJXUGHV.¤QLJV1D\PODS$XV MHGHP *HIÂ&#x201D;g ZÂ&#x201D;FKVW HLQ 6FKODQJHQKDOV LQ JHJHQOÂ&#x201D;X}JHU 5LFK WXQJ.RSISXW]GHV.¤QLJVDEJHEURFKHQVRQVWLQWDNW3IHLIPH FKDQLVPXVIXQNWLRQVW©FKWLJ/DPED\HTXHQ&KUF  +FP6FKZDU]JHVFKPDXFKWHU7RQ.XJHOLJHV*HIÂ&#x201D;gPLWKR KHPNRQLVFKHQ$XVJXVVGHUYRQHLQHULP5HOLHIGDUJHVWHOOWHQ (FKVHPLWPHQVFKOLFKHP.RSIJHWUDJHQZLUG/RFKLPKLQWHUHQ 7HLOGHU*HIÂ&#x201D;gZDQGNOHLQHU$XVEUXFKDP5DQGVRQVWJXWHU KDOWHQ&KLP¦Q&KU3 Stück! u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3.HUZRUEHQ  7KUHH SUHFROXPELDQ EODFNZDUH YHVVHOV D  -XJ ZLWK WZR IURJDSSOLFDWLRQV 0LQRUFKLSVDWULPRWKHUZLVHZHOOSUHVHUYHG/DPED\HTXH$'E  'RXEOHYHVVHOZLWKZKLVWOHIXQFWLRQWZRVQDNHOLNHQHFNVZRUPWKHLUZD\RXW RQERWKVLGHV&URZQRIIURQWDO}JXUHPLVVLQJRWKHUZLVHLQWDFW/DPED\HTXH $'F 6SKHULFDOYHVVHOZLWKKLJKVSRXWFDUULHGE\DO\LQJOL]]DUG ZHDULQJDKXPDQKHDGLQUHOLHI6PDOOKROHPLQRUFKLSDWULPRWKHUZLVH LQWDFW&KLP¦$'3 pieces!

 DoppelgefäÃ&#x; (PfeifgefäÃ&#x; / Silbador). /DPED\HTXHFD Q&KU+FP%FP7RQPLWKHOOEUDXQHU(QJREHXQGIHL QHU %HPDOXQJ LQ JHRPHWULVFKHQ 0XVWHUQ PLW EUDXQHU )DUEH 'RSSHOJHIÂ&#x201D;gLQ)ODVFKHQIRUPPLWQRFKIXQNWLRQVIÂ&#x201D;KLJHP3IHLI PHFKDQLVPXV LQ REHUHQ 7HLO GXUFK %DQGKHQNHO YHUEXQGHQ 'DVKLQWHUH*HIÂ&#x201D;gEHVLW]WHLQHQODQJHQ$XVJXVVDXIGHU6SLW]H GHVYRUGHUHQVLW]WHLQHNOHLQHPHQVFKOLFKH)LJXU%HLLKUG©UI WHHVVLFKXP1D\PODSGHQYHUJ¤WWOLFKWHQ*U©QGHUGHV/DP ED\HTXH5HLFKHVKDQGHOQ%HPDOXQJHWZDVYHUEODVVW)LJXUDXI GHUYRUGHUHQ$XVJXVVVSLW]HJHNOHEWVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV JHNDXIWDP'H]HPEHUEHL1HLUL]1RQ(XURSHDQ$UW.QHVHEHFNVWU %HUOLQ 

304

'RXEOHVSRXWHGZKLVWOHYHVVHORQHVSRXWUHSUHVHQWLQJD}JXUHRIWKHP\WKLFDO IRXQGHU1D\PODS2QHVSRXWUHSDLUHG/DPED\HTXH$'


594

595

594 KopfgefรครŸ. 0RFKH,,,,,FDQ&KU+FP5ยคWOL FKHU7RQPLWURWEUDXQHUXQGFUHPHIDUEHQHU%HPDOXQJ0ย”QQ OLFKHU 3RUWUย”WNRSI PLW VFKDUI YRUVSULQJHQGHU 1DVH XQG XQWHU GHP.LQQ]XVDPPHQJHNQRWHWHU.RSIEHGHFNXQJGLH2KUHQPLW JURgHQ UXQGHQ 6FKHLEHQ JHVFKPยฉFNW 2EHU~ย”FKH SDUWLHOO YHU ZLWWHUWDP5DQGGHV$XVJXVVHVNOHLQH$XVEUยฉFKH u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV JHNDXIWDP-DQXDUEHL1HLUL]1RQ(XURSHDQ$UW.XUIยฉUVWHQGDPP %HUOLQ 0RFKLFD SRUWUDLW KHDG YHVVHO SDLQWHG LQ FUHDP DQG UHGGLVK EURZQ $ UHDOLVWLFDOO\UHQGHUHGIDFHZLWKDVKDUSO\SURWUXGLQJQRVHDQGDGRZQZDUG GUDZQPRXWKHQFLUFOHGE\DKHDGEDQG6XUIDFHSDUWO\ZRUQRIIVRPHFKLSV DWULP0RFKH,,,,,FD$'

595 Kleine Schale. 0LWWHO1D]FD3KDVH9Q&KU+FP kFP7RQPLWGXQNHOEUDXQHUURWHUXQGEHLJHU%HPDOXQJ .OHLQH UXQGH 6FKDOH DXI GHU $XgHQVHLWH LVW HLQ PHQVFKHQJH VWDOWLJHVP\WKLVFKHV:HVHQ VRJ.DW]HQGย”PRQ GDUJHVWHOOW'HU .ยคUSHULVWODQJJHVWUHFNWXQGZLQGHWVLFKHLQPDOXPGLH6FKDOHQ DXgHQVHLWH'LH'DUVWHOOXQJZLUGDP5DQGYRQHLQHP)ULHVDXV PHQVFKOLFKHQ.ยคSIHQDEJHVFKORVVHQ,QWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV 6PDOO1D]FDERZOSDLQWHGLQUHGFUHDPDQGEURZQUHSUHVHQWLQJWKHIDPRXV P\WKLFDOย&DWJRGGHVVwRQWKHRXWVLGH,QWDFW/DWH1D]FDFD$'

596 SteigbรผgelgefรครŸ mit Vรถgelkรถpfen. 0RFKH9FDQ&KU +FP*UDXHU7RQPLW%HPDOXQJLQ&UHPHXQG'XQNHOEUDXQ .XJHOLJHV6WHLJEยฉJHOJHIย”gUXQGXPEHPDOWPLWHLQHP)ULHVYRQ .RQGRUNยคSIHQLQ%UDXQDXIFUHPHIDUEHQHP*UXQGGHUVLFKLQ 6WUHLIHQXPGHQ*HIย”gNยคUSHU]LHKWGHU+HQNHOLVWPRQRFKURP EUDXQ5HVWDXULHUWHU%UXFKDP+HQNHOVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV 6WLUUXSYHVVHOSDLQWHGLQFUHDPDQGGDUNEURZQZLWKDIUHH]HRI&RQGRUKHDGV FLUFXODWLQJDURXQGWKHFRUSXV5HVWRUHGFUDFNDWWKHKDQGOHRWKHUZLVHLQWDFW 0RFKH9FD$'

596

305


597 Steigbügelgefäß mit Früchten. 0R FKH,,,,,FDQ&KU+ FP 5¤WOLFKHU 7RQ PLW %HPD OXQJLQ&UHPH%UDXQXQG5RWEUDXQ =\OLQGULVFKHV 6WHLJE©JHOJHI”g PLW UXQGXPODXIHQGHU DEVWUDNWHU 'DU VWHOOXQJ YRQ 9¤JHOQ GLH LKUH .¤SIH QDFK KLQWHQ OHJHQ =X EHLGHQ 6HLWHQ GHV *HI”gHV VLQG HLI¤UPLJH )U©FKWH DQJHEUDFKW 7DPDULOOR"  GHU +HQNHO LVWPLWVFKZDU]HQ6WUHLIHQEHPDOWDP $QVDW]GHV$XVJXVVHVVLW]WHLQNOHLQHU 9RJHO :LQ]LJH $XVVSOLWWHUXQJHQ DP $XVJXVVVRQVWLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ HUZRUEHQHU-DKUHELV &\OLQGULFDOVWLUUXSYHVVHOSDLQWHGLQUHGFUHDP DQGUHGGLVKEURZQ$SSOLFDWLRQRIWDPDULOOR IUXLWVRQERWKVLGHVRIWKHERG\DVPDOOELUG FORVHWRWKHVSRXW7LQ\FKLSVDWULPRWKHUZLVH LQYHU\JRRGFRQGLWLRQ0RFKH,,,,,FD $'

 Zwei Gefäße. D  + FP *UDXHU 7RQ PLW EHLJHU (QJREH 5XQGRYDOHV 6WHLJE©JHOJHI”g DXI 6WDQGULQJ GHU .¤USHUYROOVW”QGLJEHGHFNWPLWHLQHU IHLQHQ %HPDOXQJ LQ KHOOEUDXQHQ /L QLHQGLH]ZHL6FKODQJHQXQG5RVHW WHQ2UQDPHQWH]HLJW$Q]ZHL6HLWHQ ]ZHL ZLQ]LJH )U¤VFKH DQPRGHOOLHUW GHU *HI”gN¤USHU ZXUGH DQ ]HQWUDOHU 6WHOOH KRUL]RQWDO GXUFKERKUW LQ HL QHUIIQXQJVLW]WHLQZHLWHUHUNOHLQHU )URVFK .OHLQHU $XVEUXFK DP 6WDQ GULQJIDFKJHUHFKWH5HVWDXULHUXQJDQ HLQHP +HQNHODQVDW] VRQVW VHKU JX WHU=XVWDQG0RFKH9FDQ &KU Seltenes, sehr originelles Gefäß! E  + FP 6FKZDU] JHVFKPDXFK WHU7RQ(LQKHQNHOLJH.DQQHDXINOHL QHP 6WDQGULQJ PLW $XVJXVV GHU DOV KRKH 7©OOH DXI HLQHP PHQVFKOLFKHQ .RSI VLW]W 'HU *HI”gN¤USHU LVW PLW HLQHP 'HNRU YRQ :DVVHUY¤JHOQ GLH SDDUZHLVH LQ ]ZHL JHSXQNWHWHQ )HOGHUQ  VLW]HQ JHVFKP©FNW ,QWDNW /DPED\HTXHFDQ&KU2 Stück! u

597

3URYHQLHQ] $XV GHU 3ULYDWVDPPOXQJ -6 6©GGHXWVFKODQGLQGHQHUHU-DKUHQ LPHQJOLVFKHQ.XQVWKDQGHOHUZRUEHQ



306

Two vessels: a) A stirrup vessel with painting LQIRUPRIWZRVQDNHVDQGURVHWWHVDQGWZR SODVWLFPLQLDWXUHIURJV7LQ\FKLSDWIRRWULQJ SURIHVVLRQDOO\UHVWRUHGDWWKHKDQGOH0RFKH 9DERXW$'5DUHDQGRULJLQDO YHVVHO E  2QHKDQGOH MXJ ZLWK D VSRXW LQ VKDSHRIDKXPDQKHDG/DPED\HTXHDERXW $'2 pieces!


599 Großes Kopfgefäß mit Raubtiergebiss. 0RFKH,99 Q &KU +  FD FP 7RQ PLW URWEUDXQHU XQG FUHPHIDUEHQHU %HPDOXQJ *HI”g LQ )RUP HLQHV .RSIHV GHU PHQVFKOLFKH XQG 5DXENDW]HQ]©JH]HLJW:”KUHQGGLH6WLUQXQG$XJHQSDUWLHGLH HLQHV0HQVFKHQVLQG]HLJWGHUXQWHUH7HLOGHV*HVLFKWHV=©JH HLQHU 5DXENDW]H PLW HLQHP EUHLWHQ KDOE JH¤IIQHWHQ 0DXO GDV ]ZHL=DKQUHLKHQXQGYLHU5HLg]”KQHVHKHQO”VVW'DV0LVFKZH VHQ WU”JW HLQH XQWHU GHP .LQQ ]XVDPPHQJHNQRWHWH WXFKDUWLJH .RSIEHGHFNXQJ.OHLQH%HVWRgXQJDQGHU1DVHVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$%HUOLQ 'HXWVFKODQGHU-DKUHELV 0RFKLFDKHDGYHVVHOLQIRUPRIDFURVVEHWZHHQKXPDQEHLQJDQGDIHOLQH SUHGDWRU&OD\SDLQWHGLQUHGGLVKEURZQDQGFUHDPFD$'

600 Vier schwarze Tongefäße. &KLP¦ /DPED\HTXH XQG ,QND D  + FP 6FKZDU] JHVFKPDXFKWHU 7RQ 6WHKHQGH )LJXU HLQHV :©UGHQWU”JHUVPLWDXVODGHQGHPYHU]LHUWHP8PKDQJXQGKR KHU.RSIEHGHFNXQJLQGHUUHFKWHQ+DQG%HFKHULQGHUOLQNHQ ]RRPRUSKHV5LWXDOJHI”gKDOWHQG.OHLQH%HVFK”GLJXQJDP$XV JXVV KLQWHQ /RFK VRQVW LQWDNW ,QND  Q &KU E  + FP 6FKZDU] JHVFKPDXFKWHU 7RQ .RSIJHI”g PLW %DQGKHQ NHOXQGKRKHP$XVJXVV%UXFKVWHOOHQDP$XVJXVVXQG+HQNHO UHVWDXULHUW &KLP¦  Q &KU F  + FD FP 6FKZDU] JHVFKPDXFKWHU7RQ.XJHOLJHV'RSSHOJHI”gPLWUXQGHP%RGHQ XQGKRKHP$XVJXVVGXUFK6WHJYHUEXQGHQDXIGHP$XVJXVV GHVHLQHQ*HI”gHVNOHLQH(FKVHPLWPHQVFKOLFKHP.RSIVLW]HQG GLH *HI”gN¤USHU PLW NOHLQHQ (LQGU©FNHQ LQ )RUP YRQ $X JHQwJHVFKP©FNW,QWDNW&KLP¦Q&KUG +FP 6FKZDU]JHVFKPDXFKWHU7RQ'RSSHODXVJXVV*HI”gDXIKRKHP 6WDQGIXgPLW.ULHJHU}JXUHQLQJHSXQNWHWHQ5HOLHIIHOGHUQ:LQ

599

]LJH%HVWRgXQJHQDQGHQ$XVJ©VVHQVRQVWLQWDNW/DPED\HTXH Q&KU4 Stück! u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ 6DPPOXQJ0%+DPEXUJ &ROOHFWLRQRIIRXUUDUHDQGLQWHUHVWLQJEODFNZDUH}JXULQHYHVVHOVD 6WDQGLQJ GLJQLWDU\,QFD$'E (I}J\YHVVHOZLWKKLJKVSRXW,QWDFW &KLP¦$'F 'RXEOHYHVVHOZLWKDSSOLFDWLRQLQIRUPRIDKXPDQ KHDGHG OL]DUG ,QWDFW &KLP¦    $' E  'RXEOHVSRXWHG YHVVHO ,QWDFW/DPED\HTXH$'4 pieces!

600

307


601 Sammlung von kolonialen Silbergegenständen. )U©KHV-DKUKXQGHUWD /FP6LOEHU$OWH SHUXDQLVFKH %URVFKH 7XSXw  LQ /¤IIHOIRUP ,QQHQ ]LVHOLHUW PLW GHP %LOG HLQHV 5DXEYRJHOV ]ZHL NOHLQH /¤IIHO HLQHU PLW DQJHVHW]WHU .HW WH  EHLGHUVHLWV GHV /¤IIHODQVDW]HV XQG KHOOEODXH *ODVSHUOH +LQWHQ %URVFKHQQDGHO DQJHO¤WHW (W ZDV NRUURGLHUW VRQVW VHKU JXWHU =XVWDQG E  / FP .RORQLDOHU 6LOEHUO¤IIHO DP /¤IIHODQVDW] =LVHOLHUXQJPLW~RUDOHP0RWLYUHFKWVVFKODXIHQ I¤UPLJHVHDQJHO¤WHW,QWDNWF /FP6LOEHU *URgH*HZDQGQDGHOPLWGXUFKEURFKHQJHDUEHL WHWHUUXQGHU6FKHLEHGLHHLQH%O©WHGDUVWHOOWLP =HQWUXPURWH*ODVSHUOHG /FDFP6LOEHU NOHLQH*DEHOQPLWWRUGLHUWHQ6FK”IWHQREHQZLQ ]LJH/DPD}JXUHQ HLQHIHKOW DXIJHVHW]W6HKUIHL QH$UEHLW*XWHU(UKDOWXQJV]XVWDQG6W©FN u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3. HUZRUEHQ 601

$ FROOHFWLRQ RI WZHOYH 6SDQLVK FRORQLDO VLOYHU REMHFWV FRPSULVLQJWZRVSRRQVKDSHGWXSXwEURRFKHVDODUJHGLVF VKDSHG FORDNSLQ DQG QLQH PLQLDWXUH WZRSURQJHG IRUNV ZLWKWLQ\/DPD}JXUHVRQWRS$OOYHU\ZHOOSUHVHUYHG12 pieces!

125'$0(5,.$



 Fischköder eines Eskimos. $ODVND7KXOH.XOWXU-K/FP $XV :DOURVV]DKQ ,Q )RUP HLQHV VWLOLVLHUWHQ /DFKVHV PLW ]ZHL %RKUXQJHQI©UGLH$XJHQXQGHLQHUIIQXQJI©UGDV0DXOVRZLH HLQHUIIQXQJDP6FKZDQ]]XU$XIK”QJXQJSelten!2EHU~”FKH DQHLQHU6WHOOHHWZDVEHULHEHQLQWDNW u

308

3URYHQLHQ]([6DPPOXQJ:60©QFKHQ6HLWGHQIU©KHQHU-DKUHQ LQGHXWVFKHP3ULYDWEHVLW] (VNLPRFDUYHGZDOUXVLYRU\}VKOXUHLQWKHIRUPRIDVDOPRQ$ODVND7KXOH &XOWXUHWKFHQWXU\6XUIDFHDWRQHVSRWVOLJKWO\UXEEHGLQWDFW


$6,(1



 Indisches Relieffragment mit einer Statue. =HQWUDOLQGLHQ&KDQ GHOOD3HULRGH FD    -K Q &KU + FP % FP $XV U¤WOLFKHP 6DQGVWHLQ 6WDWXH PLW UHLFKHP 6FKPXFN 'LH )LJXU WUÂ&#x201D;JWVFKHLEHQI¤UPLJH2KUULQJHHLQH$UW+DOVNUDJHQHLQH.HW WH VRZLH 2EHUDUP5HLIH ©EHU GHQ 2EHUN¤USHU OÂ&#x201D;XIW GLDJRQDO HLQ 6FKPXFNEDQG $Q GHU 7DLOOH VLQG GLH 5HVWH HLQHV NXU]HQ 5RFNHVHUNHQQEDU'LH7Â&#x201D;Q]HULQJHK¤UWHXUVSU©QJOLFK]XHLQHP 5HOLHIGDVDXVPHKUHUHQ)LJXUHQEHVWDQG6LHWDQ]WDOV6\PERO GHU6FK¤QKHLW]X(KUHQGHU*¤WWHUXQGKDWVRPLWDXFKHLQHDSR WURSÂ&#x201D;LVFKH )XQNWLRQ 8QWHUDUPH XQG LQ GHU +©IWH JHEURFKHQ

+DDUNQRWHQ ZLHGHU DQJHVHW]W 2EHU~Â&#x201D;FKH EHULHEHQ 5©FNVHLWH ERVVLHUW u 3URYHQLHQ]([6DPPOXQJ%5%D\HUQVHLWYRU 9JO 6WDWXH LP 0HWURSROLWDQ 0XVHXP 1HZ <RUN $FFHVVLRQ 1XPEHU  &HOHVWLDOGDQFHU3DUWRIDVDQGVWRQHUHOLHIGHSLFWLQJDIHPDOHGDQFHUZLWKULFK MHZHOOHU\6KHLVGDQFLQJIRUWKH*RGVDQHVWKHWLFV\PEROIRUEHDXW\DQGKDV DOVRDQDSRWURSDLFHIIHFW&HQWUDO,QGLD&KDQGHOD3HULRGDERXWWKWK FHQWXU\$')RUHDUPVDQGKLSEURNHQKDLUNQRWUHDWWDFKHGVXUIDFHZRUQ EDFNVLGHHPERVVHG

309


604

604 %RGKLVDWWYD$YDORNLWHVKYDUD3DGPDSDQL*DQGKDUD-KQ&KU + FP % FP 7 FP 'XQNHOJUDXHU 6FKLHIHU 'HU QLPELHUWH%RGKLVDWWYDLQ/RWXVVLW]DXIHLQHU%O©WHQJHVFKP©FN WHQ%DVLVPLW/RWXVEO©WHLQEHLGHQ+Â&#x201D;QGHQ(UWUÂ&#x201D;JWHLQHQHOD ERULHUWHQ 7XUEDQ +DOVEDQG XQG NHWWH $UPUHLIH VRZLH XP 6FKXOWHUXQG+©IWHHLQHQ0DQWHO$XV]ZHL7HLOHQ]XVDPPHQ JHVHW]W VHQNUHFKWHU 5LVV YRP *HVLFKW ELV ]XP UHFKWHQ %HLQ  1LPEXVUHFKWH6FKXOWHUXQG2EHUDUPVRZLHDQGHQ6HLWHQJH EURFKHQ u 310

3URYHQLHQ] ([ 6DPPOXQJ ): 5KHLQODQG HUZRUEHQ LP /RQGRQHU .XQVWKDQGHOGDYRU/RQGRQHU3ULYDWVDPPOXQJVHLWGHQHU-DKUHQ ,P 0DKD\DQD%XGGKLVPXV VWHKW GHU %RGKLVDWWYD $YDORNLWHVKYDUD I©U GDV XQLYHUVHOOH 0LWJHI©KO (LQH 9DULDQWH ]HLJW LKQ DOV 3DGPDSDQL GHQ +DOWHU GHV /RWXV =X GLHVHU IULHGIHUWLJHQ *HVLQQXQJ JHK¤UW DXFK GHU /RWXVVLW] 3DGPDVDQD E]ZGLH9DMUD3RVLWLRQ %RGKLVDWWYD$YDORNLWHVKYDUD3DGPDSDQL*DQGKDUDUGFHQWXU\$''DUN JUH\VFKLVW5HDVVHPEOHGIURPWZRSDUWVWKH}VVXUHSURFHHGHGIURPWKHKHDG WRWKHULJKWOHJQLPEXVULJKWVKRXOGHUDQGXSSHUDUPEURNHQ


605

605 Kopf des Buddha. 7KDLODQG $\XWWKD\D3HULRGH FD-KQ&KU+FP+HOOEUDXQHU6DQG VWHLQ ,P +DOV JHEURFKHQ 2EHU~Â&#x201D;FKH OHLFKW YHUULHEHQ u 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU +HDGRI%XGGKD7KDLODQG$\XWWKD\DSHULRGDERXWWK FHQWXU\$'%ULJKWEURZQVDQGVWRQH%URNHQDWWKHQHFN VXUIDFHVOLJKWO\UXEEHG

606

606 Gabenbringer. *DQGKDUD  -K Q &KU + FP % FP 7 FP 'XQNHOJUDXHU 6FKLHIHU %Â&#x201D;UWLJHU 0DQQ PLW /HQGHQVFKXU] XQG 6FKXOWHUPDQWHO KÂ&#x201D;OW LQ GHU /LQNHQ HLQH NOHLQH 6FKDOH Von ausgezeichneter Qualität! 5HFKWHU 8QWHUDUPXQGDQGHQ6HLWHQJHEURFKHQVRQVWLQ VHKUJXWHP=XVWDQG u 3URYHQLHQ] ([ 6DPPOXQJ ): 5KHLQODQG HUZRUEHQ LP /RQGRQHU .XQVWKDQGHO  GDYRU /RQGRQHU 3ULYDWVDPPOXQJVHLWGHQHU-DKUHQ %HDUGHGPDQZLWKRIIHULQJ*DQGKDUDUGFHQWXU\$' 'DUNJUH\VFKLVW5LJKWORZHUDUPDQGDWWKHVLGHVEURNHQ RWKHUZLVHLQJRRGFRQGLWLRQ9HU\}QHTXDOLW\

311


607 Uma. .KPHU $QJNRU :DW6WLO FD  -K Q &KU + FP % FP 7 FP 'XQNHO JUDXHU OHLFKW JU©QOLFKHU 6DQGVWHLQ 'LH *¤WWLQ 8PD DXFK 3DUYDWL  )UDX YRQ 6KLYD PLW IUHL HP 2EHUN¤USHU LQ 6DPDEKDQJD6WHOOXQJ 8P GLH+©IWHWUÂ&#x201D;JWVLHHLQHQIHLQJHIÂ&#x201D;OWHOWHQ6DPSRW ZÂ&#x201D;KUHQGLKU+DDU]XHLQHPKRKHQNHJHOI¤UPL JHQ =RSI ]XVDPPHQJHQRPPHQ LVW GHU YRQ HL QHP UHLFK YHU]LHUWHQ 'LDGHP XPIDQJHQ ZLUG 2KUOÂ&#x201D;SSFKHQ$UPHXQG)©gHJHEURFKHQNOHLQH %HVWRgXQJDP'LDGHPLQGHQ%HLQDQVÂ&#x201D;W]HQ]ZHL (LVHQVWLIWH u 3URYHQLHQ] ([ 6DPPOXQJ ): 5KHLQODQG HUZRUEHQ LP /RQGRQHU .XQVWKDQGHO GDYRU 86DPHULNDQLVFKHU 3ULYDWVDPPOXQJ HKHPDOV %HVLW] YRQ +DUU\ -2h&RQQRU HUZRUEHQLQGHQHUELVHU-DKUHQ 7KH JRGGHVV 8PD  3DUYDWL  .KPHU VW\OH RI $QJNRU :DWDERXWWKFHQWXU\$''DUNJUH\VOLJKWO\JUHHQLVK VDQGVWRQH (DU OREHV DUPV DQG OHJV DUH EURNHQ OLWWOH VSOLQWHURIWKHGLDGHPLVVSOLWWLQJRII

 Relief mit Vishnu. .KPHU $QJNRU :DW6WLO FD -KQ&KU+FP%FP7FP 'XQNHOJUDXHU OHLFKW JU©QOLFKHU 6DQGVWHLQ PLW KHOOEUDXQHP%HODJ9RUHLQHUREHQDEJHUXQGHWHQ 6WHOHVWHKWIDVWIUHLSODVWLVFKGHUYLHUDUPLJH*RWW 9LVKQX ,Q GHQ EHLGHQ KLQWHUHQ +Â&#x201D;QGHQ KÂ&#x201D;OW HU UHFKWV GLH &KDNUD :XUIVFKHLEH  XQG OLQNV GLH 3DGD .HXOH  8P GLH +©IWH WUÂ&#x201D;JW HU HLQHQ IHLQ

607

312




JHI”OWHOWHQ6DPSRWZ”KUHQGKLQWHUHLQHP'LDGHPGDV+DDU]X HLQHP KRKHQ NHJHOI¤UPLJHQ =RSI DXIJHW©UPW LVW ,P %HUHLFK GHU +©IWH XQG %HLQH VLQG VHLWOLFK LP )ODFKUHOLHI JHDUEHLWHW GLH %HLQHXQG/HKQHQHLQHV7KURQHV]XVHKHQMit Kopie der ent VSUHFKHQGHQ6HLWHQGHV.ROOHU.DWDORJHV%HLGHYRUGHUHQ8QWHU DUPH VRZLH EHLGH )©gH JHEURFKHQ VRQVW NOHLQH %HVWRgXQJHQ U©FNZ”UWLJXQGLQGHUXQWHUHQ%UXFKNDQWHMH]ZHL%RKUXQJHQ u

3URYHQLHQ] ([ .ROOHU :HVW $VLDWLFD $XNWLRQ  /RV  H[ 6DPPOXQJ%HFNHU:HLVVNDPS+DPEXUJYRU 5HOLHI ZLWK WKH JRG 9LVKQX .KPHU VW\OH RI $QJNRU :DW DERXW WK FHQWXU\ $' 'DUN JUH\ VDQGVWRQH ZLWK EULJKW EURZQ SDWLQD %RWK ORZHU DUPVDQGIHHWDUHEURNHQRWKHUZLVHIHZPLVVLQJVSOLQWHUVDWWKHEDFNDQG EHORZHDFKWZRKROHVWith corresponding pages of the Koller catalogue (copies)!

609

609 Chinesischer bronzener Spiegel. 7DQJ'\QDVWLH-KQ&KU k FP + FP 5©FNVHLWH LQ KRKHP 5HOLHI ,Q GHU 0LWWH HLQH VH LQ )RUP HLQHV O¤ZHQDUWLJHQ 7LHUZHVHQV PLW UXQGHP 5©FNHQGDVPLWYLHU/¤ZHQ]ZHL'UDFKHQXQG]ZHL3IDXHQLQ HLQHP.UHLVJHUDKPWLVW'LH7LHUHVLQGLQDNWLYHUXQGIU¤KOLFKHU %HZHJXQJ]ZLVFKHQGHQ5DQNHQGHU7UDXEHQ]ZHLJHGDUJHVWHOOW ,QGHP]ZHLWHQ5HJLVWHUGDVGHPHUVWHQQDFKHLQHP3XQNWNUHLV

IROJWDXIJOHLFKHP+LQWHUJUXQGPLWGHQ7UDXEHQODXIHQMHZHLOV ]ZHLXQGLQVJHVDPW]Z¤OI/¤ZHQXQG9¤JHOQDFKHLQDQGHU'HU $XgHQULQJLVWPLWHLQHP2UQDPHQWJHVFKP©FNW)HLQHKHOOJUDXH 3DWLQDPLW0DODFKLW,QNUXVWDWLRQHQLQWDNW u 3URYHQLHQ](UZRUEHQDXIGHP3DULVHU.XQVWPDUNWDXV3ULYDWVDPPOXQJ &%

313


'LH=HLWGHU7DQJ'\QDVWLHLPDOWHQ&KLQDJLOWDOVHLQHUGHU+¤KHSXQNWH GHU FKLQHVLVFKHQ *HVFKLFKWH ,QVEHVRQGHUH EO©KWHQ DP NDLVHUOLFKHQ +RI DXFK GLH .©QVWH .XQVWZHUNH GLHVHU 3HULRGH EULQJHQ GLH 0DFKW XQG GHQ 5HLFKWXPGHUGDPDOLJHQ+HUUVFKHU]XP$XVGUXFN'DV0RWLYGHU/¤ZHQXQG 7UDXEHQZXUGH]XHLQHPGHUSRSXO”UVWHQLQGHU7DQJ'\QDVWLHGDV.UDIWXQG +DUPRQLHGHV8QLYHUVXPVV\PEROLVLHUWDXIGHP6SLHJHODEHU]XPOXVWLJHQ XQGIU¤KOLFKHQ:HVHQXPJHGHXWHWZLUG'LH'DUVWHOOXQJGHV'UDFKHQVDOV ZLFKWLJVWHV:HVHQGHUFKLQHVLVFKHQ.XOWXUXQGGHV3DQWKHRQVO”XIWDOVURWHU )DGHQGXUFKGLHJHVDPWHFKLQHVLVFKH.XQVW'DVEHVRQGHUH0RWLYLVWDEHU GHU3IDXHLQVHLWGHU=KRX'\QDVWLH FD-KY&KU LQ&KLQD EHNDQQWHV6\PEROGDVPLWGHPP\VWLVFKHQ9RJHO3KRHQL[YHUJOLFKHQZXUGH (UV\PEROLVLHUWH0DFKW1REOHVVHXQG6FK¤QKHLW(LQH/HJHQGHYHUELQGHW DXFKGLH7DQJ'\QDVWLHPLWGHP3IDX1RFKLQGHU=HLWGHU6XL+HUUVFKHU

610

610 %L6FKHLEH DXV -DGH &KLQD QHROLWKLVFK    -W Y &KU k FP + FP $XV EUDXQJU©QHU -DGH 5XQGH 6FKHLEH PLW ]HQWUDOHP/RFK,QWDNW u 3URYHQLHQ]([3ULYDWVDPPOXQJ'U(00©QFKHQLQGHQHU-DKUHQ LP.XQVWKDQGHOHUZRUEHQ %L6FKHLEHQVLQG-DGHVFKHLEHQPLWHLQHP/RFKLQGHU0LWWHGLH]HUHPRQLHOOHQ =ZHFNHQGLHQWHQ'LHJHQDXH%HGHXWXQJGHU%6FKHLEHQZDUYRQ'\QDVWLH ]X '\QDVWLH XQWHUVFKLHGOLFK ,Q DOWHQ FKLQHVLVFKHQ 7H[WHQ ZHUGHQ VLH DOV 5DQJDE]HLFKHQ EH]HLFKQHW XQG LQ GHU /LDQJ]KX.XOWXU u Y &KU  ZXUGHQ VLH DOV  ULWXHOOH 2EMHNWH YHUZHQGHW $P K”X}JVWHQKDW PDQ %L6FKHLEHQLQGHQ*U”EHUQKRFKUDQJLJHU9HUVWRUEHQHUJHIXQGHQ(VZLUG YHUPXWHWGDVVGLHVH2EMHNWHHLQ6\PEROI©UGHQ+LPPHOVLQG 'DUNEURZQLVKJUHHQMDGH%LGLVF1RUWKZHVW&KLQD1HROLWKLFSHULRGUG QGPLOOHQLXP%&,QWDFW

314

YHUDQVWDOWHWHHLQKRKHU%HDPWHUEHLGHU6XFKHQDFKHLQHP*DWWHQI©UVHLQH 7RFKWHUHLQHQ6FKLHgZHWWEHZHUEXQGPDOWHHLQHQ3IDXDXIHLQH7©U(LQHP -XQJHQJHODQJHVGHP3IDXJHQDX]ZLVFKHQVHLQH$XJHQ]XVFKLHgHQ6R ZXUGHHU]XP0DQQGHUVFK¤QHQ7RFKWHUXQGEDOG]XP*U©QGHUXQGHUVWHQ .DLVHUGHUQHXHQ7DQJ'\QDVWLH &KLQHVHEURQ]HPLUURUZLWKWKHEDFNFDVWHGLQKLJKUHOLHI,QWKHFHQWHUD IDEXORXVFUHDWXUHIRUPHGORRSVXUURXQGHGE\IRXUOLRQVWZRGUDJRQVDQGWZR SHDFRFNVOHDSLQJDQGWZLVWLQJDPRQJIUXLWLQJJUDSHYLQHVHQFLUFOHGE\DGRWWHG OLQH,QWKHRXWHU}HOGDJDLQDPRQJDJUDSHYLQHWZHOYHOLRQVDQGELUGVDUH IROORZLQJHDFKRWKHUIXUWKHUHQFLUFOHGE\DQRUQDPHQW&KLQD7DQJ'\QDVW\ FDWKWKFHQWXU\$'6LOYHUSDWLQDDQGPDODFKLWHHQFUXVWDWLRQLQWDFW

611

611 Sitzende Figur.'RQJ6RQFDY&KUQ&KU%URQ ]HJXVV+FP$XIHLQHPDXVJHVFKZXQJHQHQ%¤JHQJHIHU WLJWHP 6WXKO VLW]HQGH P”QQOLFKH *HVWDOW PLW HLQHP JHI”OWHOWHP %HLQNOHLG NXU]”UPHOLJHQ 2EHUJHZDQG XQG JURgHQ 2KUULQJHQ PLW*HJHQVW”QGHQLQGHQ+”QGHQ$XIGHU.DORWWHVH'XQ NHOJU©QH3DWLQDPLW$X~DJHQ u 3URYHQLHQ]([6.(UZRUEHQDXVGHP3DULVHU.XQVWKDQGHO'DYRU3ULYDW VDPPOXQJZRKOHU-DKUHRGHUIU©KHU %URQ]H}JXUHRIDVHDWHGPDQZLWKRUQDWHGYHVWXUHDQGODUJHHDUULQJVKROGLQJ LQVWUXPHQWV " LQKLVKDQGV'RQJ6RQDERXW%&$'*UHHQ SDWLQD5DUH


e Liegender Löwe. )HUQRVW/FP% FP + FP 0DVVLYHU %URQ]HYROO JXVVPLW.DOWDUEHLW$XIHLQHU~DFKHQ UHFKWHFNLJHQ 3ODWWH OLHJHQGHU /¤ZH PLW QDFK YRUQH DXVJHVWUHFNWHQ 9RU GHUO”XIHQ XQG ]XU 6HLWH JHULFKWHWHP .RSI 'HU 6FKZDQ] OLHJW DXI GHP .¤USHU 'LH 0”KQH LVW LQ .DOWDUEHLW DQJHJHEHQ 'XQNHOJU©QH 3DWLQD LQ WDNW u 3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ    ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK $XNWLRQ/RV %URQ]H FDVW }JXUH RI D FURXFKLQJ OLRQ )DU (DVW'DUNJUHHQSDWLQDLQWDFW 

 Tontopf mit Bemalung. &KLQD<DQJV KRD.XOWXU FD    Y &KU + FP k FP +HOOEUDXQHU 7RQ PLW URWHU XQG GXQNHOEUDXQHU %HPD OXQJ )ODFKH 6WDQG~”FKH LQ GHU XQ WHUHQ+”OIWHNRQLVFKHU&RUSXVGHULQ GHUREHUHQ+”OIWHNXJHOLJJHIRUPWLVW PLW NXU]HP +DOV XQG DXVNUDJHQGHU 0©QGXQJ ,Q GHU 0LWWH GHV &RUSXV ]ZHLVHLWOLFKHVHQKHQNHOVRZLH]ZHL 1RSSHQ DXI GHU /LSSH ,Q GHU REH UHQ +”OIWH 'HNRU LQ )RUP YRQ JUR gHQ $FKWHQw GHU +LQWHUJUXQG YRQ HLQHP :HOOHQPXVWHU EHGHFNW REHQ XQGXQWHQEHJUHQ]WYRQEUHLWHQ]7 JHZHOOWHQ /LQLHQ DXI GHP +DOV HLQ %ODWWPXVWHU LQ GHU 0©QGXQJ LQQHQ HLQ 6WULFKPXVWHU HLQH EUHLWH /LQLH VRZLHHLQH*LUODQGH'HU7RSIGLHQ WH DOV 9RUUDWVJHI”g RGHU 8UQH Mit 7/$QDO\VH YRP /DERU .RWDOOD XQG =HUWL}NDW YRQ /L /LQJ  &KLQHVLVFKH $QWLTXLW”WHQ)UDQNIXUWD0,QWDNW u 3URYHQLHQ]$XVGHU6DPPOXQJ3URI+( +HVVHQ HUZRUEHQ EHL /L /LQJ &KLQHVLVFKH $QWLTXLW”WHQ DXI GHU $QWLN XQG .XQVW :LHVEDGHQ 9HVVHO RI OLJKWEURZQ FOD\ ZLWK SDLQWLQJ LQ UHGDQGGDUNEURZQZLWKWZRH\HOHWKDQGOHV SUREDEO\DQXUQRUDVWRUDJHYHVVHO&KLQD <DQJVKRD &XOWXUH DERXW    %& ,QWDFW :LWK 7/DQDO\VLV IURP WKH ODERUDWRU\.RWDOODDQGFHUWL}FDWHIURP/L /LQJ&KLQHVLVFKH$QWLTXLW”WHQ)UDQNIXUW a. M.!



315


e Indisches Ritualgefäß. +FP%URQ ]HNDQQH PLW RYRLGHP &RUSXV NR QLVFKHP )Xg HQJHP +DOV XQG =XQJHQPXVWHU DXI GHU 6FKXOWHU 'HU *ULII LVW DQ GHU 6FKXOWHU DQJHQLHWHW XQG XPVFKOLHgW PLW HLQHU 0DQVFKHW WHGLH/LSSH'HQ$XVJXVVELOGHWGHU .RSI GHV 6WLHUHV 1DQGL DXI VI¤UPLJ JHVFKZXQJHQHP +DOV )ORUDOH 2UQD PHQWHDXIGHU8QWHUVHLWH*U©QH3D WLQD &RUSXV YHUEHXOW XQG PLW /RFK XQGDOWHU5HSDUDWXU u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ /RVH[6KORPR0RXVVDLHII &ROOHFWLRQ    ([SRUWLHUW PLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH ,P KLQGXLVWLVFKHQ .XOW ZLUG LP 5LWXDO GHV $EKLVKHND GDV /LQJDP GDV DQLNRQLVFKH RIW SKDOOLVFKH .XOWELOG GHV 6KLYD PLW 0LOFK RGHUDQGHUHQ)O©VVLJNHLWHQEHJRVVHQ'DEHL ZHUGHQ*HI”gHLQ)RUPRGHUPLW3URWRPHQ RGHU.¤SIHQGHV1DQGLGHPKHLOLJHQ5HLWWLHU GHV6KLYDYHUZHQGHW8QVHU*HI”gVWHOOWQDFK 0DFKDUW XQG (UKDOWXQJ ]X VFKOLHgHQ ZRKO HLQEHVRQGHUVIU©KHV%HOHJH[HPSODUI©UGLHVH 3UD[LVGDUGLHQRFKKHXWHDXVJH©EWZLUG ,QGLDQEURQ]HULWXDOYHVVHOZLWKOR]HQJHVDWWKH VKRXOGHUDQGVSRXWLQWKHIRUPRIKHDGDQG QHFNRI1DQGLWKHKRO\EXOOVHUYLQJDVPRXQW RI6KLYD,QWKHULWXDORI$EKLVKHNDWKH/LQ JDPWKHDQLFRQLFRIWHQSKDOOLFLGRORI6KLYDLV VSULQNOHGZLWKOLTXLGVIURPDYHVVHOLQWKHIRUP RUZLWKSDUWVRIQDQGL7KHREMHFWVHHPVWREH DQ HDUO\ H[DPSOH IRU WKHVH NLQGV RI YHVVHOV ZKLFKDUHVWLOOLQXVHQRZDGD\V

614

615 %URQ]HNHOOHPLW}J©UOLFKHP*ULII6©G RVWDVLHQ'RQJ6RQ"-WY$QIDQJ -WQ&KU/FPk.HOOHFP /DQJHU VHJPHQWLHUWHU UXQGHU *ULII PLW %”QGHUQ YRQ JHULW]WHP 5DXWHQ PXVWHU DQ GHVVHQ (QGH HLQ QDFNWHU 0DQQKRFNWGHUVHLQHYHUVFKU”QNWHQ $UPHDXIGLH.QLHJHOHJWKDW$QVHL QHU 5©FNVHLWH LVW HLQH WUDSH]I¤PLJH 3ODWWHDQJHEUDFKWGLHREHQHLQHVH PLW HLQHP 5LQJ DXIZHLVW $P DQGH UHQ (QGH HLQ UXQGHV EDXFKLJHV *H I”gPLW$XVJXVVGDVDPREHUHQ5DQG PLW HLQHP JHULW]WHQ 0XVWHU YRQ DQ HLQDQGHU JHI©JWHQ +DNHQ GHNRULHUW LVW *U©QH 3DWLQD 5HVWH YRQ 6LQWHU LQWDNW u Provenienz: Ex Süddeutsche Privatsammlung 06VHLWHU-DKUHQ

615

316

%URQ]HODGOHFRPSULVLQJDVHJPHQWHGURXQG section handle, bowl with pouring lip and EDQGRIVFUROOSDWWHUQVWRWKHULPWRWKHXSSHU HQGDQXGHPDOH}JXUHFURXFKLQJZLWKDUPV IROGHGUHVWLQJRQWKHNQHHVWUDSH]RLGDOSODTXH to the rear pierced to accept a suspension ULQJ 6RXWKHDVW $VLD VW PLOOHQLXP %&  %HJLQQLQJ RI VW PLOOHQLXP $' *UHHQ SDWLQDWUDFHVRIVLQWHULQWDFW


616 Schöpfkelle. %DQ&KLDQJXPY&KU Q&KU/FDFP%URQ]HQHPLW WHOWLHIH .HOOH /DQJHU VFKOLFKWHU *ULII PLW KHU]I¤UPLJHU (QGXQJ GDYRU PLW HL QHP YRQ REHQ DQJHVHW]WHQ NOHLQHQ 6WLHU XQG DXI EHLGHQ 6HLWHQ MHZHLOV ]ZHL PX VFKHODUWLJHQ$XIVÂ&#x201D;W]HQMit Quittung des deutschen Zolls (Kopie)!*U©QH0DODFKLW SDWLQD SDUWLHOO %U©FKH 6LQWHUUHVWH DP *ULIINOHLQHEURQ]HQH8PZLQGXQJ u

616

3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ DXVGHP1DFKODVVHLQHU3ULYDWVDPPOXQJ,QGLDQD 86$ Bronze ladle with handle, decorated with a small EXOODQGIRXUVKHOOIRUPHGHOHPHQWV%DQ&KLDQJ DERXW%&$'*UHHQSDWLQDSDUWLDOO\ ULP PLVVLQJ UHVWV RI VLQWHU VPDOO EURQ]H VSLUDO RQKDQGOHWith receipt of the German customs service (copy)!

617 Chinesisches Kurzschwert, sog. Jià n. =HLW GHUVWUHLWHQGHQ5HLFKHY&KU /FP%URQ]HPLWKRKHP=LQQDQWHLO /DQ]HWWI¤UPLJH]ZHLVFKQHLGLJH.OLQJHPLW OHLFKW HUKDEHQHP 0LWWHOJUDW IDVW JHUDGHU 3DULHUVWDQJH UXQGH *ULIIVWDQJH PLW ]ZHL 5LQJHQVRZLHHLQHPWHOOHUI¤UPLJHQ.QDXI Mit Bestimmungszettel des Sammlers! *U©QVSDQDX~DJHQLQWDNW u

617

3URYHQLHQ]([6DPPOXQJ96%HUOLQHU -DKUHELV V5&LDUOD +UVJ .ULHJHUI©UGLH(ZLJNHLW'LH 7HUUDNRWWD$UPHHGHVHUVWHQ.DLVHUVYRQ&KLQD  6PLW$EE 'LHVHV.XU]VFKZHUWPLW]ZHL5LQJHQDP*ULIILVW W\SLVFK I©U GLH =HLW GHU VWUHLWHQGHQ 5HLFKH )©U GLH +HUVWHOOXQJ GLHVHU :DIIH ZXUGH %URQ]H PLW HLQHPKRKHQ$QWHLOYRQ=LQQ  YHUZHQGHW ZDVGHU%URQ]HIDVWGLH.RQVLVWHQ]YRQJHKÂ&#x201D;UWHWHP 6WDKOYHUOHLKWXQG]XHLQHP6WDKOJODQ]I©KUWZLH HUEHLGHPYRUOLHJHQGHQ6W©FNDQGHU.OLQJHJXW ]XVHKHQLVW &KLQHVH VKRUW VZRUG VRFDOOHG -LÂ&#x2019;Q PDGH RI EURQ]HZLWKDKLJKFRQWHQWRIWLQ:DUULQJ6WDWHV SHULRG%&/D\HUVRIYHUGLJULVLQWDFW With collectorâ&#x20AC;&#x2DC;s note! 

 Kurzschwert mit Bronzegriff. 9LHWQDP &KDP  -K Q &KU / FP /DQ]HWW I¤UPLJH.OLQJHDXV(LVHQPLW0LWWHOJUDW %URQ]HJULII PLW IÂ&#x201D;FKHUDUWLJHP (QGH XQG :HOOHQGHNRU DP 6FKDIWHQGH *ULII PLW JU©QHU3DWLQDZLQ]LJH)UDJPHQWHGHU(L VHQNOLQJHIHKOHQ u 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ   /RV  H[ 6DPPOXQJ +1 )UDQNHQ VHLW 6KRUWVZRUGZLWKLURQEODGHDQGEURQ]HKDQGOH 9LHWQDP &KDP WK FHQWXU\ $' +DQGOH ZLWK JUHHQSDWLQDLURQEODGHZLWKWLQ\IUDJPHQWVPLV VLQJ

317


619

619 Bronzedolch. 9LHWQDP 'RQJ6RQ .XOWXU  Y &KU   Q &KU / FP .RQYH[ JHIRUPWHU *ULII PLW KRUL]RQWDOHU 5LSSH XQG 3DULHUVWDQJH DQ GHU GDV EUHLW JHVFKZXQJHQH %ODWW DQVHW]W 'DUDXI LP REHUHQ %HUHLFK EHLGVHLWLJ YLHU 'RSSHOYROXWHQ *U©QH 3DWLQD ZLQ]LJH )UDJPHQWH GHV %ODWWV IHKOHQ u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ /RVH[6DPPOXQJ+1)UDQNHQ VHLW 9JO 9DQ +RD 'RQJ 6RQ 2 9LHWQDP  7KH 'RQJ6RQ&XOWXUHLQ9LHWQDP  6 1U Bronze dagger with curved blade and graved GHFRUDWLRQ LQ IRUP RI GRXEOH YROXWHV RQ WKH ERWKVLGHVRIWKHEODGH9LHWQDP'RQJ6RQ &XOWXUH%&$'*UHHQSDWLQD WLQ\IUDJPHQWVRIWKHEODGHPLVVLQJ



 Bronzedolch. 9LHWQDP 'RQJ6RQ .XOWXU  Y &KU   Q &KU / FP =ZLHEHOI¤UPLJHVw KRKOHV *ULIIHQGH PLW ]ZHL 5HLKHQ XPODX IHQGHU6FKOLW]¤IIQXQJHQGHU5HVWGHV *ULIIV NRQYH[ JHIRUPW 3DULHUVWDQJH PLWMHZHLOVHLQHU9ROXWHDP(QGHXQG ODQ]HWWI¤UPLJHV %ODWW *U©QH 3DWLQD ZLQ]LJH)UDJPHQWHGHV*ULIIVIHKOHQ u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ /RVH[6DPPOXQJ+1)UDQNHQ VHLW 9JO 9DQ +RD 'RQJ 6RQ 2 9LHWQDP  7KH 'RQJ6RQ&XOWXUHLQ9LHWQDP  6 1U %URQ]HGDJJHUZLWKODQFHORWHEODGHDQGRQLRQ shaped, hollow handle ending with two rows RIVOLWRSHQLQJV9LHWQDP'RQJ6RQ&XOWXUH  %&   $' *UHHQ SDWLQD WLQ\ IUDJPHQWVRIWKHKDQGOHPLVVLQJ

 Bronzedolch. 9LHWQDP 'RQJ6RQ .XOWXU  Y &KU   Q &KU / FP .RQYH[ JHIRUPWHU *ULII PLW VSLUDOI¤UPLJHP XQG JHRPHWULVFKHP 'HNRU XQG 3DULHUVWDQJH DQ GHU GDV ODQ]HWWI¤UPLJH %ODWW PLW JUDYLHUWHU 0LWWHOULSSHDQVHW]W7HLOVJU©QH3DWLQD ZLQ]LJH)UDJPHQWHDP*ULIIIHKOHQ u 

3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ /RVH[6DPPOXQJ+1)UDQNHQ VHLW 9JO 9DQ +RD 'RQJ 6RQ 2 9LHWQDP  7KH 'RQJ6RQ&XOWXUHLQ9LHWQDP  6 1U Bronze dagger with lanceolate blade and JUDYHG GHFRUDWLRQ RQ WKH KDQGOH 9LHWQDP 'RQJ6RQ&XOWXUH  %&   $' 3DUWLDOO\ JUHHQ SDWLQD WLQ\ IUDJPHQWV RI WKH KDQGOHPLVVLQJ

318


 .KPHU0HVVHU    -K Q &KU%URQ]HXQG(LVHQ/FP 'LH HLVHUQH .OLQJH PLW JHUDGHU 6FKQHLGH XQG JHERJHQHP 5©N NHQ'HU*ULIIDXV%URQ]HLQ*H VWDOWHLQHVNQLHQGHQ$IIHQGHUHLQ 7DEOHWWPLWDXIJHW©UPWHQ*HJHQ VWÂ&#x201D;QGHQDXIGHP.RSIKÂ&#x201D;OW6FK¤ QHJU©QH3DWLQD(LVHQEU©FKLJ u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ /RVXQG/RV H[6DPPOXQJ*05+/RQGRQVHLW 0LWWHGHUHU-DKUH(UZRUEHQDXIGHP ZHVWHXURSÂ&#x201D;LVFKHQ.XQVWPDUNW .KPHU NQLIH ZLWK LURQ EODGH 7KH EURQ]HKDQGOHLQIRUPRIDNQHHOLQJDSH EDODQFLQJ D WDEOHW RQ KLV KHDG WK  WK FHQWXU\ $' $WWUDFWLYH JUHHQ SDWLQDLURQIUDJLOH



 Chinesischer Schwertgriff. +DQ '\QDVWLH  Y   Q &KU / FP%URQ]H*ULIIGHUPLWHL QHP *LWWHUPXVWHU XQG 1RSSHQ GHNRULHUWLVWXQGLQHLQHPS\UDPL GHQI¤UPLJHQ.QDXIHQGHW'DUDQ HLQHKDOEPRQGI¤UPLJH3DULHUVWDQ JHGLHVLFK]XU.OLQJHKLQIÂ&#x201D;FKHU DUWLJ YHUOÂ&#x201D;QJHUW XQG PLW 'RUQHQ YHUVHKHQ LVW VRZLH XUVSU©QJ OLFK (LQODJHQ DXV YHUVFKLHGHQHQ 0DWHULDOLHQ HQWKLHOW 'DULQ GLH 5HVWHHLQHU(LVHQNOLQJHMit Echt KHLWV]HUWL}NDW YRQ 'U :ROIJDQJ Merkel, Frankenthal und Bestim mungszettel des Sammlers!*U©QH 3DWLQD 5HVWH YRQ 6LQWHU .OLQJH IHKOWJU¤gWHQWHLOV*ULIIHQGHHWZDV YHUERJHQ u 3URYHQLHQ]([6DPPOXQJ96%HUOLQ HU-DKUHELV



Chinese bronze sword handle with the UHPDLQVRIWKHLURQEODGH+DQ'\QDVW\ %&$'*UHHQSDWLQDWUDFHV RI VLQWHU EODGH PRVWO\ PLVVLQJ KDQGOH DW RQH HQG EHQW :LWK FHUWL}FDWH RI DXWKHQWLFLW\ RI 'U :ROIJDQJ 0HUNHO and collectorâ&#x20AC;&#x2DC;s note!

319


 Bronzebeile und Gussform. 9LHWQDP 'RQJ 6RQ  Y &KU ELV  Q &KU =ZHL %URQ]HEHLOH /  XQG FPJU©QH3DWLQDLQWDNW PLWDXV VFKZLQJHQGHP %ODWW XQG DEJHUXQ GHWHU 6FKQHLGH VRZLH ELNRQLVFKHP 6FKDIW XQG HLQH IDVW UHFKWHFNLJH *XVVIRUP DXV 6WHLQ  [ FP LQWDNWPLWNOHLQHP5LVV 3 Stück! u



3URYHQLHQ] ([ 3ULYDWVDPPOXQJ +) 0©QFKHQ LQ GHQ HU -DKUHQ LP .XQVWKDQGHOHUZRUEHQ 7ZR EURQ]H D[HV DQG RQH PRXOG RI VWRQH 9LHWQDP'RQJ6RQ&XOWXUH%& $'0RXOGZLWKWLQ\}VVXUHRWKHUZLVHLQWDFW 3 pieces!

 Paar â&#x20AC;&#x17E;Halterâ&#x20AC;&#x153; mit Dekor. :RKO'RQJ 6RQ.XOWXUXPY&KU/ FP /DQJHU NRQLVFKHU .¤U SHUXQWHQXQGREHQJH¤IIQHWLPREH UHQ7HLODQGHU5©FNVHLWH]ZHLVFKUÂ&#x201D;J DQJHVHW]WH +HQNHO XQG YRQ EHLGHQ 6HLWHQ ]ZHL U¤KUHQDUWLJH (OHPHQWH 9RUGHUWHLOGHV.¤USHUVXQG6HLWHQDQ VÂ&#x201D;W]HUHLFKPLWJUDYLHUWHQXQGGXUFK EURFKHQHQ 5RPEHQ =RSI XQG :HOOHQPRWLYHQGHNRULHUWVRZLHPLWMH I©QI ODXIHQGHQ 5HKHQ DQ GHQ 6HLWHQ $Q GHU 5©FNVHLWH GUHL JURgH GXUFK EURFKHQH 5RPEHQ 2 Stück! *U©QH 3DWLQDLQWDNW u



3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ H[ 6DPPOXQJ 'U ,VWYÂ&#x2018;Q =HOQLN %XGDSHVW Two bronze â&#x20AC;&#x17E;holdersâ&#x20AC;&#x153; with rich geometric RUQDPHQWV 'RQJ 6RQ &XOWXUH 1RUWKHUQ 9LHWQDPDERXW%&*UHHQSDWLQD LQWDFW2 pieces!

 $UPUHLI%DQ&KLDQJXPY&KU + FP k FP 0DVVLYHU NRQLVFKHU~DFKHUXQGRIIHQHU5HLIPLW JHUDGHDEVFKOLHgHQGHQ(QGHQ$XgHQ XPODXIHQ DEZHFKVHOQG DFKW %Â&#x201D;QGHU PLW=RSIPXVWHUXQGVLHEHQPLWNRQ ]HQWULVFKHQ .UHLVHQ *U©QH 0DOD FKLWSDWLQD6LQWHUUHVWHLQWDNW u 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQH[&KULVWLHhV$PVWHUGDP6DOH H[/RV



320

Big bronze open bracelet with braids and FRQFHQWULF FLUFOHV %DQ &KLDQJ DERXW  %&*UHHQSDWLQDUHVWRIVLQWHULQWDFW


627 .URNRGLONRSI$UPUHLI7KDLODQG%DQ&KLDQJXPYQ Chr. Ă&#x2DC; 8cm. Dicker hohler offener Reif in Form eines Kroko dilkopfs. An den Enden zwei auf konzentrischen Kreisen auf gesetzte Augen. In der oberen Hälfte des Reifes ein schmales Band mit Punkten und ein breites Band mit Dreieckmuster oder â&#x20AC;&#x17E;Zähnenâ&#x20AC;&#x153;. GrĂźne Malachitpatina, Sinterreste, kleine Fehlstellen, sonst intakt. 250,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung H.W., Bayern; aus dem Nachlass einer Privatsammlung, Indiana, USA.

627

Thick bronze hollow open bracelet in shape of a crocodile head. Thailand, %DQ&KLDQJDERXW%&$'*UHHQSDWLQDUHVWVRIVLQWHUVPDOO parts missing, otherwise intact.

628

628 *URgH6FKDOHPLW9RJHODXVGHP+RL$Q+RDUG9LHWQDP -KkFP+FP6WHLQ]HXJZHLgHU7RQPLWEODXHU Unterglasurfarbe, Unterseite mit braunem Ă&#x153;berzug. Auf dem Boden der Innenseite, auf einem BlĂźtenzweig sitzt mit geĂśffne ten FlĂźgeln ein Vogel. Mit einem Band von BlĂźtenblätterorna PHQWHQ XQG HLQHP )ULHV YRQ JURgHQ /RWXVEOŠWHQEOÂ&#x201D;WWHUQ DXI dem Rand dekoriert, innen mit BlĂźten und Wolken. Am Rand HLQ%DQGPLWUX\L0XVWHU$XIGHU$XgHQZDQG/RWXVEOŠWHQEOÂ&#x201D;W WHUZLHGHUPLWUX\L)RUPHQ5DQGGHU6FKDOHQDFKGHQ.RQWX UHQGHU/RWXVEOŠWWHQEOÂ&#x201D;WWHUVWDFKHOLJJHIRUPW0LW(WLNHWW 6DJD +RL$Q+RDUG9LVDOwXQG,QYHQWDUQXPPHUDXIGHU8QWHUVHLWH ,QGUHLJURgH7HLOHJHEURFKHQXQGZLHGHUJHNOHEWHLQ6SUXQJ im Rand. 1.400,â&#x20AC;&#x201C;

3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0Â&#x201D;U]  DXV Privatsammlung C.B. Big dish with a bird from the Hoi An Hoard. Stoneware, white clay with blue underglaze paint, base painted brown. In the center a bird with opened wings, sitting on a blooming tree branch. Around a band of petal pattern and a band with big lotus petals, with blossoms and clouds. The outer band with ruyi ornament. On the outer side walls big lotus petals, again decorated with ruyi and clouds within. Rim of the bowl is barbed, as slightly formed like SHWDOV9LHWQDPWKWKFHQWXU\$'5HDVVHPEOHGIURPWKUHHIUDJPHQWV D}VVXUHLQWKHZDOO:LWKDVWLFNHUÂ 6DJD+RL$Q+RDUG9LVDOwDQGWKH LQYHQWRU\QXPEHURQWKHERWWRP

321


629 *URgH6FKDOHPLW'UDFKHDXVGHP+RL$Q +RDUG9LHWQDP-KkFP+ FP 6WHLQ]HXJ ZHLgHU 7RQ PLW URWHU grĂźner und blauer Bemalung, Untersei te mit braunem Ă&#x153;berzug. Auf dem Bo den der Innenseite schwebt zwischen den Wolken ein Drache â&#x20AC;&#x201C; vermutlich, Wetter und Windgottheit Zhulong oder Shen long, der mit Kreisen und einem BlĂźten blätterring gerahmt ist. Auf dem Rand ZHLWHUHEXQWHJHRPHWULVFKHXQGS~DQ]OL FKH2UQDPHQWH$XIGHU$XgHQZDQG/R tusblĂźtenblätter. 0LW (WLNHWW  6DJD u +RL $Q +RDUG u 9LVDOw XQG ,QYHQWDUQXPPHU DXIGHU8QWHUVHLWH0HHUHV,QNUXVWDWLRQHQ auf der Unterseite, teilweise rote Farbe aufgefrischt, sonst intakt. 1.400,â&#x20AC;&#x201C; 3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ0Â&#x201D;U]DXV3ULYDWVDPPOXQJ&%

629

Big dish with a dragon from the Hoi An Hoard. Stoneware, with red, green and blue colored decoration, base painted brown. In the center a GUDJRQ~\LQJDPRQJFORXGVSUREDEO\ZHDWKHUDQG wind deity Zhulong or Shenlong. Around and on WKHZDOOJHRPHWULFDODQG~RUDORUQDPHQWV2QWKH outer side walls decorated lotus petals. Vietnam, WKWKFHQWXU\$'6HDLQFUXVWDWLRQVRQWKH bottom, red partially repainted, otherwise intact. :LWKDVWLFNHUÂ 6DJD+RL$Q+RDUG9LVDOw DQGWKHLQYHQWRU\QXPEHURQWKHERWWRP

 *URgH6FKDOHPLW%ŠIIHO'UDFKHDXVGHP +RL $Q +RDUG 9LHWQDP    -K k FP + FP 6WHLQ]HXJ ZHLgHU 7RQ mit grĂźner und blauer Bemalung, Unter seite mit braunem Ă&#x153;berzug. Auf dem Bo den der Innenseite schwebt zwischen den Wolken ein Drache mit dem KĂśrper ei QHV%ŠIIHOVGHUPLW.UHLVHQXQGJURgHQ schlichten geometrischen Ornament auf dem Cavetto gerahmt ist. Auf der Au gHQZDQG /RWXVEOŠWHQEOÂ&#x201D;WWHU 0LW (WLNHWW  6DJDu+RL$Q+RDUGu9LVDOwXQG,QYHQ WDUQXPPHU DXI GHU 8QWHUVHLWH Teilweise grĂźne Farbe aufgefrischt, sonst etwa ver schwommen und oxidiert, zwei kleine re staurierte SprĂźnge am Rand. 1.400,â&#x20AC;&#x201C; 3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ0Â&#x201D;U]DXV3ULYDWVDPPOXQJ&%



322

%LJGLVKZLWKDEXIIDORGUDJRQIURPWKH+RL$Q Hoard. Stoneware, white clay with green and blue colored decoration, base painted brown. In WKH FHQWHU GUDJRQ ~\LQJ DPRQJ FORXGV ZLWK WKH body of a buffalo. Around and on cavetto simple geometrical ornaments. On the outer side walls ORWXV SHWDOV 9LHWQDP WK  WK FHQWXU\ $' *UHHQ SDUWLDOO\ UHSDLQWHG EHVLGHV EOXUUHG DQG R[LGDWHGRQWKHULPWZRUHSDLUHG}VVXUHVWith a VWLFNHUÂ 6DJD+RL$Q+RDUG9LVDOwDQGWKH LQYHQWRU\QXPEHURQWKHERWWRP


0,77(/$/7(5



 +DQVD6FKDOHDeutschland (Sachsen?) 12. Jh. n. Chr. Kupfer VFKDOHPLWGXQNHOXQGKHOOJU©QHU3DWLQDkFP+FP ,QQHQ NRPSOHWW PLW }J©UOLFKHQ *UDYXUHQ ,P 0LWWHOPHGDLOORQ eine bekleidete männlichen Büste. Darumherum radial angeord

QHW GUHL Â&#x201D;KQOLFKH %©VWHQ PLW GHQ %HLVFKULIWHQ ,'2/ $ 75,$ (Götzendienst), INVIDIA (Neid) und IRA (Zorn). An der Wan dung weitere Verzierungen und Flechtband. 0LW 0HWDOODQDO\ VHYRQ%ULDQ*LOPRXU2[IRUGXQG/HPSHUW].DWDORJ Minimale Durchbrüche. 50.000,â&#x20AC;&#x201C;

323


3URYHQLHQ]1LHGHUOÂ&#x201D;QGLVFKHU3ULYDWEHVLW]7-'DYRU)DPLOLHQEHVLW]HUZRUEHQ YRQHLQHP/RQGRQHU6DPPOHULQGHQHUHU-DKUHQ%HL/HPSHUW] $XNWLRQ 'HU7\SXVZXUGHDOV+DQVD6FKDOHQRGHU+DQVD6FK©VVHOQEH]HLFKQHWGD HUYRUQHKPOLFKLP%HUHLFKGHUIU©KHUHQ+DQVHVWÂ&#x201D;GWHLQ1RUGGHXWVFKODQGXQG im Ostseeraum auftritt. Allerdings scheint es keine unmittelbare Verbindung ]XP +DQGHOVEXQG GHU +DQVH ]X JHEHQ 'LH *UDYXUHQ EHVFKÂ&#x201D;IWLJHQ VLFK PLWPHQVFKOLFKHP)HKOXQG:RKOYHUKDOWHQXQGVRWHLOHQVLFKGLH*HIÂ&#x201D;gH LQ 7XJHQG XQG /DVWHUVFKDOHQ 'LH VSH]LHOOH %HGHXWXQJ GLHVHU ZRKO I©U





324

+DQGZDVFKXQJEHQXW]HQ*HUÂ&#x201D;WHLVWDEHUQRFKQLFKWJHNOÂ&#x201D;UW /LW -:HLW]PDQQ)LHGOHU *UDYLHUWH 5RPDQLVFKH %URQ]HVFKDOHQ   80©OOHU =ZLVFKHQ *HEUDXFK XQG %HGHXWXQJ 6WXGLHQ ]XU )XQNWLRQ YRQ 6DFKNXOWXUDP%HLVSLHOPLWWHODOWHUOLFKHQ+DQGZDVFKJHVFKLUUV   A german romanesque engraved copper bowl depicting the vices, three of WKHP ,GRODWULD,QYLGDDQG,UD QDPHGKHUH7KHVHYHVVHOKDYHEHHQFDOOHG +DQVDERZOVEHFDXVHWKH\DSSHDULQWKHUHJLRQRIWKH+DQVHDWLF/HDJXH:LWK PHWDODQDO\VLVDQGFDWDORJXHRI/HPSHUW]


 5RPDQLVFKHU%URQ]HO¤ZH6©GHXURSD -KQ&KU+FP/FP%URQ ]HYROOJXVV,QGHU0LWWHEH}QGHWVLFKHLQH an drei Seiten umlaufende Aussparung, ZDVGDI©UVSULFKWGDVVGHU/¤ZHDOV)Xg I©U HLQHQ JU¤gHUHQ *HJHQVWDQG IXQJLHUWH 'XQNHOJU©QH3DWLQDLQWDNW u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ06 HU-DKUH %URQ]HOLRQ6RXWKHUQ(XURSHWKWKFHQWXU\ $' $ QRWFK DW WKUHH VLGHV LQ WKH PLGGOH RI WKH corpus indicates that the lion served as foot for a ODUJHUREMHFW*UHHQSDWLQDLQWDFW

 5RPDQLVFKHU %URQ]HO¤ZH Südeuropa, 11.   -K Q &KU + FP / FP %URQ]HYROOJXVV,QGHU0LWWHEH}QGHWVLFK eine an drei Seiten umlaufende Aussparung, ZDVGDI©UVSULFKWGDVVGHU/¤ZHDOV)Xg I©U HLQHQ JU¤gHUHQ *HJHQVWDQG IXQJLHUWH 'XQNHOJU©QH3DWLQDLQWDNW u 3URYHQLHQ]([V©GGHXWVFKH3ULYDWVDPPOXQJ06 HU-DKUH



%URQ]HOLRQ6RXWKHUQ(XURSHWKWKFHQWXU\ $'$QRWFKDWWKUHHVLGHVLQWKHPLGGOHRIWKHFRU pus indicates that the lion served as foot for a larger REMHFW*UHHQSDWLQDLQWDFW

 7DXIEHFNHQ XQG 6Â&#x201D;XOH 9RU5RPDQLVFK Karolingische Zeit, ca. 9. Jh. n. Chr. a) H FP k FP +HOOHU .DONVWHLQ 5XQGR YDOHV 7DXIEHFNHQ DQ GHU $XgHQVHLWH HLQ Relief mit acht Tierdarstellungen. Jedes der Tiere sitzt in einem Medaillon, das von einem Flechtband eingerahmt ist. Abgebil det sind: ein frontaler Adler; ein Bär, der ein Blatt frisst; eine Taube; ein Schwan, GHUVLFKGDV*H}HGHUSXW]WHLQPHQVFKHQ gesichtiges Fabelwesen; ein Adler, der ein 5HK VFKOÂ&#x201D;JW HLQ VWHKHQGHU /¤ZH XQG HLQ Bär, der sich an einem Baum aufgerichtet hat. In mehrere Teile zerbrochen und wie der zusammengesetzt; am Rand Reste von fünf Metallstiften, z.T. mit Blei vergossen, vermutlich zur Anbringung eines Deckels. b) H 66cm, Ã&#x2DC; 15,5cm. Heller Kalkstein. Kleine Säule, von zwei dreisträhnigen re OLH}HUWHQ%Â&#x201D;QGHUQVRXPZLFNHOWGDVVVSLW]H Rauten entstehen, in denen jeweils Blü ten, Vögel oder Fabelwesen sitzen. Oben =DS~RFKLQWDNW6W©FN 5.000,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 3ULYDWEHVLW] 7- HUZRUEHQ EHL *RUQ\ 0RVFK$XNWLRQ/RVH[ 6DPPOXQJ%5%D\HUQYRU 7ZR SUHURPDQLF OLPHVWRQH DUWLIDFWV WK FHQWXU\ $'D $VSKHULFDOIRQWHPEOLVKHGZLWKSODWHGSODQW medaillons and animals as bear, lion, eagle, swan DQGSLJHRQ5HVWRUHGIURPVHYHUDOSLHFHVE 6PDOO column with a relief structured ribbon ornament, in WKHWULDQJXODU}HOGVEORVVRPVDQLPDOVDQGELUGV Intact. SLHFHV

325


NEUZEIT



 )HUUDUHVHU.Â&#x201D;VWFKHQ,WDOLHQFD+¤O]HUQHVTXDGHUI¤UPL JHV .Â&#x201D;VWFKHQ + FP / FP % FP  PLW *KH]]R$X~D JHQ$QGHQ:DQGVHLWHQ}J©UOLFKH5HOLHIVPLWGHU'DUVWHOOXQJ die Apoll und Daphne, Artemis und Aktaion, die Entführung der Europa(?) und einen anderen Mythos zeigt. Der Deckel mit Groteskenköpfen und Harpyen. Drahtscharniere und originales 6FKORVVHUKDOWHQ,P5HOLHIHLQLJH)HKOVWHOOHQ u

326

3URYHQLHQ] ([ 6DPPOXQJ :% %DGHQ:©UWWHPEHUJ    %HL *RUQ\ 0RVFK/RV 9JO6RWKHE\hV/RQGRQ$XFWLRQRIWKRI-XO\/RW ,WDOLDQFDVNHWVKRZLQJP\WKRORJLFDOVWRULHVOLNH$SROORDQG'DSKQH'LDQD DQG$FWDHRQ(XURSDDQGRWKHU*LOWZRRGZLWKSDVWLJOLDUHOLHIRQJROGJURXQG 0DQ\ORVVHVDWWKHUHOLHI




 (LVHQVFKDWXOOH)UDQNUHLFKRGHU6SDQLHQ-K+¤O]HUQHVTXD GHUI¤UPLJHV.Â&#x201D;VWFKHQ +/FP%FP PLWOHLFKWJHZ¤OE WHP 'HFNHO LQQHQ WDSH]LHUW XQG DXgHQ PLW (LVHQ EHVFKODJHQ 'LH)HOGHUDXgHQVLQGDOVJHRPHWULVFKH'XUFKEUXFKVDUEHLWDXV gegeneinander versetzten und ineinanderlaufenden Blattmotiven gestaltet. An einer Seite kleine Fehlstellen. 2.500,â&#x20AC;&#x201C;

3URYHQLHQ]([6DPPOXQJ:%%DGHQ:©UWWHPEHUJ 9JO 6RWKHE\hV /RQGRQ $XFWLRQ RI QG RI 0D\  /RW  ( %HUJHU 3UXQNNDVVHWWHQ0HLVWHUZHUNHDXVGHU+DQQV6FKHOO&ROOHFWLRQ  6 $EEXQGD 0LVVDOER[)UHQFKRU6SDQLVK(DUO\WKFHQWXU\$'ZLWKHODERUDWHLURQ openwork decoration. Little damage a the side.

327


$17,.,6,(5(1'(63$67,&&,



 %©VWHGHV$SROORYRP%HOYHGHUH+Â&#x201D;OIWH-KQ&KU:HLgHU IHLQNULVWDOOLQHU 0DUPRU + FP %UXVWELOG GHV EHU©KPWHQ $SROOR LQ HLQHU YHUNOHLQHUWHQ 9HUVLRQ DXI SUR}OLHUHU VHSDUDW gefertigter Basis. Das Haar in typischer Manier des 19. Jhs. Min. %HVWRgXQJDP1DVHQ~©JHOVRQVWLQWDNW u 328

3URYHQLHQ]$XVV©GGHXWVFKHP$GHOVEHVLW]VHLW 8QGHUOLIHVL]HPDUEOHEXVWDIWHUWKH%HOYHGHUH$SROORQGKDOIWKFHQWXU\ $'7LQ\GHQWDWWKHQRVH


 9LFWRULDâ&#x20AC;&#x17E;Grand Tourâ&#x20AC;&#x153; Wohl Italien, 19. Jh. Bronzevollguss. H FP PLW6RFNHO %URQ]H}JXUGHU~LHJHQGHQ6LHJHVJ¤WWLQPLW weit aufgespannten Flügeln auf einer aus einer Kugel und einer Säule zusammengesetzten Basis. Der rechte Arme ist nicht aus geführt. 500,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ++':HVWIDOHQH[6DPPOXQJ9DKOGLHN([ -HVFKFNH*UHYH +DXI%HUOLQ$XNWLRQ1RYHUPEHU/RV 'HUDUWLJH )LJXUHQ ZXUGHQ XQWHU DQGHUHP  YRQ GHU QHDSROLWDQLVFKHQ %URQ]HJLHgHUHL&KLXUD]]LJHIHUWLJWXQGDQGHQEHVVHUJHVWHOOWHQ%LOGXQJVUHLVHQGHQ YHUNDXIW'DVDQWLNH2ULJLQDOEH}QGHWVLFKLP1DWLRQDOPXVHXPYRQ1HDSHO ,QYV$UDFKQH  *UDQG7RXUEURQ]H}JXULQHGHSLFWLQJ~\LQJ9LNWRU\RQFRORUHGPDUEOHEDVH/DWH WKFHQWXU\SRVVLEO\E\WKH1HDSROLWDQ0DQXIDFWXUHU&KLXUD]]L

 =ZHL%LOGQLVVHLP5HOLHID +FDFP RKQH5DKPHQ 5DK men 20x5,5cm. Hellrosa Marmor. Relief eines männlichen Portraitkopfes nach rechts in der Mode der Mitte des 18. Jahr hunderts, das lange Haar in strähnigen Wellen verlaufend und am Hinterkopf zu einem kleinen Knoten zusammengefasst, von GHPDXVHLQ%DQGLQGHQ1DFNHQIÂ&#x201D;OOW2EHU~Â&#x201D;FKHHWZDVDEJH schabt; auf hellbraunen Samt gelegt und im Goldrahmen. Im Stil GHV-KVE +FDFP3ODWWH[FP*UDXHU0DUPRU 5HOLHIELOGQLV GHV 'LNWDWRUV &DHVDU DOV %©VWH PLW /RUEHHUNUDQ] und angedeutetem Panzer. Vorderer Teil der Büste gebrochen und wieder geklebt. Sonst intakt. Im Stil der Renaissance, ver mutlich 19. Jh. In eine Eichenplatte eingelassen. 6W©FN 500,â&#x20AC;&#x201C; 7ZR IUDPHG UHOLHIV GHSLFWLQJ D  $ SRUWUDLW RI DQ WK FHQWXU\ JHQWOHPDQ made from light orange marble; surface something weathered, otherwise LQWDFWRQYHOYHWXQGHUOD\E $SRUWUDLWRIWKH5RPDQGLFWDWRU&DHVDUZHDULQJ ODXUHOZUHDWKLQWKHVW\OHRIDUHQDLVVDQFHSRUWUDLW*UH\PDUEOHIURQWSDUWRI the bust broken and restored, otherwise intact. Embedded in a massive oak ~RRUERDUG6W©FN







329


640

640 0RGHUQHV*ROGPHGDLOORQPLW$UWHPLV%©VWH-KJk 9,5cm, H 4,5cm. Goldblech getrieben und geprägt sowie Ru ELQ(LQODJHQ7RQGRPLW%©VWHGHU$UWHPLVPLW*HZDQG%LQGH Bogen und Köcher mit Pfeilen auf einem gestichelten Hinter JUXQG 'DUXP YRQ LQQHQ QDFK DXgHQ HLQ %DQG PLW HLQHP (L erstab mit Granulat, ein Band mit Blüten und Blättern sowie QHXQ OÂ&#x201D;QJOLFKHQ 5XELQ(LQODJHQ XQG HLQ %ODWWNUDQ] PLW YLHU runden Rubineinlagen. Am Rand setzt ein Netz aus Ketten an, die mittels kleiner Rosetten miteinander verbunden sind. Die Rückseite des Medaillons besteht aus glattem, nach innen ge wölbtem Goldblech. *ROG Kette an vier Stellen losgelöst, eine Rubineinlage gebrochen, Rückseite kreuzweise eingeschnitten. 8.000,â&#x20AC;&#x201C; 3URYHQLHQ]([3ULYDWEHVLW]0.70©QFKHQFDHU-DKUH 9JOGDV*ROGPHGDLOORQPLW$UWHPLVE©VWHLP1DWLRQDOPXVHXP$WKHQ+HOHQ

330

6WDWKDWRV &ROOHFWLRQ /LWHUDWXU & $GDP +UVJ  *UHHN -HZHOOHU\ IURP WKH%HQDNL0XVHXP&ROOHFWLRQV  6I$EE3$PDQGU\ &ROOHFWLRQ+Â&#x2DC;OÂ&#x2122;QH6WDWKDWRV/HVELMRX[DQWLTXHV  6II$EE 9LHUÂ&#x201D;KQOLFKH*ROGPHGDLOORQVYRQGHQHQEHULFKWHWZLUGGDVVVLHLQ 7KHVVDOLHQJHIXQGHQZXUGHQ]HLJHQGLH%©VWHQGHUJULHFKLVFKHQ*¤WWLQQHQ $WKHQD$SKURGLWHXQG$UWHPLV'LH6W©FNHZHUGHQDOVKHOOHQLVWLVFK-KY &KUGDWLHUW=XU9HUZHQGXQJGHU0HGDLOORQVJLEWHV]ZHL7KHRULHQ1DFKGHU HLQHQGLHQWHQVLHDOV'HFNHOI©U]\OLQGULVFKH%HKÂ&#x201D;OWHU'D]XJLEWHV3DUDOOHOHQ LQGHU.HUDPLNGLHPHLVWDXV1RUGJULHFKHQODQGVWDPPHQ1DFKGHUDQGHUHQ 0HLQXQJZXUGHQGLHVH0HGDLOORQVDOV+DDUQHW]JHWUDJHQGLHLP+HOOHQLVPXV XQGGHUIU©KHQU¤PLVFKHQ.DLVHU]HLWKÂ&#x201D;X}JYHUZHQGHWZXUGHQ(LQÂ&#x201D;KQOLFKHV *ROGPHGDLOORQRKQH%©VWHLVWLQGHUSRPSHLDQLVFKHQ:DQGPDOHUHLEHOHJW 'LH]ZHLWH7KHVHLVWZRKOZDKUVFKHLQOLFKHU(VH[LVWLHUHQPHKUHUHQHX]HLWOLFKH 1DFKDKPXQJHQGLHVHUDQWLNHQ*ROGPHGDLOORQV 0RGHUQJROGPHGDLOORQZLWKEXVWRI$UWHPLVVXUURXQGHGE\DQHWRIOLQNHG FKDLQVDQGUXE\LQOD\VWKFHQWXU\DIWHUDQRULJLQDORIWKHQGFHQWXU\%& Chains came off at four spots, gold sheet at backside crosswise cut, one ruby inlay broken.


641 3KDOHUDPLW4XDGULJDItalien, Re QDLVVDQFH-KkFP Auf der Vorderseite vergoldete Bronze. Rückseite aus Eisen. Auf der Vorderseite auf einer gewölb ten Scheibe im Halbrelief eine 3IHUGHTXDGULJD GLH YRQ HLQHP 0DQQ PLW ~LHJHQGHP 0DQWHO und Schwert gelenkt wird und die über den gefallenen Gegner, der am Boden liegt, hinweg reitet. Als 8PUDKPXQJ HLQ /RUEHHUNUDQ] mit drei Kügelchen. Die Rücksei WH DXV HLQHU ~DFKHQ 6FKHLEH PLW Klemmbügel. Rückseite korro GLHUW u

641

3URYHQLHQ] ([ 6©GGHXWVFKH 3ULYDW VDPPOXQJ06VHLWHU-DKUHQ Phalera with horse quadriga guided by a man with sword and waving mantle ULGLQJ RYHU D IDOOHQ ZDUULRU )URQWVLGH gilded bronze relief, backside of iron with FODPS ,WDO\ 5HQDLVVDQFH WK  WK century. Backside corroded.

642 3DDU*ROGRKUULQJHOsteuropa, 19. -KJ/FP%©JHORKUULQ ge mit einer runden Scheibe mit zentraler Rosette und Granulat GHNRUDPXQWHUHQ5DQG}OLJUDQH Ranken mit Granulatdekor, die in kleinen Blüten enden. *ROG An einem Ohrring fehlen Blüten, ein winziges Fragment vom anderen Ohrring fehlt. 500,â&#x20AC;&#x201C;

642

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\  0RVFK $XNWLRQ   /RV Pair of gold earrings with a disc with central rosette and granules, at the lo wer edge stylized tendrils and blossoms. Eastern Europe, 19th century. Blossoms of one earring broken, at the other tiny fragment missing.

 3DDU *ROGRKUULQJH Osteuropa,  -K J / FP %©JH lohrringe mit drei unterschiedlich JURgHQ DQHLQDQGHU JHKÂ&#x201D;QJWHQ Scheiben, die in Durchbruchs technik gestaltet sind. *ROG Intakt. 650,â&#x20AC;&#x201C; 3URYHQLHQ]([6KORPR0RXVVDLHII&ROO HFWLRQ/RQGRQ%HL*RUQ\ 0RVFK$XNWLRQ/RV 3DLU RI JROG HDUULQJV ZLWK WKUHH RSHQ worked discs in different sizes. Eastern Europe, 19th century. Intact.



331


644

645

646

644 *ROGULQJ PLW *HPPH DXV /DSVLOD]XOL  -K J 5LQJJU¤gH PP6FKPDOHQDFKREHQEUHLWHUZHUGHQGHQDFKDXgHQNRQ vexe Schiene, auf der Platte eingelassen eine längsovale Gemme DXVEODXHQ/DSLVOD]XOLDXIGHP,QWDJOLRGHUQDFNWH$SROOPLWJH bauschtem Mantel, zwei Pfeilen und Bogen, davor Stern. *ROG Intakt. 1.000,â&#x20AC;&#x201C;

646 0RGHUQH.DPHRPLW$MD[+FP/FP1HX]HLWOLFKHRYDOH Kameo mit Porträt von Ajax n.l. mit einem Phrygischer Helm. Kleine Absplitterung am Rand. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6.3DULVHUZRUEHQLP3DULVHU.XQVWKDQGHO 0RGHUQFDPHRZLWK$MD[6PDOOFKLSDWWKHULP

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV

647 .HWWHDXV$PHWK\VWXQG%HUJNULVWDOO-K/FP$XVXQWHU VFKLHGOLFKJURgHQ0HORQHQSHUOHQDXV$PHWK\VWXQG3HUOHQLQ Form von Blättern aus Bergkristall und Amethyst mit geritzten Blattadern. 7UDJEDUPLW9HUVFKOXVV Intakt. 800,â&#x20AC;&#x201C;

*ROG}QJHUULQJZLWKDJHPVWRPHPDGHRIODSLVOD]XOLGHSLFWLQJWKHQDNHG Apoll with mantle, two arrows and bow, above a star. 19th century. Intact.

645 *HPPHDXV$FKDWPLW1LNHXQG(URV-K+FP$XIGHP längsovalen Intaglio eine auf einem Globus sitzende Nike mit Kranz und FrĂźchtekorb, vor ihr ein Eros, dazwischen ein Baum. Intakt. 1.000,â&#x20AC;&#x201C;

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV Necklace composed of melon beads made of amethyst and beads in shape RIOHDYHVPDGHRIDPHWK\VWDQGURFNFU\VWDOWKFHQWXU\,QWDFW:HDUDEOH ZLWKFORVXUH

3URYHQLHQ] ([ 6KORPR 0RXVVDLHII &ROOHFWLRQ /RQGRQ    %HL *RUQ\ 0RVFK$XNWLRQ/RV

648 *URgH %URQ]HK\GULD LP HWUXVNLVFKHQ 6WLO  *UDQG 7RXUw   IUŠKHV-K+FP'UHLKHQNHOLJHV:DVVHUJHIÂ&#x201D;gPLWVWHLOHU Wandung, Zungenstab auf der Schulter und abgesetztem Hals.

*HPVWRQHPDGHRIDJDWHGHSLFWLQJ1LNHZLWKZUHDWKDQGIUXLWEDVNHWVLWWLQJRQ a globe, in front of her Eros, in between a tree. 19th century. Intact.

647

332


648

Der Vertikalgriff endet oben in einem /¤ZHQNRSI 'LH XQWHUH $WWDVFKH LVW mit einem Gorgoneion und Hippo kampen verziert. Auf den Querhen keln zwei nackte Knaben, die mit dem Kopf zueinander stehen.  u 3URYHQLHQ] ([ 6DPPOXQJ - .OHLQ    %HL *RUQ\  0RVFK $XNWLRQ   A large bronze hydria in Etruscan style,  *UDQG7RXUwWKHDUO\WKFHQWXU\$' The handles are decorated with male nudes, a gorgoneion, a lion´s head and hippocamps. *UHHQSDWLQDWLRQLQWDFW

648

649 %URQ]HJHIÂ&#x201D;gPLW]ZHL%ŠVWHQDWWDVFKHQ + FP % FP +RKHU SUR} OLHUWHU 6WDQGIXg GDUDXI HLQ RYDOHV steilwandiges Becken mit einem brei WHQ~DFKHQ5DQG 0RGHUQ $QGHQ Schmalseiten jeweils eine drapierte %ŠVWHHLQHVEÂ&#x201D;UWLJHQ6LOHQVPLW(IHX und Korymbenkranz (RĂśmische .DLVHU]HLW    -K Q&KU  ,Q GLH Attaschen ursprĂźnglich eingehängt je weils ein Ring. 6WDQGIXg XQG %HFNHQ PRGHUQ Aus mehreren Fragmenten ]XVDPPHQJHVHW]W X JURg~Â&#x201D;FKLJ UH touchiert, winzige Randfragmente fehlen, ein Ringhenkel fehlt. 2.000,â&#x20AC;&#x201C; 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ /RQGRQ%HL*RUQ\ 0RVFK $XNWLRQ/RV Bronze vessel with high foot and oval corpus ZLWKVWHHSZDOODQG~DWERWWRPDWHDFKVLGHWKH bearded, draped bust of Silenos with wreath of corymbes and ivy leaves, in the handle attach ment originally mounted two ring handles. Vessel modern, busts and handles from Ro PDQ,PSHULDO3HULRGUGWKFHQWXU\$' Reassembled of several fragments with huge retouched areas, tiny fragments of the bottom missing, one ring handle missing. )RRWDQG YHVVHOPRGHUQ

649

333


LOTS Die folgenden Lots sind nicht in unserem gedruckten Katalog abgebildet! Bitte besichtigen Sie VLHLQXQVHUHU*DOHULH$EELOGXQJHQ}QGHQ6LHDXIXQVHUHU+RPHSDJH$OOH/RWVZHUGHQYHUNDXIW ZLHEHVHKHQ.HLQH5ŠFNJDEH 7KHIROORZLQJORWVDUHQRWLOOXVWUDWHGLQRXUSULQWHGFDWDORJXH3OHDVHYLHZDWRXURI}FH<RXPD\ DOVR}QGLOOXVWUDWLRQVRQRXUKRPHSDJH$OOORWVDUHVROGDVYLHZHG1RUHWXUQV ,ORWWLVHJXHQWLQRQVRQRLOOXVWUDWLQHOQRVWURFDWDORJRPDSRVVRQRHVVHUHSUHVLLQYLVLRQHQHO QRVWURXI}FLR,PPDJLQLWURYLVXOQRVWURVLWRZHE,ORWWLYHQJRQRYHQGXWLFRPHSUHVLLQYLVLRQHH SLDFLXWL1RQÂ&#x2122;SRVVLEOHUHVWLWXLUOL /HVORWVVXLYDQWVQHVRQWSDVLOOXVWUÂ&#x2DC;VGDQVQRWUHFDWDORJXH,OHVWQÂ&#x2DC;DQPRLQVSRVVLEOHGHOHV DGPLUHUGDQVQRWUHJDOHULH9RXVWURXYHUH]OHXUVSKRWRJUDSKLHVVXUQRWUHVLWHLQWHUQHW /HVORWVVRQWYHQGXVWHOVTXHOV/HVUHWRXUVQHVHURQWSDVDFFHSWÂ&#x2DC;V 650 'RSSHONRKO~DVFKH PLW +HQNHO /HYDQWH    -K Q &KU + FP$XVKHOOEUDXQHP.ODUJODV8I¤UPLJHU.¤USHUDXV]ZHL langen RĂśhren von einem dĂźnnen Faden in sechs Windungen XP]RJHQPLWJHUXQGHWHQ/LSSHQ%RGHQDEJH~DFKW=XEHLGHQ Seiten Ăźber dem Spiralfaden von oben nach unten zwei dĂźnne Schlaufenfäden, die die Wandung jeweils dreimal berĂźhren. Ein gewĂślbter Korbhenkel auf den Schlaufen aufgesetzt. Ein Sprung, ZHLgHU%HODJLQWDNW u 3URYHQLHQ] ([ 6DPPOXQJ 96 %HUOLQ HU -DKUH ELV  ([ 'DQQHQEHUJ%HUOLQ -XQL /RV Levantine double kohl tube of light brown glass with wound trail around the ERG\WZRWUDLOVLQORRSVUXQDORQJDQGDEDVNHWKDQGOHWKWKFHQWXU\ $'$}VVXUHZKLWHFRYHULQJLQWDFW 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

651 )OÂ&#x201D;VFKFKHQ PLW )DGHQGHNRU Â?VWOLFKHU 0LWWHOPHHUUDXP    Jh. n. Chr. H 6cm. Aus farblosem Klarglas. Kugeliger KĂśrper PLW ODQJHP +DOV XQG 7ULFKWHUPŠQGXQJ (LQ GŠQQHU ZHLgHU Spiralfaden läuft um den KĂśrper vom Hals bis zum Boden. Feine Iris, intakt. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 9JO$YRQ6DOGHUQ*OÂ&#x201D;VHUGHU$QWLNHLQ6DPPOXQJ(UZLQ2SSHQOÂ&#x201D;QGHU  61U (DVWHUQ0HGLWHUUDQHDQJOREXODUERWWOHRIFRORUOHVVFOHDUJODVVZLWKORQJQHFN WXEXODUULPDQGZKLWHVSLUDOWUDLOGHFRUDWLRQVWQGFHQWXU\$')LQH iridescence, intact. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

652 6DPPOXQJ *OÂ&#x201D;VHU Â?VWOLFKHU 0LWWHOPHHUUDXP XP    -K Q&KU +FP*LHgHUFKHQLQ9RJHOIRUPDXVKHOOEODXHP Klarglas. Winzige SprĂźnge, feine Iris. 2) H 16,6cm, Flasche aus hellblauem Klarglas mit bauchigem KĂśrper und langem Hals. )HLQH ,ULV LQWDNW   + FP ]\OLQGULVFKHV .Â&#x201D;QQFKHQ DXV grĂźnem Klarglas mit KleeblattmĂźndung. Intakt. 4) H 7,8cm, zylindrischer Becher aus braunem Klarglas mit gestauchtem Kragen. Goldener Belag, intakt. 6WŠFN 800,â&#x20AC;&#x201C;

334

3URYHQLHQ] ([ $XNWLRQ 0DJQLQ :HGU\ 6HSWHPEHU   /RV  ([ 6DPPOXQJ6.3DULV Collection of roman and eastern glass: a birdshaped funnel, a candlestick bottle, a juglet and a cylindrical jar, light blue, green and brown clear glass. FDVWWKFHQWXU\$')LQHLULGHVFHQFHPRVWO\LQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 6DPPOXQJ*OÂ&#x201D;VHUÂ?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU a) H 10,6cm. Geripptes zylindrisches Kännchen aus grĂźnem Klarglas mit zylindrischem Hals, ausgezogener und gefalteter /LSSHXQGJHNQLFNWHP%DQGKHQNHOE +XFP=ZHL zylindrische Flaschen aus hellblauen Klarglas mit kurzem zy OLQGULVFKHP+DOVXQGZHLWDXVJH]RJHQHUXQGJHIDOWHWHU/LSSH 6WŠFN3DUWLHOOHU%HODJLQWDNW u Provenienz: Ex Sammlung H.H., Bayern, vor 1970. &ROOHFWLRQ RI (DVWHUQ 0HGLWHUUDQHDQ ULEEHG MXJOHW DQG VLPSOH ERWWOHV RI green and light blue clear glass, cylindrical body with cylindrical necks and IROGHGULPVWUGFHQWXU\$')LQHLULGHVFHQFHSDUWLDOO\FRYHULQJLQWDFW SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

654 =ZHL+HQNHONUŠJHÂ?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU 1) H 12,5cm. Aus hellgrĂźnem Klarglas. Rechteckige Flasche PLWJHZ¤OEWHU6FKXOWHU]\OLQGULVFKHP+DOVPLWJHIDOWHWHU/LSSH und einem Bandhenkel. 2) H 14,2cm. Aus hellblauem Klarglas. ApfelfĂśrmige Flasche mit zylindrischem Hals, gestauchter XQG JHIDOWHWHU /LSSH XQG HLQHP %DQGKHQNHO  6WŠFN /HLFKW versintert, intakt. 500,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV Collection of two jugs with handles, square and oval, of light green and light EOXHFOHDUJODVVVWQGFHQWXU\$')LQHVLQWHULQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851


655 .DQQH XQG 6SULQNOHU Ă&#x2013;stlicher Mittelmeerraum und Naher 2VWHQ    -K Q &KU   + FP %DXFKLJH .DQQH DXV hellblauem Klarglas mit zylindrischem Hals, KleeblattmĂźndung PLW HLQJHIDOWHWHU /LSSH XQG HLQHP +HQNHO $XI GHP .¤USHU Vertiefungen in Bienenwabenmuster. Feine Iris, intakt. 2) H 9cm. Kugeliger Sprinkler aus hellgrĂźnem Klarglas mit zylindrischem +DOVQDFKDXgHQJH]RJHQHP5DQGXQGJHUXQGHWHU/LSSH$XI dem KĂśrper ein dekoratives Muster mit konzentrischen Kreisen. Partiell Iris, intakt. 6WŠFN 650,â&#x20AC;&#x201C;

658 6DPPOXQJ*OÂ&#x201D;VHUÂ?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU +  ELV FP 'UHL EDXFKLJH )ODVFKHQ DXV KHOOEODXHP Klarglas mit Standring, zylindrischem, sich nach oben leicht erweiteterndem Hals und gerundetem oder abgeschliffenem Rand, ein StĂźck mit Fadenring am Hals. Dazu ein Armband, Ă&#x2DC; 8,2cm, aus blauen Klarglas. 6WŠFN SchĂśne Iris, Armband mit goldener Iris, ein Glas am Rand partiell abgebrochen. 900,â&#x20AC;&#x201C;

3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV1UH[*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ$/'HXWVFKODQGEHL *RUQ\ 0RVFKH[6DPPOXQJ+6'HXWVFKODQGHUZRUEHQ 

&ROOHFWLRQRI(DVWHUQ0HGLWHUUDQHDQERWWOHVRIOLJKWEOXHFOHDUJODVVJOREXODU or squat globular body with tubular necks and rounded or polished rim, plus DEUDFHOHWRIEOXHJODVVUGWKFHQWXU\$'%HDXWLIXOLULGHVFHQFHRQHJODVV with chipping on rim. SLHFHV

Collection of a juglet with trefoil mouth and a sprinkler of light blue and light JUHHQFOHDUJODVV%RWKZLWKGHFRUDWLYHSDWWHUQVRQERG\UGWKFHQWXU\ $')LQHLULGHVFHQFHLQWDFWSLHFHV

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

656 )ODVFKH PLW )DGHQGHNRU XQG *ORFNHQ~DVFKH Ă&#x2013;stlicher Mittel PHHUUDXP RGHU /HYDQWH XP    -K Q &KU   + FP Aus hellblauem Klarglas. BirnenfĂśrmiger KĂśrper mit Standring, langem zylindrischen Hals mit dĂźnner dreifacher Fadenspira OH XQG QDFK ,QQHQ JHIDOWHWHU /LSSH   + FP $XV IDUEOR sem Klarglas. GlockenfĂśrmiger KĂśrper mit gewĂślbten Boden, ODQJHP]\OLQGULVFKHQ+DOVXQGOHLFKWQDFKDXgHQDXVJH]RJHQHU XQGJHIDOWHWHU/LSSH6WŠFN SchĂśne Iris, intakt. 600,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV Collection of two bottles, piriform with long neck and trail decoration and EHOOVKDSHGZLWKGRPHGERWWRPDQGORQJQHFNRIOLJKWEOXHDQGFRORUOHVVFOHDU JODVVVWWKFHQWXU\$'%HDXWLIXOLULGHVFHQFHLQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

657 6DPPOXQJ *ODV~DVFKHQ Â?VWOLFKHU 0LWWHOPHHUUDXP    -K n. Chr. a) H 9,9cm. Bauchige Flasche aus hellblauem Klarglas mit Standring und sich nach oben leicht erweiterndem Hals; b) H 12,2cm. Kugelige Flasche aus farblosem Klarglas mit NXU]HP+DOVXQG7ULFKWHUPŠQGXQJPLWJHIDOWHWHU/LSSHF + 16,9cm. Breite tropfenfĂśrmige Flasche aus hellgrĂźnem Klarglas PLW 6WDQGULQJ ODQJHP +DOV XQG QDFK DXgHQ JH]RJHQHU XQG JHIDOWHWHU/LSSH6WŠFN Feine Iris und partieller Belag, intakt. 900,â&#x20AC;&#x201C; Provenienz: Ex Sammlung H.H., Bayern, vor 1970. &ROOHFWLRQRI(DVWHUQ0HGLWHUUDQHDQERWWOHVRIOLJKWFOHDUJODVVJOREXODURU VTXDW JOREXODU ERG\ ZLWK ORQJ QHFNV DQG WXEXODU RU IROGHG ULP QG  WK FHQWXU\$')LQHLULGHVFHQFHSDUWLDOO\FRYHULQJLQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

Provenienz: Ex Sammlung H.H., Bayern, vor 1970.

659 6DPPOXQJ *ODV~DVFKHQ Â?VWOLFKHU 0LWWHOPHHUUDXP    Jh. n. Chr. a) H 14,6cm. Bauchige Flasche aus hellgrĂźnem Klarglas mit Standring, zylindrischem Hals und ausgebogenem und umgeschlagenem Rand, am Hals ein Fadenring; b) H FP.XJHOLJHJHULSSWH)ODVFKHDXVKHOOEODXHP.ODUJODVPLW KRFKJHVWRFKHQHU6WDQG~Â&#x201D;FKHNXU]HP+DOVXQG7ULFKWHUPŠQGXQJ PLW JHIDOWHWHU /LSSH F  + FP $SIHOI¤UPLJH )ODVFKH DXV hellgrĂźnem Klarglas mit Standring, zylindrischem, sich nach XQWHQYHUMŠQJHQGHQ+DOVXQGJHUXQGHWHU/LSSH6WŠFN Feine Iris und partieller Belag, intakt. 700,â&#x20AC;&#x201C; Provenienz: Ex. Sammlung H.H., Bayern, vor 1970. &ROOHFWLRQRI(DVWHUQ0HGLWHUUDQHDQERWWOHVRIOLJKWEOXHDQGJUHHQFOHDUJODVV globular or squat globular body with cylindrical necks and tubular or folded ULPQGWKFHQWXU\$')LQHLULGHVFHQFHSDUWLDOO\FRYHULQJLQWDFW3 pie FHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

660 6DPPOXQJ*ODV~DVFKHQÂ?VWOLFKHU0LWWHOPHHUUDXP-KQ Chr. a) H 10,5cm. Kugelige Flasche aus gelbem und hellblau HP.ODUJODVPLWNOHLQHU6WDQG~Â&#x201D;FKHODQJHP]\OLQGULVFKHQ+DOV und kurzer TrichtermĂźndung; b) H 11,1cm. Bauchige Flasche aus hellblauem Klarglas mit Standring, zylindrischem, sich nach oben leicht erweiternden Hals; c) H 14,8cm. Breite, tropfenfĂśr mige Flasche aus hellgrĂźnem Klarglas mit Standring, trichterfĂśr PLJHP+DOVXQGQDFKDXgHQJH]RJHQHU/LSSH6WŠFN Feine Iris und partieller Belag, intakt. 900,â&#x20AC;&#x201C; Provenienz: Ex Sammlung H.H., Bayern, vor 1970. &ROOHFWLRQ RI (DVWHUQ 0HGLWHUUDQHDQ ERWWOHV RI \HOORZ DQG OLJKW FOHDU JODVV globular or squat globular body with cylindrical or tubular necks and tubular RUEURDGULPVWUGFHQWXU\$')LQHLULGHVFHQFHSDUWLDOO\FRYHULQJLQWDFW SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

335


661 6DPPOXQJ *OÂ&#x201D;VHU Â?VWOLFKHU 0LWWHOPHHUUDXP    -K Q &KU D  + FP 7URSIHQI¤UPLJH )ODVFKH DXV KHOOEODXHP Klarglas mit breitem hochgedrĂźcktem Boden, langem Hals und trichterfĂśrmiger MĂźndung, auf dem KĂśrper gezwickten Noppen in zwei Reihen; b) H 9,5cm. Becher aus hellblauem Klarglas PLW NOHLQHU 6WDQG~Â&#x201D;FKH XQG OHLFKW QDFK DXgHQ JH]RJHQHU XQG HLQJHIDOWHWHU /LSSH F  + FP 6WHLOZDQGLJH 6FKDOH DXV KHOOEODXHP .ODUJODV PLW NOHLQHU KRFKJHVWRFKHQHU 6WDQG~Â&#x201D;FKH und abgeschliffenem Rand. 6WŠFN Feine Iris, intakt. 600,â&#x20AC;&#x201C; Provenienz: Ex Sammlung H.H., Bayern, vor 1970. &ROOHFWLRQRI(DVWHUQ0HGLWHUUDQHDQYHVVHOVRIOLJKWEOXHFOHDUJODVVDSLULIRUP ERWWOHZLWKSLQFKHVDEHDNHUDQGDERZOZLWKVWLQJHGERWWRPVWUGFHQWXU\ $')LQHLULGHVFHQFHSDUWLDOO\FRYHULQJLQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

662 =ZHL %HFKHU Â?VWOLFKHU 0LWWHOPHHUUDXP    -K Q &KU Aus hellblauem Klarglas. 1) H 10,2cm. Konischer KĂśrper mit HLQJHVFKREHQHP U¤KUHQI¤UPLJHQ 6WDQGIXg XQG OHLFKW QDFK DXgHQ JH]RJHQHU XQG JHUXQGHWHU /LSSH GDUXQWHU HLQ GŠQQHU )DGHQULQJ   + FP =\OLQGULVFKHU .¤USHU PLW 6WDQG~Â&#x201D;FKH XQG OHLFKW QDFK DXgHQ JH]RJHQHU XQG JHUXQGHWHU /LSSH .RQYH[HU.¤USHUPLWYLHUJURgHQ(LQWLHIXQJHQXQG5LSSHQ 6WŠFN Feine Iris, intakt. 500,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV Collection of two beakers, with foot and trail decoration and with convex sides, RIOLJKWEOXHFOHDUJODVVVWWKFHQWXU\$')LQHLULGHVFHQFHLQWDFW2 pie FHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 7UÂ&#x201D;QHQ~Â&#x201D;VFKFKHQÂ?VWOLFKHU0LWWHOPHHUUDXP-KQ&KU +FP$XVKHOOEODXHP.ODUJODV%DXFKLJHU.¤USHUPLW ODQJHP]\OLQGULVFKHQ+DOVXQGHLQJHIDOWHWHU/LSSH6WŠFN Im Inneren schĂśne Iris, intakt. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV &ROOHFWLRQ RI WZR ERWWOHV RI OLJKW EOXH FOHDU JODVV VW  QG FHQWXU\ $' Iridescence, intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

664 6DPPOXQJ*OÂ&#x201D;VHUPLW3URGXNWLRQVIHKOHUQĂ&#x2013;stlicher Mittelmeer UDXP-KQ&KU+FP6DOE¤O~Â&#x201D;VFKFKHQDXV hellblauem und farblosem Glas. Konischer und zylindrischer KĂśrper mit langem, zylindrischem Hals.  6WŠFN ZerdrĂźckt, MĂźndungen abgebrochen, ein StĂźck gebrochen und geklebt, schĂśne Iris. 150,â&#x20AC;&#x201C; 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ +*5KHLQODQG3IDO] Production defects, two piriform bottles of light green and colorless glass, 1st QGFHQWXU\$'6PDVKHGDQGEURNHQRQHUHDWWDFKHGYHU\EHDXWLIXOLULGH scence. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

336

665 6DPPOXQJ*OÂ&#x201D;VHUÂ?VWOLFKHU0LWWHOPHHUUDXPXQG Jh. n. Chr. Aus hellblauem und grĂźnem Klarglas. a) H 21,1cm. /Â&#x201D;QJOLFKHVEDXFKLJHV)OÂ&#x201D;VFKFKHQPLW'RUQXQGJHIDOWHWHU/LS SHE +FP.HU]HQVWÂ&#x201D;QGHU7URSIHQXQGEDXFKLJHV )OÂ&#x201D;VFKFKHQ PLW ~DFKHP RGHU HLQJHGUŠFNWHP %RGHQ ]\OLQGUL VFKHP+DOVXQGJHIDOWHWHU/LSSHF +FP%DXFKLJHU6SULQN ler mit gestauchtem Kragen.  6WŠFN SchĂśne Iris, partieller Belag, intakt. 500,â&#x20AC;&#x201C; Provenienz: Ex. Sammlung H.H., Bayern, vor 1970. &ROOHFWLRQRI(DVWHUQ0HGLWHUUDQHDQVPDOOFDQGOHVWLFNDQGZLWKGURSVKDSHG ERWWRPERWWOHVDQGDVSULQNOHUVWQGDQGWKWKFHQWXU\$'%HDXWLIXO iridescence, partially covering, intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

666 0RGHUQH 6WDEEURVFKH DXV *ROG PLW DQWLNHP &DPHR Brosche PRGHUQ&DPHRU¤PLVFKFD-KQ&KUJ/FP&D meo H 1,1cm. Cameo aus hellroter Koralle mit einer drapierten FrauenbĂźste, in einer antikisierenden Goldfassung mit Ă&#x2013;se ge fasst, montiert als Stabbrosche. *ROG7UDJEDU Intakt. 500,â&#x20AC;&#x201C; 3URYHQLHQ]([6OJ2%1RUGGHXWVFKODQGVHLWGHQHU-DKUHQ 0RGHUQJROGEURRFKDQDQWLTXHUHGFRUDOFDPHRGHSLFWLQJWKHGUDSHGEXVW of a woman, in a modern mounting after the antique, mounted to a modern EURRFK%URRFKPRGHUQFDPHRURPDQQGFHQWXU\$',QWDFW6XLWDEOHIRU PRGHUQZHDU 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

667 *ODVSHUOHQNHWWH5¤PLVFK-KQ&KU/FP=\OLQGUL sche, bikonische, trichterfĂśrmige, kugelige und scheibenfĂśrmige Perlen aus verschieden farbigem, gestreiftem Glasmosaik. 7UDJ EDUPLW9HUVFKOXVV Modern aufgefädelt, intakt. 250,â&#x20AC;&#x201C; Provenienz: Ex Sammlung C.B., Hessen, vor 1979. 1HFNODFHRIGLIIHUHQWO\VKDSHGEDQGHGPRVDLFJODVVEHDGV5RPDQVWQG FHQWXU\$'0RGHUQVWULQJLQJLQWDFW6XLWDEOHIRUPRGHUQZHDUZLWKFDUH 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

668 =ZHL.HWWHQDXV*ODVXQG.DUQHROSHUOHQ5¤PLVFK-KQ &KU/FDXFPD $XVNXJHOLJHQXQGELNRQLVFKHQ3HU len aus grĂźnem, blauem und schwarzem Glas sowie Karneol. Dazwischen zwei Perlen aus Fritte. b) Aus kugeligen und biko QLVFKHQ3HUOHQDXV/DJHQDFKDW.DUQHROEODXHPZHLgHPXQG grĂźnem Glas, dazwischen eine Bergkristallperle.  6WŠFN Mo dern aufgefädelt, intakt. 400,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEHVWÂ&#x201D;QGHQ GHU 0ŠQ]KDQGOXQJ .DUO .UHVV0ŠQFKHQYRU 7ZR QHFNODFHV RI PRVWO\ JODVV DQG UHG FRUQHOLDQ EHDGV 5RPDQ VW  UG FHQWXU\$'0RGHUQVWULQJLQJLQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851


669 =ZHL .HWWHQ DXV *ODV XQG .DUQHROSHUOHQ 5¤PLVFK    -K Q&KU/FDXFPD$XVELNRQLVFKHQXQGSRO\HGHUI¤U migen Perlen aus Karneol, schwarzem Stein und blauem Glass, dazwischen verschiedenartige Glasperlen. b. Aus vorwiegend NXJHOLJHQ ELNRQLVFKHQ U¤KUHQ XQG VFKHLEHQI¤UPLJHQ 3HUOHQ DXV.DUQHROEODXHPZHLgHPXQGJUŠQHP*ODV6WŠFN Mo dern aufgefädelt, intakt. 400,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEHVWÂ&#x201D;QGHQ GHU 0ŠQ]KDQGOXQJ .DUO .UHVV0ŠQFKHQYRU 7ZR QHFNODFHV RI PRVWO\ JODVV DQG UHG FRUQHOLDQ EHDGV 5RPDQ VW  UG FHQWXU\$'0RGHUQVWULQJLQJLQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

670 7RUTXHVDXV%URQ]H%URQ]H]HLWY&KUkFP Aus rundem Draht, der an der Ă&#x2013;ffnung zu einem Haken und einer Ă&#x2013;se aufgebogen ist und dessen Enden spiralig aufgewickelt sind. GrĂźne Patina, Spiralenden gebrochen. 500,â&#x20AC;&#x201C; 3URYHQLHQ]([VŠGGHXWVFKH3ULYDWVDPPOXQJ06HU-DKUH Torque of bronze wire with hook and eye closure and spiral endings. Bronze $JH%&*UHHQSDWLQDVSLUDOHQGLQJVEURNHQ 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

671 7RUTXHVDXV%URQ]H%URQ]H]HLWY&KUkFP$XV rundem Draht, der an der Ă&#x2013;ffnung zu zwei Ă&#x2013;sen aufgebogen ist und dessen Enden spiralig aufgewickelt sind. GrĂźne Patina, intakt. 500,â&#x20AC;&#x201C; 3URYHQLHQ]([VŠGGHXWVFKH3ULYDWVDPPOXQJ06HU-DKUH 7RUTXHRIEURQ]HZLUHZLWKWZRH\HOHWVDQGVSLUDOHQGLQJV%URQ]H$JH %&*UHHQSDWLQDLQWDFW 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

672 â&#x20AC;˘ 3DDU$UPUHLIHPLW.XJHOGHNRUKaukasisch (?), 1. Jt. v. Chr. Ă&#x2DC; 6cm. Bronzevollguss, verzinnt. Ring, an dem fĂźnf Kugeln mit rechteckigen Stegen, die plastischen Punktdekor aufweisen, befestigt sind. Teils grĂźne Patina, Reste von Sinter, Bruchstelle in einem Reif, der andere an drei Stellen antik repariert und modern gekebt. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK$XNWLRQ/RV

e 3DDU6LOEHUDUPUHLIHPLW7LHUNRSIHQGHQ/XULVWDQ-WY&KUk 6,5cm. Offene, bandfĂśrmige Reife, die in stilisierten TierkĂśpfen enden. Auf den Reifen eingeritztes Rautenmuster. BraungrĂźne Patina, intakt. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW GHU $XVIXKUJHQHKPLJXQJ GHU LVUDHOLVFKHQ $QWLNHQEHK¤UGH %HL *RUQ\  0RVFK$XNWLRQ/RV Pair of silver bracelets with open endings in shape of stylized animal heads. Luristan, 1st millenium B.C. Browngreen patina, intact. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

674 =ZHL*ODVDUPUHLIH5¤PLVFK-KQ&KUkFP$XVRSD NHQZHLgHQKHOOEODXHQXQGVFKZDU]HQWRUGLHUWHQ*ODVVWÂ&#x201D;EHQ an den Enden zusammengezwickt. 6WŠFN Ein Reif geklebt. 200,â&#x20AC;&#x201C; 3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06HU-DKUH 7ZRWZLVWHGEUDFHOHWVRIZKLWHEOXHDQGEODFNJODVV5RPDQQGUGFHQWX U\$'2QHUHDVVHPEOHGSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

675 6LOEHUQH $QNHU}EHO 5¤PLVFK    -K Q &KU / FP Der Kopfteil in Form eines Ankers mit KnĂśpfen an den $XV]LSIHOXQJHQ:XOVWDP%ŠJHOVFKHLWHOXQG.QRSIDP)XgWHLO von einer Platte abgedeckte Spirale, trapezfĂśrmiger Nadelhalter mit graviertem Dreiecksband. An der Spirale eine Anhänger mit (IHXEODWWDP)XgHLQWUDSH]I¤UPLJHU$QKÂ&#x201D;QJHU(LQ$QKÂ&#x201D;QJHU an der Spirale fehlt. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6ŠGGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]HDQFKRU}EXODFRQVLVWLQJRIDQRQLRQNQRE}QLDODVKDOORZFDWFKSODWH a bow that widens to the head and terminates in a decorated rectangular KRUL]RQWDOEDU7KHERZKHDGLVFXUYHGZLWKVKRUWZLQJVWKDWDQJOHEDFNZDUGV ZLWKURXQGHG}QLDOVRQHSHQGDQWLQVKDSHRIDQLYRU\OHDIRQHWUDSH]RLGDO 5RPDQQGUGFHQWXU\$'2QHSHQGDQWPLVVLQJ 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

676 6FKHLEHQ}EHO PLW (PDLO(LQODJHQ 5¤PLVFK    -K Q &KU /FP=ZHLDQWLWKHWLVFKH3IHUGHN¤SIHGLHPLWHLQHP%RJHQ verbunden sind, darĂźber zentral ein Reif. Emaileinlagen in 2UDQJH +HOO X 'XQNHOJUŠQ XQG 6FKZDU] 6FKZDU]H 3DWLQD Nadel fehlt, Emaileinlagen zum Teil verloren. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([VŠGGHXWVFKH3ULYDWVDPPOXQJ06HU-DKUH

3DLURIWLQWHGEURQ]HFDVWEUDFHOHWVZLWK}YHVSKHUHV&DXFDVLDQ " VWPLO lenium B.C. Partially green patina, traces of sinter, one bracelet broken, the RWKHUUHSDLUHGLQDQFLHQWDQGPRGHUQWLPHV WUDFHVRIJOXH 

'LVF}EXODZLWKHQDPOLQOD\VLQVKDSHRIWZRDQWLWKHWLFKRUVHKHDGVDQGDULQJ DERYH5RPDQVWUGFHQWXU\$'%ODFNSDWLQDQHHGOHPLVVLQJHQDPHO inlays partially lost.

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

337


677 %URQ]HQH6FKHLEHQ}EHOLQ'XUFKEUXFKVWHFKQLN5¤PLVFK Jh. n. Chr. Ă&#x2DC; 5,2cm. Im Zentrum ein Buckel, in einem Vierpas VRUQDPHQW~RUDOH(OHPHQWHDOV%HJUHQ]XQJ]XPOHLFKWXPJH bogenen Rand eine Punktreihe, in den Zwickeln ursprĂźnglich Emaileinlagen. GrĂźne Patina, Nadel fehlt, RĂźckseite etwas kor rodiert. 400,â&#x20AC;&#x201C; 3URYHQLHQ]([6ŠGGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]H RSHQZRUN GLVF }EXOD ZLWK RULJLQDO HQDPHO LQOD\V LQ WKH JXVVHWV 5RPDQ UG  WK FHQWXU\ $' *UHHQ SDWLQD QHHGOH PLVVLQJ EDFNVLGH partially corroded. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

678 .OHLQH6DPPOXQJ3IHUGH}EHOQDXV%URQ]HDarunter eine Schar QLHU}EHOPLWHLQHP3IHUGFKHQLPVHLWOLFKHQ5HOLHI /FPU¤ PLVFK-KQ&KUJUŠQVFKZDU]H3DWLQDLQWDNW 6SLUDO}EHO PLWVWLOLVLHUWHP3IHUGFKHQ /FP(LVHQ]HLW-KY&KU LQWDNW  XQG HLQH JUDYLHUWH 3IHUGFKHQ}EHO / FP 0LWWHODOWHU Nadel fehlt). 6WŠFN 250,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEHVWÂ&#x201D;QGHQ GHU 0ŠQ]KDQGOXQJ .DUO .UHVV0ŠQFKHQYRU 6PDOOFROOHFWLRQRIKRUVH}EXODLQFOXGLQJRQH5RPDQRQH,URQ$JHDQGRQH 0HGLHYDO}EXOD2QH}EXODZLWKPLVVLQJQHHGOHWKHRWKHUVLQWDFWSLHFHV

680 6DPPOXQJ0LQLDWXU3KDOORL5¤PLVFK-KQ&KU/ FP%URQ]HJXVVEHLHLQHP([HPSODU5HVWHYRQ9HU]LQQXQJ Darunter ein Anhänger in Form eines männlichen Geschlechts PLWÂ?VHQGUHL$PXOHWW$QKÂ&#x201D;QJHULQ)RUPHLQHV3KDOORV]ZHL $PXOHWWDQKÂ&#x201D;QJHUPLW]ZHL3KDOORLXQGGUHL$SSOLNHQLQ3KDOORV )RUPGDYRQHLQH]XVÂ&#x201D;W]OLFKPLWPDQXV}FD6WŠFN Intakt. 450,â&#x20AC;&#x201C; 3URYHQLHQ]([0ŠQFKQHU3ULYDWVDPPOXQJ06VHLWHU-DKUHQ Collection of bronze miniature votive and amulet pendants in shape of a male genitalia or a phallos with loop, among them two pendants with two phalloi DQGWKUHHDSSOLTXHVRQHRIWKHPZLWKSKDOORVDQGPDQXV}FD5RPDQVW UGFHQWXU\$'*UHHQSDWLQDLQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

681 ,QWHUHVVDQWH6DPPOXQJEURQ]HQH*ŠUWHOEHVFKOÂ&#x201D;JHDarunter fĂźnf %HVFKOÂ&#x201D;JH /FPWKUDNRVN\WKLVFK-KY&KU PLW stilisierten Tieren, drei Beschläge, davon zwei in Durchbruchs WHFKQLNPLW)DEHOZHVHQXQG*UHLI /FPDZDULVFK-K Q&KU GUHL%HVFKOÂ&#x201D;JHPLW+DVH/¤ZHPLW6RQQHXQG0RQG XQG/¤ZHLQ'XUFKEUXFKVWHFKQLN /FPU¤PLVFK -K Q&KU   PLWWHODOWHUOLFKH %HVFKOÂ&#x201D;JH PLW /¤ZH 9RJHO )D EHOZHVHQXQG:ROIDXVYHUJROGHWHU%URQ]H /FP -K XQGHLQZLNLQJLVFKHU$QKÂ&#x201D;QJHUPLW$GOHUXQG)LVFK /FPkFP-KQ&KU 6WŠFN Teils mit grĂźner Patina, teils fehlen winzige Fragmente. 1.600,â&#x20AC;&#x201C;

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0ŠQFKHQ]ZLVFKHQXQG

679 6DPPOXQJ0LQLDWXU3KDOORL5¤PLVFK-KQ&KU/  FP (LQ ([HPSODU DXV 6LOEHU VRQVW %URQ]HJXVV ]7 PLW Kaltarbeit. Darunter zwei Anhänger in Form eines männlichen *HVFKOHFKWV PLW Â?VHQ YLHU $PXOHWW$QKÂ&#x201D;QJHU LQ )RUP HLQHV 3KDOORV GDUXQWHU HLQHU DXV 6LOEHU / FP  HLQ $PXOHWWDQ hänger mit zwei Phalloi, ein Amulettanhänger mit Phallos und +DQGHLQH$SSOLNHLQ3KDOORV)RUPXQGHLQ'HFNHOYRQHLQH 0LQLDWXUJHIÂ&#x201D;gPLW3KDOORV6WŠFN Intakt. 500,â&#x20AC;&#x201C;

&ROOHFWLRQRIEURQ]HEHOW}WWLQJVLQFOXGLQJ}YH7KUDFR6F\WKLDQ}WWLQJVZLWK VW\OL]HGDQLPDOV WKWKFHQWXU\%& WKUHH$YDULDQ}WWLQJVZLWKP\WKLFDO FUHDWXUHVDQGJULI}Q WKWKFHQWXU\$' WKUHH}WWLQJVZLWKKDUHOLRQZLWK VXQDQGPRRQDQGOLRQLQRSHQZRUNWHFKQLTXH 5RPDQQGUGFHQWXU\ $' }YH0HGLHYDO}WWLQJVZLWKOLRQELUGP\WKLFDOFUHDWXUHDQGZROIRIJLO GHGEURQ]H WKWKFHQWXU\ DQGD9LNLQJSHQGDQWZLWKHDJOHDQG}VK WKWKFHQWXU\$' 3DUWLDOO\ZLWKJUHHQSDWLQDSDUWLDOO\IHZIUDJPHQWV missing. SLHFHV

3URYHQLHQ]([0ŠQFKQHU3ULYDWVDPPOXQJ06VHLWHU-DKUHQ Collection of bronze miniature votive and amulet pendants in shape of a male genitalia or a phallos with loop, among them one of silver, one pendant with two phalloi, one with a phallos and an hand, one applique and one lid RIDPLQLDWXUHYHVVHO5RPDQVWUGFHQWXU\$'*UHHQSDWLQDLQWDFW10 SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

682 =ZHL *ODV$QKÂ&#x201D;QJHU Byzantinisch. H 2cm. Spätantike, runde $QKÂ&#x201D;QJHUDXVJHOEHP*ODVPLWVWHKHQGHP/¤ZHQ6WŠFN Eine Ă&#x2013;se ist gebrochen. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6.3DULVH[$XNWLRQ%RLVJLUDUG/RV Two yellow glass pendants. Byzantine. Round Pendants with a standing lion. One lug is broken. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 %OHL$PXOHWW5¤PLVFK-KQ&KU/FP)ODFKHRYDOH Scheibe mit einer Inschrift und Kreuzsymbol auf der Vordersei te. Feine Haarrisse, sonst intakt. 120,â&#x20AC;&#x201C; 3URYHQLHQ]([6OJ6.3DULVH[*RUQ\ 0RVFK0ŠQFKHQ$XNWLRQ /RV Lead amulet depicting an inscription and a cross symbol on the frontside. Late 5RPDQWKWKFHQWXU\$'7LQ\FUDFNVRWKHUZLVHLQWDFW 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

338


684 *HPPHPLW+DKQXQG+HQQH5¤PLVFK-KQ&KU$XV URWHP .DUQHRO % FP  DXI GHP TXHURYDOHQ ,QWDJOLR HLQ Hahn, der eine Henne begattet, davor ein Modius. Intakt. 250,â&#x20AC;&#x201C; 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0ŠQFKHQ]ZLVFKHQXQG Red cornelian gemstone depicting a rooster mating a hen, in front of them a PRGLXV5RPDQVWQGFHQWXU\$',QWDFW

688 )ŠQI VFK¤QH .DPHHQ DXV GHP   -DKUKXQGHUW k   FP2YDOH.DPHHQDXVRUDQJHJHÂ&#x201D;GHUWHP$FKDWPLWHLQHP Wappen, darĂźber ein Schwertarm. Ovale Kamee aus Gagat mit GHP %UXVWVWŠFN HLQHU MXQJHQ )UDX LP 3UR}O PLW 'LDGHP XQG NRVWEDUHP*HZDQG/Â&#x201D;QJOLFKH.DPHHDXV/DJHQDFKDWPLW$UHV LP 3UR}O PLW NRULQWKLVFKHP +HOP XQG 6FKLOG 2YDOH .DPHH DXV3HUOPXWWPLWGHP3UR}OHLQHV0DQQHVPLW%DUWLPDQWLNHQ *HZDQGXQGPLW/RUEHHUNUDQ]2YDOH.DPHHDXV/DJHQDFKDW mit dem BruststĂźck eines betagten Mannes mit freier Brust.  6WŠFN Prachtexemplare! 400,â&#x20AC;&#x201C;

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

3URYHQLHQ]([(VWHOULFKFROOHFWLRQHUZRUEHQLQGHQHUXQGHU-DKUHQ

685 *HPPH PLW ,VLV 5¤PLVFK    -K Q &KU $XV RUDQJHP Karneol (H 1,2cm), auf dem hochovalen Intaglio eine thronende Isis. Intakt. 250,â&#x20AC;&#x201C;

)LYHQLFHFDPHRVIURPWKHWKWKFHQWXU\2YDOFDPHRPDGHRIDJDWHZLWK an emblem and an arm with a sword above. Oval cameo made of haematite with a bust of a young woman with tiara and precious dress. Obround cameo PDGHRIDJDWHZLWKDSUR}OHRI$UHVZLWK&RULQWKLDQKHOPHWDQGVKLHOG2YDO FDPHRPDGHRIPRWKHURISHDUOZLWKWKHSUR}OHRIDPDQLQDQFLHQWFORWKHV and laurel wreath. Oval cameo made of agate with the bust of an old man with bare chest. SLHFHV

3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0ŠQFKHQ]ZLVFKHQXQG 2UDQJHFRUQHOLDQJHPVWRQHGHSLFWLQJDQHQWKURQHG,VLV5RPDQVWQG FHQWXU\$',QWDFW 9(5.$8)7:,(%(6(+(1.(,1(5�&.*$%(62/'$69,(:(' 125(7851

686 â&#x20AC;˘ *HPPHDXVURWHP.DUQHRO5¤PLVFK-KQ&KU+FP /Â&#x201D;QJVRYDOHU,QWDJOLRGDUDXIHLQ.UHX]XQGGDUXQWHU]ZHL)LVFKH *ROG,QWDNW u 3URYHQLHQ]([6DPPOXQJ.%HUZRUEHQEHL9.1HZ<RUN 'DYRU3ULYDWVDPPOXQJ 5HGFRUQHOLDQJHPVWRQHGHSLFWLQJDFURVVDQGWZR}VK5RPDQUGWK FHQWXU\$',QWDFW 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

687 *HPPHDXV/DJHQDFKDWÂ?VWOLFKHU0LWWHOPHHUUDXP-KY Chr. B 1,5cm. Mit Querbohrung. Darauf ein stilisiertes Tier mit einem Zweig und einem Stern. Winzige Fragmente fehlen. 200,â&#x20AC;&#x201C; 3URYHQLHQ]([6OJ6.3DULVH[*RUQ\ 0RVFK0ŠQFKHQ$XNWLRQ /RV *HPVWRQHPDGHRIOD\HUHGDJDWHZLWKGULOOLQJKROHGHSLFWLQJDVW\OL]HGDQLPDO ZLWKEUDQFKLQIURQWRIDVWDU(DVWHUQ0HGLWHUUDQHDQWKWKFHQWXU\%& Tiny fragments missing. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

689 6FK¤QH *HPPHQ XQG .DPHHQ6DPPOXQJ DXV GHP   -DKUKXQGHUW k   FP 'UHL *HPPHQ DXV RUDQJH geädertem Achat mit Porträts, eine Gemme aus Karneol mit HLQHP3RUWUÂ&#x201D;WIŠQI.DPHHQDXV/DJHQDFKDWPLW)UDXHQSRUWUÂ&#x201D;WV XQG HLQHP 3UR}O GHV $UHV HLQH .DPHH DXV %HLQ PLW 3RUWUÂ&#x201D;W Intakt. 6WŠFN 400,â&#x20AC;&#x201C; 3URYHQLHQ]([(VWHOULFKFROOHFWLRQHUZRUEHQLQGHQHUXQGHU-DKUHQ 1LFHFROOHFWLRQRIJHPVWRQHVDQGFDPHRVIURPWKHWKWKFHQWXU\7KUHH gemstones made of orange agate with portraits, one gemstone made of carne OLDQZLWKDSRUWUDLW}YHFDPHRVPDGHRIDJDWHZLWKIHPDOHSRUWUDLWVDQGRQH of Ares and one cameo made of bone. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

690 6FK¤QH*HPPHQ6DPPOXQJDXVGHP-DKUKXQGHUWĂ&#x2DC; 1 FP=HKQNOHLQH*HPPHQDXV.DUQHROIŠQI*HPPHQDXV RUDQJHJHÂ&#x201D;GHUWHP $FKDW GDEHL HLQH LQ 6LOEHU JHIDVVW ZHLWHUH Gemmen aus Koralle, Quarz und Onyx, mit verschiedenen Motiven. Intakt bis leichte Absplitterungen. 6WŠFN 400,â&#x20AC;&#x201C; 3URYHQLHQ]([(VWHOULFKFROOHFWLRQHUZRUEHQLQGHQHUXQGHU-DKUHQ 1LFHFROOHFWLRQRIJHPVWRQHVIURPWKHWKWKFHQWXU\7HQVPDOOJHPVWRQHV PDGHRIFDUQHOLDQ}YHPDGHRIDJDWHZLWKLQRQHLVFDVHGLQVLOYHUIXUWKHU gemstones made of coral, quartz and onyx, with various themes. Intact, some ZLWKVOLJKWVSOLWRIIVSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

691 6FK¤QH *HPPHQ6DPPOXQJ DXV GHP   -DKUKXQGHUW Ă&#x2DC; ca. 1cm. Kleine Gemmen unter anderem aus Achat, Karneol, /DSLVOD]XOLPLWYHUVFKLHGHQHQ0RWLYHQ6WŠFN 400,â&#x20AC;&#x201C; 3URYHQLHQ]([(VWHOULFKFROOHFWLRQHUZRUEHQLQGHQHUXQGHU-DKUHQ 1LFH FROOHFWLRQ RI JHPVWRQHV IURP WKH WKWK FHQWXU\ 6PDOO JHPVWRQHV made of agate, carnelian, lapis lazuli among others, with various themes. 19 SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

339


692 6DPPOXQJHQDQWLNHU*HPPHQXQGPRGHUQHU*LSVDEGUŠFNH 20. Jh. n. Chr. Darunter 17 Gemmen unter anderem aus Karne RO]ZHLGDYRQDOV5LQJJHIDVVWXQGHLQ6NDUDEÂ&#x201D;XVkFP Dazu ein rechteckiger Stein aus rotem Glas mit dem Porträt HLQHV EÂ&#x201D;UWLJHQ 0DQQHV / FP  -K PLW /Â&#x201D;QJVERKUXQJ intakt) sowie vier AbdrĂźcke von Gemmen der hellenistischen XQG U¤PLVFKHQ =HLW DXV HLQHU 'DNW\OLRWKHN + FP DXV Gips mit schwarzem Ă&#x153;berzug, Ă&#x153;berzug z.T. abgesplittert, 18. Jh.) mit der BĂźste eines Mannes, mit den gestaffelten KĂśpfen YRQ $XJXVWXV PLW (LFKHQNUDQ] XQG /LYLD PLW GHP .RSI YRQ Zeus Ammon sowie mit dem thronenden Asklepios mit Schlan JH .DODWKRV XQG =HSWHU ~DQNLHUW YRQ +\JLHLD XQG 7\FKH PLW Mauerkrone. 6WŠFN 500,â&#x20AC;&#x201C; 3URYHQLHQ](UZRUEHQŠEHUZLHJHQGEHL+HOLRVYRUXQGH[6DPPOXQJ 'U:*0ŠQFKHQHU-DKUH Collection of gemstones and plaster casts. 17 gemstones, two of them installed in rings, one scarab. Along with it one rectangular red glass stone with a portrait of a bearded man and four plaster casts of a daktyliothek depicting a male bust, the portraits of Augustus and Livia, a head of Zeus Ammon and $VFOHSLRV ZLWK +\JLHLD DQG 7\FKH 5RPDQ WR 0RGHUQ 7LPHV QG  WK century. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 *URgH*HPPHQ6DPPOXQJDXVGHP-DKUKXQGHUWkFD FP.OHLQHELVPLWWHOJURgH*HPPHQXQG.DPHHQPLWWHLOZHLVH antikisierenden Motiven. Darunter sieben Mikromosaike mit Motiven aus Rom. 6WŠFN 400,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHUVŠGGHXWVFKHQ6DPPOXQJ5* %LJ FROOHFWLRQ RI JHPVWRQHV IURP WKH WKWK FHQWXU\ 6PDOO DQG ELJJHU JHPVWRQHVZLWKDQWLTXHOLNHWKHPHVDPRQJRWKHUVVHYHQPLFURPRVDLFVZLWK themes from Rome. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

694 *URgH*HPPHQ6DPPOXQJDXVGHP-DKUKXQGHUWĂ&#x2DC; ca.   FP .OHLQH ELV PLWWHOJURgH *HPPHQ XQG .DPHHQ PLW teilweise antikisierenden Motiven, frĂźhneuzeitlichen Wappen und Porträts. 6WŠFN 400,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHUVŠGGHXWVFKHQ6DPPOXQJ5* %LJ FROOHFWLRQ RI JHPVWRQHV IURP WKH WKWK FHQWXU\ 6PDOO DQG ELJJHU JHPVWRQHVZLWKDQWLTXHOLNHWKHPHVSRUWUDLWVDQGHDUO\PRGHUQKHUDOGLFHP blems. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

340

695 )UDJPHQWHLQHV(URWHQ6DUNRSKDJ5¤PLVFK-KQ&KU+ 14,8cm, B 15,8cm. Marmor, oberer Teil einer Sarkophagwand PLW]ZHL(URWHQ/LQNV+DOE}JXUHLQHV(URWHQPLWGHU5HFKWHQ auf seinem Gesicht, rechts BĂźste eines Eroten mit leicht nach hinten gebeugten Kopf. Die beiden Figuren tragen leichte Ge wänder Ăźber der linken Schulter und kurze, lockige Frisuren. )UDJPHQW2EHU~Â&#x201D;FKHEHULHEHQ5ŠFNVHLWHPRGHUQJHJOÂ&#x201D;WWHW 500,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ )UDJPHQWRIPDUEOHFRI}QZLWKWZRHURWHVQGUGFHQWXU\$'$IUDJPHQW slightly worn surface. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

696 5HOLHIIUDJPHQW PLW 3IHUGHNRSI 5¤PLVFK    -K Q &KU /FP%FP0DUPRU(UKDOWHQVLQGGHU.RSIXQGGHU 7HLOHLQHV9RUGHUIXgHVYRQHLQHPQOJDORSSLHUHQGHQ3IHUGGD YRU HLQHU HUKDEHQH /HLVWH OLQNV GDYRQ GLH ,QVFKULIWHQUHVWH ,  $9 2EHU~Â&#x201D;FKH EHVWRgHQ ]ZHL PRGHUQH %RKUO¤FKHU XQG =X richtung fĂźr Aufhängung auf der RĂźckseite. 500,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHU 6OJ '. .RSHQKDJHQ YRUPDOV DXV HLQHU 1RUGHXURSÂ&#x201D;LVFKHQ6DPPOXQJHUZRUEHQLQGHQHUHU-DKUHQ )UDJPHQWRIDPDUEOHUHOLHIGHSLFWLQJWKHKHDGDQGDSDUWRIRQHIRUHOHJRID KRUVHDVZHOODVWKHOHWWHUV,$9RIDQLQVFULSWLRQ5RPDQVWQGFHQWXU\ $'6XUIDFHZRUQWZRPRGHUQGULOOLQJKROHVDWWKHEDFNVLGHIRUVXVSHQVLRQ 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

697 $UFKLWHNWXUIUDJPHQW    -K Q &KU :HLgHU IHLQNULVWDOOLQHU Marmor. H 16cm B 24cm. Von einem ionischen Kapitell mit Eierstab und seitlichen Blättern. Fragmentarisch. 200,â&#x20AC;&#x201C; 3URYHQLHQ]([1DFKODVV'U:LHGHPDQQ.ORVWHU1HXEXUJHU -DKUH $UFKLWHFWXUDOIUDJPHQWIURPDLRQLFFDSLWDOZLWKHJJDQGGDUWDQGOHDYHVUG FHQWXU\$')UDJPHQWDU\ 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851


698 6DPPOXQJ%URQ]HREMHNWH5¤PLVFK-KQ&KU'DUXQWHU vier Appliken in Form einer HermesbĂźste (H 5cm, antike GusslĂścher), einer AthenabĂźste (H 4,5cm, intakt) und zwei /¤ZHQN¤SIHQ k FP XQG FP GHU NOHLQHUH LQWDNW GHU JU¤gHUH PLW ]ZHL /¤FKHUQ  HLQ 0DUVNRSI + FP DP +DOV JHEURFKHQ  HLQ 3DQWKHUNRSIJULII / FP JHEURFKHQ  YLHU 3KDOORV$QKÂ&#x201D;QJHU /FPX+FPEHLHLQHP)UDJPHQWH GHV +RGHQVDFNV JHEURFKHQ  ]ZHL 3IHLOVSLW]HQ / FP XQG 5,5cm, Reste von Sinter und fehlende Fragmente), 5 Fibeln, GDUXQWHU]ZHL=ZLHEHONQRSI}EHOQ /FP-KQ&KU LQWDNW XQGHLQH2PHJD)LEHO kFPLQWDNW HLQH.QLH}EHO PLWKDOEUXQGHU.RSISODWWH /FP-KQ&KULQWDNW  HLQH)LEHOPLWXPJHVFKODJHQHP)Xg /FP-KQ&KU intakt) und ein Armreif mit verdickten Enden und drei Noppen (Ă&#x2DC; 6cm, intakt) u.a. 6WŠFN u 3URYHQLHQ]$XVGHU6DPPOXQJ/-1LHGHUODQGHYRU Collection of bronze objects including four appliques in form of a bust of 0HUFXU\DQG$WKHQDDQGOLRQKHDGVDKHDGRI0DUVSDUWRIDKDQGOHZLWKD SDQWKHUKHDGIRXUPLQLDWXUHSKDOORVSHQGDQWVWZRDUURZKHDGV}YH}EXODVD EUDFHOHW5RPDQQGWKFHQWXU\$'0RVWO\LQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

699 ,VLV)RUWXQDXQG+HUPHV5¤PLVFKH.DLVHU]HLW-KQ&KU ,VLV PLW W\SLVFK JULHFKLVFKÂ&#x201D;J\SWLVFKHU 7UDFKW XQG )ŠOOKRUQ Bronzehohlguss, H 9cm; Hermes mit Caduceus, Bronzevollguss, H 6,5cm.6WŠFN Beide mit Patina und min. Beschädigungen. 600,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHQHKHPDOLJHQ5HVWEHVWÂ&#x201D;QGHQGHU0ŠQFKQHU0ŠQ]KDQGOXQJ .DUO.UHVVYRU 5RPDQEURQ]H}JXUHVRI,VLV)RUWXQDDQG0HUFXU\VWUGFHQWXU\$' Patina, min. damages.SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

700 3DQDXV%URQ]H*ULHFKHQODQG-KY&KU%URQ]HYROOJXVV H 10,5cm. Figur eines laufenden, nackten Pan mit ausgestreckten Armen. Grimassenhafte GesichtszĂźge. Die rechte Hand hat eine rechteckige Vertiefung. GrĂźne Patina, fragmentarisch. 500,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV %URQ]H }JXULQH RI 3DQ *UHHFH WK  UG FHQWXU\ %& *UHHQ SDWLQD fragmented. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

701 %URQ]HEŠVWHGHV0HQ5¤PLVFK-KQ&KU+FDFP Aus einem Blßtenkelch wachsende Bßste des nackten Men mit phrygischer Mßtze und Mondsichel. Reste von Sinter, intakt. u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0ŠQFKHQ]ZLVFKHQXQG %URQ]HEXVWRIQDNHG0HQZLWK3KU\JLDQFDSDQGOXQXOD5RPDQVWQG FHQWXU\$'7UDFHVRIVLQWHULQWDFW

702 3IHUGHVWDWXHWWH PLW 6LOEHUEDQG 5¤PLVFK    -K Q &KU + FP / FP %URQ]HYROOJXVV 6WDWXHWWH HLQHV 3IHUGHV PLW erhobenem rechten Vorderlauf. Um den Bauch und Hals ein zu den Enden schmaler werdendes Silberband geschlungen. GrĂźne Patina, rechter Hinterlauf gebrochen, 600,â&#x20AC;&#x201C; 3URYHQLHQ]([:LHQHU3ULYDWVDPPOXQJ06HU-DKUH %URQ]HPLQLDWXUHKRUVHZLWKDVLOYHUEDQG5RPDQVWQGFHQWXU\$' *UHHQSDWLQDULJKWKLQGOHJEURNHQ 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 6DPPOXQJ 7LHU}JXUHQ DXV %URQ]H Vorwiegend westasiatisch. / FP %URQ]HYROOJXVV ]7 PLW .DOWDUEHLW 'DUXQWHU GUHL )LJŠUFKHQDXV/XULVWDQ -WY&KU LQ)RUPHLQHV9RJHOXQG zweier Widderanhänger, ein skythischer Hirsch aus Silber (5. -K Y&KU  YLHU =HEX5LQGHU HLQHV GDYRQ DXI HLQHP $OWDU zwei Panther, ein Hirsch, ein Stier, eine Ziege und ein liegender Widder. 6WŠFN*U¤gWHQWHLOVLQWDNWEHLHLQHU)LJXU/RFKLP Sockel. 500,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEHVWÂ&#x201D;QGHQ GHU 0ŠQ]KDQGOXQJ .DUO .UHVV0ŠQFKHQYRU &ROOHFWLRQRIDQLPDO}JXUHVRIEURQ]HLQFOXGLQJWKUHHSHQGDQWVRI/XULVWDQD Scythian silver deer, four cebu bulls, two pahnthers, one deer, one bull, a goat DQGDFURXFKLQJUDP0RVWO\:HVWHUQ$VLDWLF0RVWO\LQWDFWRQH}JXUHZLWK hole in the stand. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

704 .OHLQH 6DPPOXQJ 3IHUGFKHQ}JXUHQ DXV %URQ]H Vorwiegend U¤PLVFK    -K Q &KU / FP %URQ]HYROOJXVV PLW Kaltarbeit. Darunter zwei Pferdchen mit Bronzesockel und eins davon mit Reiter, zwei modern gesockelte Figuren, die anderen beiden ohne Sockel. Zwei Pferdchen stark stilisiert.  6WŠFN *U¤gWHQWHLOVLQWDNW]76FKZDQ]RGHU9RUGHUIXgJHEURFKHQ u 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEHVWÂ&#x201D;QGHQ GHU 0ŠQ]KDQGOXQJ .DUO .UHVV0ŠQFKHQYRU 6PDOOFROOFHFWLRQRIKRUVH}JXUHVWZRRIWKHPZLWKEURQ]HVWDQGDQGRQHRI them with rider, two with modern stand and two without stand, two strongly VW\OL]HG0RVWO\5RPDQQGWKFHQWXU\$'0RVWO\LQWDFWSDUWLDOO\WDLORU foreleg broken. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

705 6LFKHOSURWRPHQS\[LV Geometrisch, 8. Jh. v. Chr. H 6,7cm. 0LW 5LW]GHNRU 'XQNHOJUŠQH 3DWLQD 2EHU~Â&#x201D;FKH VWHOOHQZHLVH JHJOÂ&#x201D;WWHW u Provenienz: Ehemals in einer portugiesischen Sammlung, erworben in den HU -DKUHQ H[ *RUQ\  0RVFK $XNWLRQ   /RV  'DQQ 3ULYDWVDPPOXQJ$0'HXWVFKODQG *HRPHWULFEURQ]HS\[LVZLWKELUGhVKHDGVDQGHQJUDYHGGHFRUWKFHQWXU\ %&'DUNJUHHQSDWLQDVXUIDFHSDUWLDOO\EXUQLVKHG 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

341


706 'RQDXOÂ&#x201D;QGLVFKH0\VWHULHQSODNHWWH5¤PLVFKH.DLVHU]HLW Jh. n. Chr. B 8,5cm, H 8,5cm. SternfĂśrmige, zweiseitige Blei platte. Darstellung auf der Vorderseite in drei Registern (von REHQQDFKXQWHQ 2EHQGLH%ŠVWHQYRQ6ROXQG/XQDHLQDQ der gegenĂźber. Darunter Helena zwischen den von jeweils einer weiteren Figur begleiteten Dioskuren, die Ăźber eine am Boden liegende Figur hinwegreiten. Darunter sind Opferszenen, Gerät schaften, Tiere und weitere Figuren zu sehen. Auf der RĂźckseite in einem Kreis auf einer Standlinie Potnia Theron (=Herrin der 7LHUH  PLW HLQHP JH]Â&#x201D;XPWHQ /¤ZHQ 6HOWHQH)RUP Bleipatina, unterer und linker Rand gebrochen, zwei Rundeln fehlen, drei Rundeln wieder angesetzt. 250,â&#x20AC;&#x201C; 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6ŠGGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ 'DQEXLDQ P\VWHU\ SODTXH VWDUVKDSHG ZLWK UHOLHIV RQ WZR VLGHV 5RPDQ ,PSHULDO3HULRGQGUGFHQWXU\$'%HLJHSDWLQDOHIWDQGORZHHGJHEUR ken, two roundels missing, three roundels reattached. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

707 3DDUEURQ]HQH=LHUEHVFKOÂ&#x201D;JH5¤PLVFK-KQ&KUkFD 8,8cm. Runde, in Durchbruchstechnik gearbeitete Scheiben mit SHOWDI¤UPLJHQ 2UQDPHQWHQ LP 5DQG MHZHLOV YLHU /¤FKHU LQ denen die bronzenen Befestigungsnägel z.T. noch erhalten sind. Wahrscheinlich von einer Wagendekoration.  6WŠFN GrĂźne Patina, insgesamt vier Befestigungsnägel erhalten, intakt. 400,â&#x20AC;&#x201C; 3URYHQLHQ] ([ +HUPDQQ +LVWRULFD $XNWLRQ   /RV  H[ 6ŠGGHXWVFKH3ULYDWVDPPOXQJ06VHLWHU-DKUHQ %URQ]HURXQGGLVFLQRSHQZRUNZLWKSHOWDVKDSHGRUQDPHQWVDWWKHHGJHKROHV IRU WKH QDLOV SDUW RI FKDULRW }WWLQJ 5RPDQ QG  UG FHQWXU\ $' *UHHQ patina, in total four nails preserved, intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

708 =ZHL %URQ]HVWHPSHO Byzantinisch, Ăśstl. Mittelmeergebiet,    -K Q &KU D %URWVWHPSHO / FP ODQ]HWWI¤UPLJ PLW Â?VH XQG 5LQJ DXI GHU 5ŠFNVHLWH ,QVFKULIW 7  1,.2 E Monogrammstempel: H 4,5cm, mit Ă&#x2013;se auf der RĂźckseite und Monogramm. 6WŠFN*UŠQH3DWLQDLQWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV 6DPPOXQJ$$0ŠQFKHQ]ZLVFKHQXQG

710 6DPPOXQJDQWLNHUNOHLQHU2EMHNWHDarunter zwei punische Idole aus Bein, vier Teile eines rĂśmischen Arztbestecks aus Bronze, YLHUU¤PLVFKH0LQLDWXUJHIÂ&#x201D;gHDXVEXQWHP*ODVHLQU¤PLVFKHU Messergriff in Form eines männlichen Kopfes mit phrygischer MĂźtze, ein Bleiring, eine rĂśmische Theatermaske aus Terrakotta u.a. 6WŠFN7HLOZHLVHIUDJPHQWLHUWXQGJHEURFKHQ u 3URYHQLHQ]([6DPPOXQJ5%6ŠGGHXWVFKODQGVHLW Collection of ancient small objects. Among others two punic bone idols, four Roman surgical instruments, four Roman miniature jars made of coloured glas, a Roman knife handle in the form of a male head with phrygian cap, a lead ring and one terracotta mask. Partly fragmented. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

711 6DPPOXQJ DQWLNHU .OHLQREMHNWH D  =ZHL JULHFKLVFKU¤PLVFKH 6FKOHXGHUEOHLH/XQGFP'XQNHOJUDXHXQGEUDXQH3DWLQD b) RĂśmischer bronzener Fingerring mit roter Karneolgemme, GDUDXI)RUWXQD5LQJJU¤gHPPF =ZHL)Â&#x201D;OVFKHUI¤UPFKHQ aus Ton, eines mit Abdruck eines Gegenstempels, eines mit Abdruck eines Denars des Severus Alexander. Ă&#x2DC; 2,6 und 2,9cm. d) Kegelsiegel aus Blei mit Kopf des Antoninus Pius. Ă&#x2DC; 2,5cm. Dunkelgraue Patina. e) Zwei rĂśmische Glasanhänger in Form YRQ*HIÂ&#x201D;gHQ/XQGFPI ,VODPLVFKHV*ODVJHZLFKWk 2,5cm. GrĂźnes Klarglas mit Iris. 6WŠFN 500,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ &ROOHFWLRQRIDQFLHQWREMHFWV,QFOD WZR*UHHN5RPDQOHDGVOLQJEXOOHWVZLWK GDUNJUH\DQGEURZQSDWLQDE 5RPDQEURQ]H}QJHUULQJZLWKUHGFRUQHOL DQ JHPVWRQH GHSLFWLQJ )RUWXQD F  WZR WHUUDFRWWD IRUJHU\ PRXOGV RQH IRU D FRXQWHUPDUNRQHIRUDGHQDULXVRI6HYHUXV$OH[DQGHUG DOHDGHQFRQHVHDO ZLWKWKHSRUWUDLWRI$QWRQLQXV3LXVZLWKGDUNJUH\SDWLQDH WZR5RPDQJODVV SHQGDQWLQIRUPRIYHVVHOVDQGI DQ,VODPLFZHLJKWPDGHRIJUHHQLVKJODVV with iridescence. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

712 6LW]HQGH *¤WWLQwDXV7HUUDNRWWD6. Jh. v. Chr. Brauner Ton. H 14,6cm. KĂśrper und Thron sind nur schematisch modelliert, das Gesicht dafĂźr etwas feiner ausgefĂźhrt. Beide Seiten des Throns JHEURFKHQHLQH(FNHZLHGHUDQJHNOHEWPHKUHUH%HVWRgXQJHQ auf der RĂźcksseite Wachssiegel mit Wappen. 250,â&#x20AC;&#x201C;

7ZR EURQ]H VWDPSV 2QH EUHDG VWDPS ZLWK WKH LQVFULSWLRQ 7  1,.2 DQG RQHPRQRJUDPPVWDPS%\]DQWLQH(DVWHUQ0HGLWHUUDQHDQWKWKFHQWXU\ $'*UHHQSDWLQDLQWDFWSLHFHV

3URYHQLHQ]([6DPPOXQJ6.3DULVH[*RUQ\ 0RVFK0ŠQFKHQ$XNWLRQ /RV

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

*UHHN WHUUDFRWWD RI VHDWHG wJRGGHVVx WK FHQWXU\ %& 7KURQH EURNHQ DW both sides, one fragment reattached, several dents, wax seal with coat of arms at back.

709 6DPPOXQJ$VWUDJDOH5¤PLVFK-KQ&KU/FP Darunter 7 StĂźck aus Bronze, 5 StĂźck aus Blei und 10 StĂźck aus Knochen. 6WŠFN Intakt. 500,â&#x20AC;&#x201C; 3URYHQLHQ]([VŠGGHXWVFKH3ULYDWVDPPOXQJ06HU-DKUH =XU9HUZHQGXQJGHU$VWUDJDOHV0)LWWÂ&#x2019;6SLHOHXQG6SLHO]HXJLQGHU$QWLNH  6IIII &ROOHFWLRQRINQXFNOHERQHVPDGHRIEURQ]HOHDGDQGERQH5RPDQVWUG FHQWXU\$',QWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

342

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851


 6DPPOXQJ JULHFKLVFKHU 7HUUDNRWWD}JXUHQ Griechisch und (WUXVNLVFK-KQ&KU+YRQELVFP+HOOHUXQG roter Ton. a) Aphrodite Anadyomene im Chiton mit Himation und Obergewand, eine Hand geklebt, kleine Absplitterungen; b) KĂśrper der halbnackten Aphrodite Anadyomene mit Amorkopf, aus mehreren Teilen zusammengesetzt und restauriert; c) eine Tanagräerin, Kopf und KĂśrper aus verschiedenen Statuetten, Hinterteil vĂśllig restauriert; d) Figur eines Mannes im kurzen &KLWRQ.RSIJHNOHEW2EHU~Â&#x201D;FKHVWDUNEHULHEHQXQGYHUVLQWHUW 6WŠFN 500,â&#x20AC;&#x201C;

716 7HUUDNRWWDVWDWXHWWHHLQHUVFKZDQJHUHQ)UDX5¤PLVFK-KQ Chr. H 14,8cm. Hellroter Ton. Stehende, nackte Frau mit in die HĂźften gestemmten Armen. Wahrscheinlich eine Votivstatuette. 3URYLQ]LHOOHU 6WLO $XV JURgHQ )UDJPHQWHQ ]XVDPPHQJHVHW]W UnterkĂśrper u. Teil der linken KĂśrperseite fehlen. 400,â&#x20AC;&#x201C;

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

&ROOHFWLRQRIJUHHNWHUUDFRWWD}JXUHVVWUGFHQWXU\$'$PRQJWKHPWZR $SKURGLWHVDZRPDQDQGDPDQ}JXUHV3DUWLDOO\UHDWWDFKHGDQGUHSDLUHG otherwise good preserved. SLHFHV

717 0Â&#x201D;GFKHQNRSIPLW.UDQ]*ULHFKLVFK-KY&KU+FP Grober, brauner Ton. Handgeformt. Nach links gedrehter Kopf HLQHV 0Â&#x201D;GFKHQV PLW 0HORQHQIULVXU FDSLWH YHODWR XQG JURgHP .UDQ] 5ŠFNZÂ&#x201D;UWLJ GUHL DQWLNH 9HUWLHIXQJHQ 2EHU~Â&#x201D;FKH DP Hinterkopf teilweise abgeplatzt. 400,â&#x20AC;&#x201C;

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

714 .OHLQH6DPPOXQJDQWLNHU7HUUDNRWWDVWDWXHWWHQa) H 14 cm. Hell brauner Ton. Einseitig ausgeformte Statuette einer GĂśttin mit Polos. Griechisch, 4. Jh. v. Chr. Intakt. b) H 15,1 cm. Brauner Ton. Matrizengeformte Statuette eines Eros als Schafträger. RĂś PLVFK-KQ&KU,QWDNWF +ELVFP5RWEUDXQHU und beiger Ton. Drei KĂśpfe mit Mitra, sog. BischĂśfe. Spätantik, -KQ&KU$OOHLP+DOVJHEURFKHQ6WŠFN 750,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ erworben aus dem Nachlass eines Zahnarztes. 6PDOO&ROOHFWLRQRI$QFLHQWWHUUDFRWWD}JXUHVD 2QHVLGHPRXOGHGVWDWXHWWH RIDJRGGHVVZLWKSRORV*UHHNWK%&%ULJKWEURZQFOD\,QWDFWE 0RXOG IRUPHGVWDWXHWWHRIDQ(URVDVJRRGVKHSKHUG5RPDQVWUGFHQWXU\$' %URZQFOD\,QWDFWF 7KUHHKHDGVZLWK0LWUDVRFDOOHGELVKRSV/DWH5RPDQ WKWKFHQWXU\$'5HGGLVKEURZQDQGEHLJHFOD\$OOEURNHQDWWKHQHFN SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

715 =ZHL +\GURSKRUHQ *ULHFKLVFK    Y &KU +  XQG 15,9cm. Matrizengeformt mit handmodelliertem Ă&#x153;berzug. Aus rotbraunem Ton.  6WŠFN Ă&#x153;berzug teilweise abgeplatzt, sonst intakt. 550,â&#x20AC;&#x201C; Provenienz: Aus der westdeutschen Privatsammlung H.W., erworben im 0Â&#x201D;U] 7ZRK\GURSKRUHVPDGHRIUHGEURZQFOD\*UHHN%&0RXOGHG formed with handmoulded slip. Slip partially rubbed off, otherwise intact. 2 SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

3URYHQLHQ]([¤VWHUUHLFKLVFKH3ULYDWVDPPOXQJ06HU-DKUH Terracotta statuette of a standing pregnant woman, probably a votive. Roman, QGUGFHQWXU\$'5HDVVHPEOHGORZHUERG\DQGSDUWRIWKHOHIWVLGH missing.

Provenienz: Aus der westdeutschen Privatsammlung H.W., erworben im 2NWREHUDXVGHU6DPPOXQJ'U+RW]H Handmolded head of a young woman capite velato with wreath made of coarse EURZQFOD\*UHHNQGVWFHQWXU\%&6XUIDFHDWWKHEDFNRIWKHKHDGLV SDUWLDOO\~DNHRII 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

718 9HQXVLQÂ&#x160;GLNXODRĂśmisch, Asia Minor, um 200 n. Chr. 14,6 x 11,4cm. Brauner Ton. Hinten halbrundes Relief in Form einer Ă&#x201E;dikula, in der die nackte GĂśttin steht. Sie trägt eine Frisur in der Mode der severischen Kaiserinnen und hält mit der Rechten ein Gewand und FrĂźchte. Der Kopf der GĂśttin wird von einer Muschel hinterfangen. Und am Rand der Ă&#x201E;dikula ein Eierstab. 9RUQHHLQNOHLQHVKLQWHQHLQJURgHV%UHQQORFKREHQHLQ/RFK zum Aufhängen. Unten winzige Absplitterungen, sonst intakt. 250,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ Roman terracotta relief made of brown clay in shape of an aedicula shrine with scallop shell top, inside Venus with the headdress of the severian empresses. $VLD0LQRUDERXW$'%HORZIHZWLQ\VSOLQWHUVDUHPLVVLQJRWKHUZLVH intact. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

719 0Â&#x201D;QQOLFKHV*HVFKOHFKWVYRWLYRĂśmische Kaiserzeit oder frĂźher. H 8,5cm. Hellroter Ton mit Resten von rotem Ă&#x153;berzug. Reste von Sinter, an der Kante hinten zwei BrĂźche, sonst intakt. u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ +*5KHLQODQG3IDO] 7HUUDFRWWDYRWLYHLQIRUPRIPDOHJHQLWDOLD*UHHNRU5RPDQ3HULRG7UDFHV of sinter, partially broken edges, otherwise intact. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

343


720 )UDJPHQWHLQHU7RQNDFKHOPLW/¤ZHQNRSI5¤PLVFKXP-KQ Chr. H 15,5cm, B 14cm. Roter Ton mit braunem Ă&#x153;berzug. Im REHUHQ 7HLO GHU .DFKHO HLQ /¤ZHQNRSI LP 5HOLHI + FP 7 XPFP PLWSDUWLHOOHUKDOWHQHU0Â&#x201D;KQH)UDJPHQW2EHU~Â&#x201D;FKH SDUWLHOODEJHULHEHQ u Provenienz: Aus der westdeutschen Privatsammlung W.R., erworben in den HUELVHU-DKUHQ &HUDPLF WLOH IUDJPHQW ZLWK D UHOLHI OLRQ KHDG $ERXW UG FHQWXU\ $' $ fragment, partially rubbed off slip. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

721 6XEP\NHQLVFKHV$ODEDVWURQ11. Jh. v. Chr. H 9,1cm, B 10,2cm, k FP +HOOEUDXQHU 7RQ PLW URWEUDXQHU %HPDOXQJ /LQLHQ GHNRU DXI GHU 6FKXOWHU 3XQNWUHLKH $XV JURgHQ )UDJPHQWHQ zusammengesetzt, vollständig. 400,â&#x20AC;&#x201C; 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ $$0ŠQFKHQHUZRUEHQ]ZLVFKHQXQG 6XE 0\FHQDHDQ DODEDVWURQ WK FHQWXU\ %& 5HDVVHPEOHG IURP ODUJH fragments, complete. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

722 6DPPOXQJ IUŠKHU JULHFKLVFKHU 6FKDOHQ D  F  ,RQLVFK  -K Y &KUD =ZHLKHQNOLJH7ULQNVFKDOHPLW6WDQGIXgXDEJHVHW]WHP 5DQG5RWVFKZDU]H%HPDOXQJLQ)RUPYRQEUHLWHQXQGVFKPD len umlaufenden Bändern. Im Inneren konzentrische Kreise. H 8,5 cm, Ă&#x2DC; 15,5cm. Aus Fragmenten zusammengesetzt, moder QH (UJÂ&#x201D;Q]XQJHQ E  =ZHLKHQNOLJH 7ULQNVFKDOH PLW 6WDQGIXg X DEJHVHW]WHP 5DQG +HQNHO]RQH URW )Xg]RQH VFKZDU] EHPDOW im Inneren schwarzer Glanzton. H 7,8cm, Ă&#x2DC; 12,5cm. Ein Hen kel gebrochen und geklebt, leichte Absplitterung am Rand. c) =ZHLKHQNOLJH 7ULQNVFKDOH PLW 6WDQGIXg X DEJHVHW]WHP 5DQG +HQNHO]RQHURW)Xg]RQHVFKZDU]EHPDOWLP,QQHUHQVFKZDU ]HU*ODQ]WRQ+FPkFP)XgJHEURFKHQXQGJHNOHEW OHLFKWH $EVSOLWWHUXQJHQ DP 5DQG G  H  *ULHFKLVFK¤VWOLFKHU 0LWWHOPHHUUDXP JHRPHWULVFK    -K Y &KU 3URWRZKLWH painted ware. d) Flache Trinkschale mit kleinem Standring und zwei kleinen Henkeln. Braune Bemalung im Inneren mit NRQ]HQWULVFKHQ/LQLHQ+FPkFP$EVSOLWWHUXQJDP 5DQGGRUWJHEURFKHQXQGJHNOHEWH (LQKHQNOLJH~DFKH7ULQN schale mit kleinem Standring. Braune Bemalung im Inneren mit NRQ]HQWULVFKHQ/LQLHQ+FPkFP0RGHUQH(UJÂ&#x201D;Q]XQJ DP5DQGGRUWJHEURFKHQXQGJHNOHEWI 'DXQLVFKVXEJHRPH WULVFK    -K Y &KU +DQGJHW¤SIHUWH NRQLVFKH 6FKDOH PLW EUHLWHU6WDQG~Â&#x201D;FKHRKQH+HQNHO%LFKURPDWLVFKH%HPDOXQJLQ breiten konzentrischen Streifen und geometrischem Motiv im ,QQHUHQ=ZHL /¤FKHU DP 5DQG+ FP k FP,QWDNW  6WŠFN 750,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO &ROOHFWLRQRI(DUO\*UHHNERZOVDF ,RQLFWKFHQWXU\%&D 7ZLQKDQGOHG drinking bowl. Red and black painted bands, circles inside. Reassembled from IUDJPHQWVPRGHUQDGGLWLRQV E  7ZLQ KDQGOHG GULQNLQJ ERZO 5HG SDLQWHG at the handle part, black painted at the foot zone, black inside. One handle EURNHQDQGUHDVVHPEOHGVOLJKWVSOLWRIIVDWWKHULPF 7ZLQKDQGOHGGULQNLQJ bowl. Red painted at the handle part, black painted at the foot zone, black LQVLGH)RRWEURNHQDQGUHDVVHPEOHGVOLJKWVSOLWRIIVDWWKHULPGH *UHHN (DVWHUQ0HGLWHUUDQHDQJHRPHWULFDOG )ODWGULQNLQJERZOZLWKVPDOOIRRWULP

344

XQGWZRKDQGOHV%URZQSDLQWHGFRQFHQWULFDOOLQHVLQVLGH6SOLWRIIVDWWKHULP EURNHQDQGUHDVVHPEOHGH )ODWGULQNLQJERZOZLWKVPDOOIRRWULPXQGRQH KDQGOH%URZQSDLQWHGFRQFHQWULFDOOLQHVLQVLGH0RGHUQDGGLWLRQDWWKHULP EURNHQDQGUHDVVHPEOHGI 'DXQLFDOVXEJHRPHWULFDO+DQGPRXOGHGFRQLFDO bowl without handle. Bichromatical painted thick strips and geometrical motif inside. Two holes at the rim. Intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 =ZHL NRULQWKLVFKH .RW\OHQ 6FKZDU]}JXULJ 'HWDLOV WHLOZHLVH LQ 5RW D  6SÂ&#x201D;WSURWRNRULQWKLVFK    Y &KU + FP % FP k FP )XgVWUDKOHQ GDUŠEHU )ULHV PLW +XQGHQ XQWHU GHU /LSSH :HOOHQOLQLHQ :LQ]LJH $EVSOLWWHUXQJHQ DP 5DQG )DUEH HWZDV EHULHEHQ E  0LWWHONRULQWKLVFK    Y &KU + FP % FP k FP )XgVWUDKOHQ )ULHV PLW YLHU 6FKZÂ&#x201D;QHQXQGHLQHP$GOHUXQWHUGHU/LSSH:HOOHQOLQLHQ$XV Fragmenten zusammengesetzt, wenige kleine Fehlstellen.  6WŠFN u 3URYHQLHQ]$XVGHQHKHPDOLJHQ5HVWEHVWÂ&#x201D;QGHQGHU0ŠQFKQHU0ŠQ]KDQGOXQJ .DUO.UHVVHUZRUEHQYRU 7ZR&RULQWKLDQEODFN}JXUHGNRW\ODLD /DWH3URWR&RULQWKLDQ B.C. With frieze depicting four dogs. Tiny splinters at the rim are missing, co ORUSDUWLDOO\VOLJKWO\UXEEHGRIIE 0LGGOH&RULQWKLDQ%&2XWVLGH a frieze with four swans and one eagle. Reassembled from fragments, only few tiny splinters are missing. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

724 .RULQWKLVFKHU$U\EDOORV6SÂ&#x201D;WSURWRNRULQWKLVFKY&KU +FPkFP$XIGHU6FKXOWHUPHKUHUH6SLUDOHQDXIGHP Bauch Fries mit vier laufenden Hunden. Kleine Fehlstellen an MĂźndungsteller und Standring, kleine Farbretuschen. Dazu eine NOHLQH&KRXVGHU*QDWKLD:DUHPLW:HLQUDQNH.DPSDQLHQ -KY&KU+FP)DUEHVWHOOHQZHLVHHWZDVYHUULHEHQVRQVW intakt. 6WŠFN u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQH[/RV &KRXV  H[6DPPOXQJ+-63+HVVHQHUZRUEHQ Corinthian pointed aryballos with frieze of four dogs. Late Protocorinthian, %&/LWWOHPLVVLQJIUDJPHQWVDWPRXWKDQGVWDQGIHZVSRWVZLWK UHWRXFKHG FRORU 3OXV D VPDOO FKRXV RI WKH *QDWKLDZDUH ZLWK YLQHWHQGULO Campanian, 4th century B.C. Surface partially slightly rubbed, otherwise in tact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

725 .OHLQH 6DPPOXQJ NRULQWKLVFKH 9DVHQ Spätkorinthisch II, 550   Y &KU D  ([DOHLSWURQ PLW 2PHJDKHQNHOQ 6FKXOWHU XQG +HQNHO~Â&#x201D;FKLJEHPDOW+FP/FPkFP$XgHQ DQ HLQHU 6WHOOH ELV ]XP )Xg 2EHU~Â&#x201D;FKH DEJHSODW]W E  .RW\OH PLW DEJHVHW]WHP 5DQG $XgHQ 7URSIHQIULHV VRQVW LQQHQ XQG DXgHQ PLW *ODQ]WRQ EHGHFNW + FP % FP k FP Aus Fragmenten zusammen gesetzt, dabei eine retuschierte )HKOVWHOOHF 0LQLDWXU.RW\OH$XgHQ=LFN]DFNEDQGVRZLHURWH XQGVFKZDU]H/LQLHQ+FP%FPkFP,QWDNW'D]X HLQ G  ~DFKHV URW}JXULJHV $ODEDVWURQ $XI GHU 6FKXOWHU )ULHV YRQYLHU:DVVHUY¤JHOQGD]ZLVFKHQ5RVHWWHQ,WDORNRULQWKLVFK XPY&KU+FPkFP(LQHDQWLNH$ESODW]XQJDP KĂśrper, eine kleine moderne Absplitterung an der MĂźndung.  6WŠFN 500,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO


/LWWOH FROOHFWLRQ RI &RULQWKLDQ YDVHV /DWH &RULQWKLDQ ,,6    %& D ([DOHLSWURQZLWKRPHJDKDQGOH6KRXOGHUDQGKDQGOHFRYHUHGZLWKFRORU 2XWVLGHDWDODUJHVSRWRIWKHVXUIDFHFKLSSHGRIIE .RW\OHZLWKRIIVHWULP Outside frieze with drops, otherwise inside and outside covered with black glaze. Reassembled from fragments, one small modern and retouched area. F  0LQLDWXUHNRW\OH 2XWVLGH ]LJ]DJ DQG EHORZ UHG DQG EODFN OLQHV ,QWDFW 3OXVDG ~DWUHG}JXUHGDODEDVWURQ2QWKHVKRXOGHUIRXUZDWHUELUGV,WDOR corinthian, about 550 B.C. One splinter at the corpus is chipped off in ancient times, one splinter of the rim is lost in modern times. SLHFHV

729 *ULHFKLVFKHU 6N\SKRV 5. Jh. v. Chr. H 9,7cm, B 19,5cm, Ă&#x2DC; FP$XgHQVHQNUHFKWHXQGZDDJHUHFKWH3DOPHWWHQ,QWDNW 500,â&#x20AC;&#x201C; 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ $$0ŠQFKHQHUZRUEHQ]ZLVFKHQXQG *UHHNVN\SKRVWKFHQWXU\%&2XWVLGHSDOPHWWHV,QWDFW

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

726 'UHL NRULQWKLVFKH 7HOOHU 6SÂ&#x201D;WNRULQWKLVFK ,,    -K Y &KU D  k FP :HLgH (QJREH GDUDXI LQ URVD XQG URWHU )DUEH %OŠWHQPXVWHU$XV)UDJPHQWHQ]XVDPPHQJHVHW]WE kFP :HLgH (QJREH GDUDXI PLW URWHU XQG VFKZDU]HU )DUEH .UHLVH und Zickzackband. Farbe stellenweise verrieben, sonst intakt. F  k FP :HLgH (QJREH GDUDXI PLW URWHU XQG VFKZDU]HU Farbe Kreise und Kranz. Intakt. 6WŠFN 600,â&#x20AC;&#x201C;

e $WWLVFKH /HN\WKRV GHV %RZGRLQ0DOHUV    Y &KU 6DOEJHIÂ&#x201D;gPLW]\OLQGULVFKHP.¤USHU+FPkFPk)Xg FP5RW}JXULJ9RUQHDXIGHP.¤USHUHLQH1LNHPLW6FKDOH vor einem Altar. DarĂźber und darunter ein Band mit Mäander. Auf der Schulter schwarze Palmetten und ein Stabfries. 0LW .RSLHQGHV+LUVFKNDWDORJHV Aus Fragmenten zusammengesetzt, JU¤gHUH3DUWLHQ FDHLQ'ULWWHO IHKOHQXQGVLQGUHWXVFKLHUW 500,â&#x20AC;&#x201C;

3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ $$0ŠQFKHQHUZRUEHQ]ZLVFKHQXQG 7KUHH&RULQWKLDQSODWHV/DWH&RULQWKLDQ,,WKWKFHQWXU\%&$OOZLWK ZKLWHVOLSD )ORZHUSDLQWHGZLWKSLQNDQGUHGFRORU5HDVVHPEOHGIURPIUDJ PHQWVE &LUFOHVDQG]LJ]DJSDWWHUQSDLQWHGZLWKUHGDQGEODFNFRORU&RORU SDUWLDOO\UXEEHGRIIRWKHUZLVHLQWDFWF &LUFOHVDQGZUHDWKSDLQWHGZLWKUHG and black color. Intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5�&.*$%(62/'$69,(:(' 125(7851

727 %¤RWLVFKH6FKDOH5. Jh. v. Chr. H 7,2cm, B 20,6cm, Ă&#x2DC; 15,7cm. ,QQHQ7RQGRPLW.UHLVSXQNWDXgHQ3DOPHWWHQIULHV(LQ+HQNHO sowie ein Randfragment gebrochen und wieder angesetzt, kleine $ESODW]XQJHQLP,QQHUHQ u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ $$0ŠQFKHQHUZRUEHQ]ZLVFKHQXQG Boeotian cup. 5th century B.C. Inside tondo with dot and circle, outside palmettes. One handle and a fragment of the rim are broken and reattached, LQVLGHIHZOLWWOHVSOLQWHUVRIWKHVXUIDFHDUH~DNHGRII 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

728 %¤RWLVFKH6FKDOH5. Jh. v. Chr. H 7,1cm, B 20,7cm, Ă&#x2DC; 15,7cm. ,QQHQ7RQGRPLW.UHLVSXQNWDXgHQ3DOPHWWHQIULHV(LQ+HQNHO gebrochen und wieder angesetzt, kleine Abplatzungen im ,QQHUHQ u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ $$0ŠQFKHQHUZRUEHQ]ZLVFKHQXQG Boeotian cup. 5th century B.C. Inside tondo with dot and circle, outside palmettes. One handle is broken and reattached, inside few little splinters of WKHVXUIDFHDUH~DNHGRII

3URYHQLHQ] ([ +LUVFK 1DFKIROJHU $XNWLRQ   /RV   $XV ED\HULVFKHU6DPPOXQJw  9JO ]XP %HLVSLHO )OŠJHO 2EHUJHZDQG XQG $OWDU DXI GHU /HN\WKRV $UFKÂ&#x201D;RORJLVFKHV 1DWLRQDOPXVHXP 0DGULG  $59  &9$  7DI%HD]OH\$UFKLYH3RWWHU\'DWDEDVH RGHUGDV8QWHUJHZDQG DXIGHU/HN\WKRV%ULWLVK0XVHXP/RQGRQ( $59%HD]OH\ $UFKLYH3RWWHU\'DWDEDVH  $WWLFUHG}JXUHF\OLQGULFDOOHN\WKRVRIWKH%RZGRLQ3DLQWHU%& On the corpus a Nike with bowl in front of an altar. Reassembled from frag PHQWVODUJHSDUWV DERXWRQHWKLUG DUHPLVVLQJDQGUHWRXFKHG:LWKFRSLHV RIWKHFRUUHVSRQGLQJFDWDORJXHE\+LUVFK 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 =ZHLDWWLVFKH/HN\WKHQ1. Hälfte 5. Jh. v. Chr. Beide mit zylin GULVFKHP&RUSXVD FP6FKZDU]}JXULJ6DW\UPLW.LWKDUD und tanzende Mänade zwischen zwei Bäumen. Henkel und Hals JHEURFKHQ XQG ZLHGHU DQJHVHW]W UŠFNZÂ&#x201D;UWLJ JU¤gHUH HUJÂ&#x201D;Q]WH )HKOVWHOOHE +FP:HLgJUXQGLJXQGVFKZDU]}JXULJ0Â&#x201D; ander, Gitterfelder und doppelte Efeuranke. Henkel und Hals gebrochen und wieder angesetzt, rĂźckwärtig ein kleine, ergänzte Fehlstelle, Farbe teilweise verrieben. 6WŠFN 600,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHU6DPPOXQJ06%D\HUQHUZRUEHQLQGHQHUELV HU-DKUHQ%HL*RUQ\ 0RVFK$XNWLRQ/RV 7ZR$WWLFF\OLQGULFDOOHN\WKRLVWKDOIWKFHQWXU\%&D %ODFN}JXUH6DW\U ZLWKNLWKDUDDQGGDQFLQJPDHQDGEHWZHHQWZRWUHHVE :KLWHJURXQGDQG EODFN}JXUH0HDQGHUEDQGVRIJULGDQGDGRXEOHLY\WHQGULO+DQGOHDQG neck at both vases are broken and reattached, each lekythos with a missing DQGPRGHUQDGGHGSDUWDWWKHEDFNWKHFRORXURIE LVSDUWLDOO\VOLJKWO\UXEEHG off. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

345


 .DPSDQLVFKHV URW}JXULJHV $ODEDVWURQ FD    Y &KU + FP %DXFKLJH 9DVH PLW VFKPDOHP ]\OLQGULVFKHP +DOV XQG XPJHVWŠOSWHU /LSSH 'LH URW}JXULJH 0DOHUHL ]HLJW HLQ )UDXHQSUR}OPLW6DNNRVXQGHLQH3DOPHWWHPLW]ZHLOÂ&#x201D;QJOLFKHQ Voluten. Hals ist gebrochen und geklebt, Bauch weist Risse auf, NOHLQH$EVSOLWWHUXQJDP%DXFK u 3URYHQLHQ]([6DPPOXQJ.OXJHU &DPSDQLDQUHG}JXUHGDODEDVWURQ$ERXW%&7KHSDLQWLQJVKRZV DIDFHSUR}OHRIDZRPDQDQGDSDOPHWWH7KHQHFNLVEURNHQDQGUHDWWDFKHG }QH}VVXUHVDQGVOLJKWO\FKLSSHG 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 .OHLQH6DPPOXQJURW}JXULJHU9DVHQ0DJQD*UDHFLD v. Chr. a) Apulischer Miniaturkrater mit Deckel. H 8,8cm. Auf dem KĂśrper zwei FrauenkĂśpfe mit Sakkos, dazwischen Palmetten mit Ranken. b) Apulische Chous. H 9,8cm. Auf dem KĂśrper Frauenkopf mit Sakkos zwischen Ranken. c) Apulische Chous. H 9,4cm. Auf dem KĂśrper kleiner Vogel innerhalb eines 5DKPHQV 'D]X G  $WWLVFKH 1HW]OHN\WKRV GHU %XODV*UXSSH $%9  II     Y &KU + FP $XgHQ VFKZDU]HV 1HW] PLW ZHLgHQ 3XQNWHQ  6WŠFN Henkel der Netzlekythos gebrochen und wieder angesetzt, sonst bis auf winzige Abplatzungen intakt. 1.000,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHQHKHPDOLJHQ5HVWEHVWÂ&#x201D;QGHQGHU0ŠQFKQHU0ŠQ]KDQGOXQJ .DUO.UHVVHUZRUEHQYRU 6PDOO&ROOHFWLRQRIUHG}JXUHGYDVHV$SXOLD%&D 0LQLDWXUH NUDWHU ZLWK OLG VLF  2Q WKH FRUSXV WZR KHDGV RI ZRPHQ ZLWK VDNNRV E  &KRXVZLWKWKHKHDGRIDZRPDQZLWKVDNNRVF &KRXVZLWKELUGLQVLGHD IUDPH3OXVG DQ$WWLFQHWOHN\WKRVRIWKH%XODV*URXS%&7KH neck and handle of the lekythos are broken and reattached, otherwise except few rubbed spots intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 .OHLQH 6DPPOXQJ DWWLVFKH 9DVHQ D  1LHGULJH VFKZDU]}JXULJH 6FKDOH,QQHQ7RQGRPLW*RUJRQHLRQ8PY&KU+FP % FP k FP $XV )UDJPHQWHQ ]XVDPPHQ JHVHW]W kleine Fehlstellen an den Bruchkanten. b) Pyxis mit Deckel der Glanztonware. 2. Hälfte 5. Jh. v. Chr. H 10,5cm, Ă&#x2DC; 10,2cm. Aus JURgHQ)UDJPHQWHQ]XVDPPHQJHVHW]WNOHLQH)HKOVWHOOHQDQGHQ %UXFKNDQWHQF .OHLQHU7HOOHUDXIKRKHP)XgGHU*ODQ]WRQZDUH -KY&KU+FPkFP:LQ]LJH%HVWRgXQJHQVRQVW LQWDNWG .OHLQH]\OLQGULVFKH/HN\WKRVPLW6FKXOWHUVWUDKOHQ -K Y &KU + FP (WZDV EHULHEHQ VRQVW LQWDNW H  /DPSH PLW *ODQ]WRQ  -K Y &KU / FP k FP 2EHU~Â&#x201D;FKH partiell verrieben, sonst intakt. Dazu f) moderne Nachahmung HLQHUVFKZDU]}JXULJHQ2LQRFKRHPLW3RVHLGRQXQG6SKLQ[+ 10,8cm. Henkel und Teil der MĂźndung gebrochen. 6WŠFN 1.500,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO /LWWOHFROOHFWLRQRI$WWLFYDVHVD 6WHPOHVVEODFN}JXUHGFXS,QVLGHDVPDOO tondo with gorgoneion. About 500 B.C. Reassembled from fragments, little PLVVLQJDUHDVDWWKHFUDFNVE 3\[LVZLWKOLGRIWKH%ODFN*OD]H:DUHQG half 5th century B.C. Reassembled from fragments, little missing areas at the FUDFNV F  6PDOO VWHPPHG GLVK RI WKH %ODFN *OD]H :DUH WK FHQWXU\ %& /LWWOHDUHDVVOLJKWO\UXEEHGRWKHUZLVHLQWDFWG 6PDOOF\OLQGULFDOOHN\WKRVZLWK UD\VRQWKHVKRXOGHUWK%&/LWWOHDUHDVVOLJKWO\UXEEHGRWKHUZLVHLQWDFWH  Lamp with black glaze. 5th century B.C. Little areas slightly rubbed, other ZLVHLQWDFW3OXVDI PRGHUQLPLWDWLRQRIDEODFN}JXUHGRLQRFKRHZLWKZLWK Poseidon and Sphinx. Handle and part of the mouth are missing. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 .OHLQH 6DPPOXQJ 9DVHQ GHU *QDWKLD:DUH Magna Graecia, VSÂ&#x201D;WHV-KY&KU*ODQ]WRQZDUHPLWURWHUJHOEHUXQGZHLgHU Bemalung. a) Apulische Schnabelkanne mit Pyxidencorpus mit ]ZHLSODVWLVFKHQ/¤ZHQN¤SIHQ+FP$XIGHP'HFNHO]ZHL Weinranken, auf dem KĂśrper Granatapfel. Ausguss gebrochen und wieder angesetzt. b) Apulische Schnabelkanne mit ovoidem Corpus mit zwei plastischen FrauenkĂśpfen. H 19cm. Auf dem KĂśrper mehrere Friese, u.a. Eierstäbe und Weinranke. Im Hals und Henkel gebrochen und wieder angesetzt, kleine retuschierte Fehlstelle am Henkel. c) Kampanische Chous. H 12cm. Auf dem KĂśrper Weinranke. Fehlstelle an der MĂźndung, Reste YRQ6LQWHUG $SXOLVFKHU6N\SKRV+%FPkFP $XgHQEHLGVHLWLJ(IHXUDQNH%HULHEHQH6WHOOHQDP5DQGVRQVW intakt. 6WŠFN 1.000,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHQHKHPDOLJHQ5HVWEHVWÂ&#x201D;QGHQGHU0ŠQFKQHU0ŠQ]KDQGOXQJ .DUO.UHVVHUZRUEHQYRU 6PDOO&ROOHFWLRQRIYDVHVRIWKH*QDWKLDZDUH0DJQD*UDHFLDODWHWKFHQWX U\%&%ODFNJOD]HGZDUHZLWKZKLWHDQGSDUWLDOO\\HOORZDQGUHGSDLQWLQJD  $SXOLDQMXJZLWKEHDNHGVSRXWDQGS\[LVIRUPHGFRUSXVDQGWZRSODVWLFOLRQV heads. On the lid vine tendrils, on the corpus a pomegranate. Spout is broken DQGUHDWWDFKHGE $SXOLDQMXJZLWKEHDNHGVSRXWDQGRYRLGFRUSXVDQGWZR SODVWLFZRPHQKHDGV2QWKHFRUSXVVHYHUDOIULH]HVHJHJJSDWWHUQDQGYLQH tendril. Broken at neck and handle and reattached, little missing part of the KDQGOHLVUHWRXFKHGF &DPSDQLDQFKRXV2QWKHFRUSXVYLQHWHQGULO3DUWRI WKHPRXWKLVPLVVLQJUHVWRIVLQWHUG $SXOLDQVN\SKRV2XWVLGHLY\WHQGULOV Rim is partially rubbed off, otherwise intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

346


 9LHU*HIÂ&#x201D;gHGHU;HQRQ:DUHApulisch, 4. Jh. v. Chr. Ein Kothon mit Strahlenkranz und Wellenband (H 6,1cm), eine Chous mit 6FKZDQ + FP  HLQH &KRXV PLW :HOOHQEDQG + FP  VRZLHHLQH6FKDOHPLW)OHFKWEÂ&#x201D;QGHUQ %FP 6WŠFN Bei einer Chous ist der Henkel gebrochen und wieder angesetzt, sonst intakt. 200,â&#x20AC;&#x201C;

 .OHLQH $QWLNHQVDPPOXQJ D  (LQH NOHLQHU URW}JXULJHU DWWLVFKHU /HN\WKRV PLW MXQJHU VFKUHLWHQGHU )UDX + FP  LQWDNW E  eine kleine hellenistische Kanne aus Terracotta mit Henkel (H FP JXWHUKDOWHQF HLQHU¤PLVFKH7UÂ&#x201D;QHQ~DVFKHPLWODQJHP +DOVDXVJHOEOLFKJUŠQHP.ODUJODV +FP NOHLQHU6SUXQJ LQGHU/LSSHVRQVWLQWDNW6WŠFN u

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ

3URYHQLHQ]([6DPPOXQJ(ULFK:XQGHUOLFK.DUOVUXKHHUZRUEHQLQGHQ HU-DKUHQ

)RXUVPDOOYDVHRIWKH;HQRQZDUH$SXOLDQWKFHQWXU\%&,QFODNRWKRQ with rays and band of waves, a chous with swan, another chous with band of waves and a cup with interlace. One handle of a chous is broken and reat tached, otherwise intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 .OHLQH 6DPPOXQJ JULHFKLVFKH .HUDPLN a) Skyphos der Xe QRQ:DUH $SXOLHQ  -K Y &KU + FP % FP $XV Fragmenten zusammengesetzt. b) Hochwandige Schale der Glanztonware, im Inneren Rädchendekor. Apulien, 4. Jh. v. &KU k FP :LQ]LJH $EVSOLWWHUXQJ DP )Xg F  .OHLQHU Kyathos der Glanztonware. Kampanien, 4. Jh. v. Chr. H 8,1cm, B 11,4cm. Intakt. d) Kleine gedrungene Amphora mit eckigen Henkeln. Hellenistisch. H 7,6cm, B 9,6cm. Kleine Absplitterung an der MĂźndung. 6WŠFN 500,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ erworben aus dem Nachlass eines Zahnarztes. 6PDOO FROOHFWLRQ RI *UHHN SRWWHU\ D  6N\SKRV RI WKH ;HQRQ ZDUH $SXOLD WKFHQWXU\%&5HDVVHPEOHGIURPIUDJPHQWVE %ODFNJOD]HGERZOLQVLGH scrolled decor. Apulia, 4th century B.C. Tiny splinter of the foot is missing. F /LWWOHEODFNJOD]HGN\DWKRV&DPSDQLDQWKFHQWXU\%&,QWDFWG /LWWOH amphora with angular shaped handles. Hellenistic. Little splinter of the rim is missing. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

 6DPPOXQJ.HUDPLN*HIÂ&#x201D;gHSpätes 4. Jh. Darunter ein bauchiger Topf mit langem, schmalen Ausguss und Widderkopfprotome (H 9cm, Ă&#x2DC; 9,2cm, Kaspisch, 8. Jh. v.Chr., ex Christieâ&#x20AC;&#x2DC;s $PVWHUGDP" YRU   HLQ 6N\SKRV GHU ;HQRQ:DUH + FPkFPLQWDNW PLW'HNRULQ)RUPYRQODXIHQGHP+XQG XQGHLQHP6FKUDIIXUEDQGHLQ.DQWKDURVGHU;HQRQ:DUHVRJ 6W 9DOHQWLQV%HFKHU + FP k FP HLQ )UDJPHQW ZLHGHU angesetzt mit retuschierten Bruchkanten und Ergänzungen) EHPDOW PLW 2OLYHQ=ZHLJHQ :HOOHQ XQG 6FKUDIIXUEDQG XQG ein Skyphos (H 9cm, Ă&#x2DC; 7,5cm ohne Henkel, aus mehreren Fragmenten zusammengesetzt, ein Henkel wiederangesetzt, %HPDOXQJVWDUNYHUEODVVW GHU*QDWKLD:DUHPLW%HPDOXQJLQ ZHLgLQ)RUPYRQ=ZHLJHQ6WŠFN 250,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHU6DPPOXQJ/-1LHGHUODQGHYRU Collection of ceramic vessels including a Caspian vessel with handle in shape RIDUDPSURWRPHDQGDEHDNHGVSRXW WKFHQWXU\%&LQWDFW DVN\SKRV RI WKH ;HQRQ ZDUH LQWDFW  D FDQWKDURV RI WKH ;HQRQ ZDUH D VRFDOOHG 6W 9DOHQWLQEHDNHU RQHIUDJPHQWUHDWWDFKHGZLWKUHWRXFKHGDQG}OOHGXSDUHDV  DQGDVN\SKRVRIWKH*QDWKLDZDUHZLWKSDLQWLQJLQZKLWH 5HDVVHPEOHGIURP ODUJHIUDJPHQWVRQHKDQGOHUHDWWDFKHGSDLQWLQJIDGHG /DWHWKFHQWXU\%& SLHFHV

6PDOOFROOHFWLRQRIDQWLTXHVDVPDOODWWLFUHG}JXUHGOHN\WKRVDVPDOOWHUD FRWWDYDVHZLWKKDQGOHDURPDQERWWOHRIJUHHQFOHDUJODVV0RVWO\LQWDFW3 SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

740 6FKDOH GHU Â&#x20AC;5HG 6ZDQy*UXSSH Magna Graecia, 2. Hälfte 4. -K Y &KU k FP % PLW +HQNHOQ  FP 6L[7HFKQLN $XI QLHGULJHP )Xg ,QQHQ HLQ /RUEHHUNUDQ] GDULQ 7RQGR PLW 6FKZDQ DXgHQ /RUEHHU]ZHLJH 5DQG LQQHQ EHVWRgHQ HLQ Henkel wieder angesetzt. 400,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ57*1RUGGHXWVFKODQGHUZRUEHQLP.XQVW KDQGHOLQ'HXWVFKODQG$QIDQJHU-DKUH%HL*RUQ\ 0RVFK $XNWLRQ/RV &XSLQ6L[yVWHFKQLTXHRIWKH5HG6ZDQ*URXS0DJQD*UDHFLDQGKDOI WKFHQWXU\'HFRUDWHGZLWKODXUHOZUHDWKVDQGVZDQ2QHKDQGOHUHDWWDFKHG splinters of rim missing. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

741 $SXOLVFKH 6FKDOH PLW 6WHPSHOGHNRU 2. Hälfte 4. Jh. v. Chr. H FP%PLW+HQNHOQFPkFP*ODQ]WRQVFKDOHPLW LQQHQDEJHVHW]WHP5DQGXQGSUR}OLHUWHP5LQJIXg,QQHQ6WHP peldekor in Form eines Sternornamentes mit fĂźnf Palmetten. Ein Henkel sowie drei kleine Randfragmente gebrochen und wieder angesetzt. 200,â&#x20AC;&#x201C; 3URYHQLHQ] %HL *RUQ\  0RVFK $XNWLRQ   /RV  DXV GHU 6DPPOXQJ.)71RUGUKHLQ:HVWIDOHQYRUHUZRUEHQ $SXOLDQEODFNJOD]HGVWHPOHVVFXSZLWKVWDPSHGGHFRULQVLGHLQIRUPRIDVWDU ZLWK}YHSDOPHWWHVQGKDOIWKFHQWXU\%&2QHKDQGOHDQGWKUHHVPDOO fragments of the rim are broken and reattached. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

742 $SXOLVFKH 6FKDOH 2. Hälfte 4. Jh. v. Chr. H 4,5cm, B 21,7cm, k FP *ODQ]WRQVFKDOH PLW LQQHQ DEJHVHW]WHP 5DQG XQG SUR}OLHUWHP5LQJIXg,QWDNW u 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ:HVWIDOHQHUZRUEHQ]ZLVFKHQ ELVDXVGHU6DPPOXQJ-RVHI:LQWHU $SXOLDQEODFNJOD]HGVWHPOHVVFXSQGKDOIWKFHQWXU\%&,QWDFW 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

347


 *URgHU DWWLVFKHU 6N\SKRV Spätes 5. Jh. v. Chr. H 15,4cm, B 29,4cm, Ă&#x2DC; 18,2cm. Glanztonware. Im oberen Bereich gebrochen und wieder angesetzt, dabei mehrere moderne Ergänzungen, DXgHQJU¤gHUH%HUHLFKHŠEHUPDOW u 3URYHQLHQ] ([ 6DPPOXQJ %0 %D\HUQ VHLW FD  (UZRUEHQ LP 0ŠQFKQHU+DQGHO Large Attic skyphos of the black glaze ware. Late 5th century B.C. Upper part broken and reattached, few modern and retouched areas, outside partially RYHUSDLQWHG 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

744 6DPPOXQJ *ODQ]WRQNHUDPLN DXV 0DJQD *UDHFLD    -K Y Chr. a) H 14,4cm. Beiger Ton. Kugelige Flasche mit geripptem Corpus und Bandhenkel. MĂźndung wieder zusammengesetzt, 6LQWHUUHVWH E  + FP % PLW +HQNHOQ FP 6N\SKRV Intakt. c) H 18,1cm. Gnathia Fläschchen mit ovoidem, vertikal geripptem Corpus und gelber â&#x20AC;&#x17E;Perlenketteâ&#x20AC;&#x153; um die Schulter. Sinterreste, sonst intakt. 6WŠFN u 3URYHQLHQ] (KHPDOV 6DPPOXQJ (& )UDQNHQ HUZRUEHQ LQ GHQ HU XQGHU-DKUHQ /RWEODFNJOD]HGSRWWHU\IURP0DJQD*UDHFLDIURPWKHWKUGFHQWXU\%& D 6SKHULFDO~DVNZLWKRQHKDQGOHDQGULEEHGERG\0RXWKUHDVVHPEOHGUH PDLQVRIVLQWHUE 6N\SKRV,QWDFWF *QDWKLDERWWOHZLWKULEEHGRYRLGFRUSXV DQG\HOORZ QHFNODFHwUXQQLQJURXQGWKHVKRXOGHU5HPDLQVRIVLQWHULQWDFW SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

745 6DPPOXQJ9DVHQDXV$WKHQXQGGHU0DJQD*UDHFLD-KY &KUD .OHLQHURW}JXULJH%DXFKOHN\WKRVPLW+DVHQ+FP (UZRUEHQ LP 0Â&#x201D;U]  DXV GHU 6DPPOXQJ 'U 6WRO] 7LHU b) .DQWKDURV GHU ;HQRQ:DUH + FP Erworben im November  DXV GHU 6DPPOXQJ 'U 6WRO] 7ULHU c) Apulischer Sky phos, Glanztonware. H 7,1cm. Erworben im August 1994 aus der Sammlung Winkels, Essen. d) Etruskische Kleeblattkanne PLWJHULSSWHP&RUSXV0DODFHQD:DUH+FPErworben im 6HSWHPEHUDXVGHU6DPPOXQJ'U6WRO]7ULHU e) Kothon, Glanztonware. H 8,1cm. (UZRUEHQ LP 2NWREHU  DXV 'RUW munder Privatsammlung. f) Kothon, Glanztonware. H 5,8cm. J  %DXFKLJHV .Â&#x201D;QQFKHQ *ODQ]WRQZDUH + FP Erworben LP 2NWREHU  DXV 'RUWPXQGHU 3ULYDWVDPPOXQJ h) Kleine Bauchlekythos, Glanztonware. H 6,8cm. i) Kleine Schnabelkan ne, Glanztonware. H 7,6cm. Erworben im Oktober 1995 aus der Sammlung Winkels, Essen. 6WŠFN2EHU~Â&#x201D;FKLJH$ESODW]XQJHQ DQGHUURW}JXULJHQ/HN\WKRVVRQVWŠEHUZLHJHQGLQWDNW u Provenienz: Aus der westdeutschen Privatsammlung H.W. &ROOHFWLRQRIVPDOOYDVHVIURP$WKHQVDQG0DJQD*UDHFLDWKUGFHQWXU\ %&,QFODUHG}JXUHVTDXWOHN\WKRVZLWKKDUHNDQWKDURVRIWKH;HQRQZDUH $SXOLDQEODFNJOD]HGVN\SKRV(WUXVFDQWUHHIRLOHMXJRIWKH0DODFHQDZDUH WZREODFNJOD]HGNRWKDDQGEODFNJOD]HGEHOOLHGMXJVTXDWOHN\WKRVMXJZLWK EHDNHG VSRXW 6SOLQWHU RI WKH VXUIDFH RI WKH UHG}JXUH OHN\WKRV DUH PLVVLQJ otherwise mostly intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

348

746 .OHLQH 6DPPOXQJ YRQ *ODQ]WRQNHUDPLN D  )ODFKH /HNDQH PLW zwei breiten, geschwungenen Henkeln aus schwarzem Glanzton. $WWLVFK-KY&KU+FPkFP+HQNHOVLQGDQJHVHW]W OHLFKWH $EVSOLWWHUXQJ E  *URgH HLQKHQNOLJH %DXFK/HN\WKRV PLW EUHLWHU ~DFKHQ /LSSH DXV VFKZDU]HP *ODQ]WRQ 0DJQD Graecia, 4. Jh. v. Chr. H 21,5cm. Kleine Absplitterungen, am +DOVDP+HQNHODQVDW]JHEURFKHQXQGJHNOHEWF .OHLQH%DXFK /HN\WKRV PLW EUHLWHU JHVFKZXQJHQHU /LSSH DXV VFKZDU]HP *ODQ]WRQ 0DJQD *UDHFLD  -K Y &KU + FP 6WŠFN GHU /LSSH IHKOW +HQNHO JHEURFKHQ XQG JHNOHEW VRQVW LQWDNW G  .OHLQH JHGUXQJHQH %DXFK/HN\WKRV PLW ODQJHP +DOV DXV schwarzem Glanzton. Magna Graecia. 4. Jh. v. Chr. H 14,9 cm. Absplitterungen, teilweise Abbrieb des Glanztons, sonst intakt. e) Kleines Schnabelkännchen mit schmalem, langem $XVJXVV JURgHU Â?IIQXQJ XQG KRKHP +HQNHO DXV URWEUDXQHP 7RQ0DJQD*UDHFLD-KY&KU+FP6WŠFNGHU/LSSH gebrochen, liegt bei. f) Chous mit dreiblättrigen MĂźndung und schmalem Henkel aus schwarzem Glanzton. Magna Graecia, 4. Jh. v. Chr. H 10cm. Intakt. 6WŠFN 750,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO 6PDOOFROOHFWLRQRIEODFNJOD]HGFHUDPLFVD )ODWOHNDQHZLWKWZRFXUYHGKDQG OHV$WWLFWKFHQWXU\%&+DQGOHVDUHUHDVVHPEOHGVOLJKWVSOLWRIIVE %LJ EHOO\OHN\WKRVZLWKRQHKDQGOH0DJQD*UDHFLDWKFHQWXU\%&1HFNLVEUR NHQDQGUHDVVHPEOHGF 6PDOOEHOO\OHN\WKRVZLWKZLGHULP0DJQD*UDHFLD 4th century B.C. Part of the rim is broken, handle is broken and reassembled. G 6PDOOEHOO\OHN\WKRVZLWKORQJQHFN0DJQD*UDHFLDWKFHQWXU\%&)LQH VSOLWRIIVRWKHUZLVHLQWDFWH 6PDOOEHDNVSRXWHGMXJZLWKDKLJKKDQGOHPDGH RIEURZQFOD\0DJQD*UDHFLDWKFHQWXU\%&3DUWRIWKHULPLVEURNHQDQG HQFORVHGI &KRXVZLWKVOLPKDQGOH0DJQD*UDHFLDWKFHQWXU\%&,QWDFW SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

747 .OHLQH 6DPPOXQJ *ODQ]WRQNHUDPLN DXV GHU 0DJQD *UDHFLD 2. +Â&#x201D;OIWH-KY&KUD .OHLQHU.DQWKDURVGHU;HQRQ:DUHPLW Eierstab und Flechtband. H 4,4cm. Teile des Randes fehlen. b) Kothon. H 9,4cm. Kleine Abplatzungen des Glanztons. c) 'UHLHLQKHQNHOLJH1Â&#x201D;SIFKHQ/FP7HLOZHLVHHWZDV EHULHEHQG 'HFNHOHLQHU/HNDQLVkFP:LQ]LJH$EVSOLQ terungen am Rand. 6WŠFN 250,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV &ROOHFWLRQRIEODFNJOD]HGSRWWHU\IURPWKH0DJQD*UDHFLDQGKDOIWKFHQ WXU\%&,QFODVPDOONDQWKDURVRIWKH;HQRQZDUH SDUWVRIWKHULPDUHPLV VLQJ DNRWKRQ VXUIDFHSDUWLDOO\UXEEHGRII WKUHHRQHKDQGOHFXSV SDUWLDOO\ VOLJKWO\UXEEHG DQGWKHOLGRIDOHNDQLV WLQ\VSOLQWHUVRIWKHULPDUHPLVVLQJ  SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851


748 6DPPOXQJ JULHFKLVFKHU *ODQ]WRQNHUDPLN    -K Y &KU =ZHL .RWKRQH PLW HLQHP +HQNHO + FP FP %HLGH DP Rand fragmentiert, z.T. Abrieb des Glanztons, sonst intakt. Ein Skyphos mit einem waagerechten und einem senkrechten Henkel. H 7cm, Ă&#x2DC; 8cm. Aus BruchstĂźcken zusammengesetzt. Ein Schalenskyphos mit zwei schmalen, waagerechten Henkeln und im Inneren gestempelte Palmetten. H 5cm, Ă&#x2DC; 10cm. Standring und Boden gebrochen und geklebt. Eine Schale in GHU )RUP & PLW DEJHVHW]WHP 5DQG HLQHP EUHLWHQ )Xg XQG zwei geschwungenen Henkeln. H 9cm, Ă&#x2DC; 17cm. Abrieb und Absplitterung des Glanztons im Inneren und an der Unterseite GHV6WDQGIXgHVVRQVWLQWDNW(LQ7HOOHUPLW5LQJIXg+FPk FP*HEURFKHQXQGJHNOHEW(LQHIXgORVH6FKDOHPLWUXQGHQ +HQNHOQ+FPkFP,QWDNW(LQHIXgORVH6FKDOHPLW eckigen Henkeln. H 5cm, Ă&#x2DC; 12,5cm. Gebrochen und geklebt. 1HXQKHQNHOORVH6FKDOHQ9HUVFKLHGHQH*U¤gHQkFP z.T. Abrieb des Glanztons, am Rand gebrochen, sonst intakt.  6WŠFN 600,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO &ROOHFWLRQRI*UHHNEODFNJOD]HGFHUDPLFVWKWKFHQWXU\%&7ZRNR thons with one handle. Both slightly fragmented at the rim, otherwise intact. One skyphos with one horizontal and one vertical handle. Reassembled from fragments. One skyphos with two slim handles and inside stamped palmettes. %RWWRPEURNHQDQGUHDVVHPEOHG2QHERZOLQIRUP&ZLWKRIIVHWULPZLGH foot and two handles. Intact. One plate with foot. Broken and reassembled. One bowl with round handles. Intact. One bowl with angular handles. Broken and reassembled. Nine bowls without handles in different sizes. Partly fractu red, otherwise intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

749 9LHU IUŠKHWUXVNLVFKH *HIÂ&#x201D;gH D  *URgH NXJHOLJH 2OOD PLW NRQLVFKHP )Xg XQG DXVNUDJHQGHP 5DQG ,PSDVWR 0LWWH 7. Jh. v. Chr. H 25cm. Feine Absplitterung, sonst intakt. b) *URgH)XgVFKDOHPLWHLQJH]RJHQHU6FKXOWHUXQGVWHLOHP5DQG ,PSDVWR 0LWWH  -K Y &KU + FP k FP /HLFKWH $EODJHUXQJHQXQGNOHLQH$XVEUŠFKHDP5DQGXQGDP6WDQGIXg c) Henkellose, bikonische Schale mit einwärts geknicktem 5DQG XQG DXVVFKZLQJHQGHP )Xg ,PSDVWR 0LWWH  -K Y Chr. H 7cm, Ă&#x2DC; 12,5cm. Aus Scherben zusammengesetzt und JHNOHEW6WDQGIXgJHEURFKHQG +HQNHOORVHELNRQLVFKH6FKDOH PLW HLQZÂ&#x201D;UWV JHNQLFNWHP 5DQG XQG DXVVFKZLQJHQGHP )Xg Impasto. Mitte 7. Jh. v. Chr. H 7cm, Ă&#x2DC; 12,5cm. Aus Scherben ]XVDPPHQJHVHW]WXQGJHNOHEWXQJOHLFKPÂ&#x201D;gLJH)RUP6WŠFN 750,â&#x20AC;&#x201C;

750 'DXQLVFKH2OOD6XEJHRPHWULVFK,,,%Y&KU.XJH OLJHV*HIÂ&#x201D;gPLW7ULFKWHUPŠQGXQJ]ZHL%ŠJHOKHQNHOQXQG]ZHL Tierprotomen. H 28,2cm, Ă&#x2DC; 26,7cm. Beiger Ton mit dunkel brauner Bemalung. Vier Fragmente der MĂźndung gebrochen und wieder angesetzt, dabei winzige Abplatzungen am Rand. 250,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV 'DXQLDQROODPDGHRIEHLJHFOD\ZLWKGDUNEURZQSDLQWLQJ6XEJHRPHWULF,,,% %&)RXUIUDJPHQWVRIWKHPRXWKDUHEURNHQDQGUHDWWDFKHGIHZ tiny splinters of the rim are missing. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

751 'DXQLVFKHU 9RJHODVNRV 6XEJHRPHWULVFK ,,,%    Y &KU .XJHOLJHV *HIÂ&#x201D;g LQ VWLOLVLHUWHU 9RJHOIRUP PLW KRKHP $XVJXVV XQG %ŠJHOKHQNHO + FP / FP %HLJHU 7RQ mit dunkelbrauner Bemalung. Winzige Absplitterungen an der MĂźndung, sonst intakt. 200,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ+''1RUGUKHLQ:HVWIDOHQHUZRUEHQ]ZLVFKHQ ELVDXVGHU6DPPOXQJ-RVHI:LQWHU 'DXQLDQELUGDVNRVPDGHRIEHLJHFOD\ZLWKGDUNEURZQSDLQWLQJ6XEJHRPHWULF ,,,%    %& 7LQ\ VSOLQWHUV RI WKH PRXWK DUH PLVVLQJ RWKHUZLVH intact. 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

752 =ZHL GDXQLVFKH 9DVHQ a) Olla. Hellbrauer Ton mit brauner %HPDOXQJ 6XEJHRPHWULVFK ,,%    Y &KU + FP Ă&#x2DC; 21,6cm. Sprung im KĂśrper, dabei ein Fragment gebrochen und wieder angesetzt. b) Kyathos. Hellbrauner Ton mit dun NHOEUDXQHU%HPDOXQJ6XEJHRPHWULVFK,,$Y&KU +FPkFP.OHLQH$EVSOLWWHUXQJHQDP5DQGNOHLQH Farbretusche an der Innenseite des Henkels. 6WŠFN 500,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV 7ZR'DXQLDQYDVHV6XEJHRPHWULF,,%&D 2OOD%ULJKWEURZQ clay with brown painting. One crack, one fragment at this area is broken and UHDWWDFKHG E  .\DWKRV %LUJKW EURZQ FOD\ ZLWK GDUN EURZQ SDLQWLQJ /LWWOH splinters of the mouth are missing, little repainted spots at the inside of the handle. SLHFHV

Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

)RXU HDUO\ (WUXVFDQ FHUDPLFV D  %LJ VSKHULFDO 2OOD ZLWK FRQLFDO IRRW DQG ZLGHULP,PSDVWR0LGGOHRIWKHWKFHQWXU\%&)LQHVSOLWRIIVRWKHUZLVH LQWDFW E  %LJ FRQLFDO ERZO ZLWK GLVWLQFW VWHHS ULP ,PSDVWR 0LGGOH RI WKH WKFHQWXU\%&/LJKWVHGLPHQWVPDOOEUHDNDJHDWWKHULPDQGWKHIRRWF  6PDOO ELFRQLFDO ERZO ZLWKRXW KDQGOHV ,PSDVWR 0LGGOH RI WKH WK FHQWXU\ %&5HDVVHPEOHGIURPIUDJPHQWVDQGEURNHQIRRWG 6PDOOELFRQLFDOERZO ZLWKRXWKDQGOHV,PSDVWR0LGGOHRIWKHWKFHQWXU\%&5HDVVHPEOHGIURP fragments, uneven form. SLHFHV

 6WÂ&#x201D;QGHUMagna Graecia, 2. Hälfte 4. Jh. v. Chr. H 12,7cm. Hell brauner Ton mit beiger Engobe und rotbrauner Bemalung in Form von Mäandern, gegenständigen Dreiecken und Zungen friesen. Oben und unten je eine kleine Abplatzung. 250,â&#x20AC;&#x201C;

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

6WDQGPDGHRIEULJKWEURZQFOD\ZLWKEHLJHVOLSDQGUHGEURZQSDLQWLQJ0DJQD *UDHFLDQGKDOIWKFHQWXU\%&7ZROLWWOHVSOLQWHUVDUHPLVVLQJ

3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

349


754 6DPPOXQJ 9DVHQ DXV GHU 0DJQD *UDHFLD    -K Y &KU D  'DXQLVFKH .DQQH PLW /LQLHQGHNRU + FP Erworben im 2NWREHU b) Einhenkeliger Becher aus rotem Ton. H 7,2cm. (UZRUEHQLP$XJXVW c) Einhenkeliger Napf mit Glanzton. /FPErworben im August 1994 aus der Sammlung Winkels, Essen. G H 7HOOHUPLWQLHGULJHP)XgGHU*ODQ]WRQZDUHPLW 6WHPSHOGHNRUkFPErworben im September 1990 aus der 6DPPOXQJ'U6WRO]7LHU6WŠFN Teilweise leicht berieben, sonst ŠEHUZLHJHQGLQWDNW 400,â&#x20AC;&#x201C; Provenienz: Aus der westdeutschen Privatsammlung H.W. &ROOHFWLRQRIVPDOOYDVHVIURP0DJQD*UDHFLDWKUGFHQWXU\%&,QFO D 'DXQLDQ RQHKDQGOHG MXJ ZLWK OLQHGHFRU RQHKDQGOHG FXS PDGH RI UHG WHUUDFRWWDRQHKDQGOHGERZOZLWKEODFNJOD]HDQGDGLVKRIWKHEODFNJOD]HG ware with stemped decor. Surface partially slightly rubbed off, otherwise most ly intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

755 6DPPOXQJPHVVDSLVFKHU9DVHQ-KY&KUDG 0HVVD SLVFKD *ORFNHQNUDWHUPLWDXVODGHQGHU/LSSHXQGJHVFKZXQJH QHP6WDQGIXgURWEUDXQH%HPDOXQJLQ)RUPYRQZDDJHUHFKWHQ breiten und schmalen Bändern und einem umlaufenden Oliven zweigornament. H 20 cm, Ă&#x2DC; 17cm. Teilweise schwarz gebrannt. Partielle Ablagerungen, am Rand gebrochen und geklebt. Etwa +Â&#x201D;OIWH GHV )XgHV LVW PRGHUQ HUJÂ&#x201D;Q]W E  .RORQHWWHQNUDWHU PLW brauner Bemalung in Form von breiten und schmalen Bändern XQGHLQHP/RWXVEOŠWHQRUQDPHQWDP+DOV+FPkFP (WZD+Â&#x201D;OIWHGHV)XgHVLVWPRGHUQHUJÂ&#x201D;Q]WF .DQQHPLWEDX chigem Corpus und einem breiten Bandhenkel, sowie mit roter Bemalung und Streifendekor. H 19cm. Am Rand gebrochen, sonst intakt. d) Mit konzentrischen Kreisen und Punkten bemal WHU7HOOHUDXIKRKHP)Xg+FPkFP5RWH%HPDOXQJ WHLOZHLVHVFKZDU]JHEUDQQW)XgJHEURFKHQXQGJHNOHEWH )DOLV NLVFK)XgVFKDOHGHU*HQXFLOOD*UXSSH5RWEUDXQH%HPDOXQJ in Form eines Kreuzes, ein Punkt in dessen Mitte, in den Fel GHUQGUHL3XQNWHDXgHQIŠQIZHOOHQI¤UPLJH+DNHQ+FPk *HEURFKHQHU6WDQGIXg6WŠFN 1.000,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO &ROOHFWLRQRI0HVVDSLDQFHUDPLFVWKUGFHQWXU\%&D %HOONUDWHUGH corated with brown and red painted bands and an olive branch ornament running around the centre of the body with a black pedestal base and out WXUQHGOLS%URNHQDQGUHDVVHPEOHGDWWKHULP0RGHUQDGGLWLRQDWWKHIRRW E &ROXPQNUDWHUGHFRUDWHGZLWKEURZQSDLQWHGEDQGVDQGDORWXVRUQDPHQW DWWKHQHFN0RGHUQDGGLWLRQDWWKHIRRWF 6LQJOHKDQGOHMXJZLWKUHGSDLQWHG EDQGV%URNHQDWWKHULPRWKHUZLVHLQWDFWG 3ODWHZLWKDKLJKIRRWSDLQWHG ZLWKFRQFHQWULFFLUFOHVDQGGRWV)RRWEURNHQDQGUHDVVHPEOHGH )DOLVFDQ %RZORQDIRRWRIWKH*HQXFLOODJURXS5HGDQGEURZQSDLQWHGZLWKDFURVV and dots, surrounded by a wavelike ornament. Broken foot. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

350

756 6FK¤QH 6DPPOXQJ DQWLNHU *HEUDXFKVNHUDPLN D  .OHHEODWW Oinochoe mit gedrungenem Korpus und hohem Henkel, rote, streifenfĂśrmige Bemalung. Etruskisch, 6. Jh. v. Chr. Heller Ton. H 16,5 cm. MĂźndung gebrochen und geklebt, sonst intakt. b) /DJ\QRV PLW KRKHP +DOV XQG EUHLWHU JHNQLFNWHQ %DXFKXQJ +HOOHQLVWLVFK    -K Y &KU + FP +HQNHO XQG +DOV gebrochen und geklebt. c) Weithalsige Kanne mit breiter, schräger /LSSHXQGEDXFKLJHP.RUSXV7\S1LHGHUELHEHU5¤PLVFK +-KQ&KU+HOOHU7RQ+FP,QWDNWG 'UHLKRKH ovale Becher, die sich nach unten verjĂźngen. Mit ausgestellter, VFKUÂ&#x201D;JHQ 0ŠQGXQJ 5¤PLVFK  -K Y &KU   -K Q &KU 5¤WOLFK JUDXEHLJHU 7RQ +   FP k   FP ,QWDNW e) RĂśmischer Deckel aus hellem Ton, Ă&#x2DC; 9,5 cm. f) RĂśmische Reibschale aus hellem Ton, Ă&#x2DC; 24 cm. g) Hellenistischer Becher DXVU¤WOLFKHP7RQ-KY&KU+FPkFP.OHLQHU %UXFKDP5DQGK .OHLQHVHOOLSVHQI¤UPLJHV.RVPHWLNJHIÂ&#x201D;gPLW DXVJHVWHOOWHU /LSSH NOHLQHU 0ŠQGXQJ XQG VSLW] ]XODXIHQGHP )Xg/HYDQWHRGHU1RUGDIULND-WY&KU$P5DQGJHEURFKHQ und geklebt, sonst intakt. i) Tonlampe mit abgerundeter Schulter und langer Schnauze. j) Erhabener, weiblicher Kopf auf Spiegel. %URQHHU 7\S )UŠKE\]DQWLQLVFK    -K Q &KU / FP Henkel gebrochen. 6WŠFN 1.000,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO Nice collection of ancient utilitarian pottery. Oinochoe with trefoil spout ZLWK KLJK KDQGOH UHG SDLQWHG VWULSV (WUXVFDQ WK FHQWXU\ %& /LJKW FOD\ Spout broken and reassembled, otherwise intact. Lagynos with high neck. +HOOHQLVWLFUGVWFHQWXU\%&+DQGOHDQGQHFNEURNHQDQGUHDVVHPEOHG -XJ ZLWK ZLGH QHFN EURDG OLS DQG EXOERXV FRUSXV 7\SH 1LHGHUELHEHU  5RPDQ QG + UG FHQWXU\ $' /LJKW FOD\ ,QWDFW 7KUHH KLJK RYDO FXSV 5RPDQVWFHQWXU\%&VWFHQWXU\$'5HGDQGJUH\FOD\,QWDFW5RPDQ lid made of light clay. Roman mortarium made of light clay. Hellenistic cup PDGHRIUHGFOD\QGVWFHQWXU\%&6PDOOFOLSDWWKHULP6PDOOHOOLSWLFDO cosmetic vessel with pointed foot. Levant or North Africa. 1st millennium B.C. Broken and reassembled at the rim, otherwise intact. Terracotta lamp with a UHOLHIRIDZRPDQyVKHDGRQWKHPLUURU%URQHHU7\SH(DUO\%\]DQWLQHWK WKFHQWXU\$'+DQGOHEURNHQSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

757 =ZHLJULHFKLVFKH.HUDPLNJHIÂ&#x201D;gH+HOOHQLVWLVFK-KY&KU D  8QJXHQWDULXP PLW /LQLHQGHNRU + FP k FP 0LW 6WÂ&#x201D;QGHUE .OHLQH6FKDOHPLW5LOOHQGHNRUXQGKRKHP)Xg+ 5,8cm, Ă&#x2DC; 10,1cm. 6WŠFN Intakt. 200,â&#x20AC;&#x201C; Provenienz: Aus der Sammlung N.R., Oberbayern, erworben in den 1970er -DKUHQLP0ŠQFKQHU.XQVWKDQGHO 7ZR+HOOHQLVWLFSRWWHU\D 8QJXHQWDULXPZLWKSDLQWLQJGHFRULQIRUPRIOLQHV E %RZOZLWKJURRYHGHFRUDQGWDOOIRRW$OOLQWDFWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851


758 7HUUD6LJLOODWD)UDJPHQWHPLW7¤SIHUVWHPSHOProvinz Gallien, 1.   -K Q &KU )UDJPHQWH YRQ 7HUUD 6LJLOODWD 6FKŠVVHOQ XQG 7HOOHUQPLW7¤SIHUVWHPSHOGHU7¤SIHU&$/996 /D*UDXIHVHQ TXH  &(/6,196 ,WWHQZHLOHU  6$&(5 /XELH  &$/9,196 /(179 ,$19$5,96 0$&&21 0$57,$/,6 5KHLQ] DEHUQ  &$/996 0('9/96 9,&725,196 35,',$1 96 ',21,6,96 7$95,1,$1 &5(67,2 /(179/96  6WŠFN 500,â&#x20AC;&#x201C; 3URYHQLHQ](UZRUEHQEHL$[HO:HEHU.¤OQ

762 6FK¤QH6DPPOXQJ7HUUD6LJLOODWD6FKDOHQXQG7HOOHU-K Q&KU1RUGDIULNDQLVFKHXQGJDOOLVFKH:DUHkFP 'DUXQWHU ]ZHL VHKU JURgH 6FKŠVVHOQ XQG HLQH .UDJHQVFKDOH 7HLOZHLVH PLW SUR}OLHUWHP ,QQHUHQ HLQ NOHLQHU 7HOOHU PLW Rädchendekor. 6WŠFN Bis auf eine kleine Absplitterungen an der Kragenschale intakt. 1.000,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ +'' 1RUGUKHLQ:HVWIDOHQ HUZRUEHQ ]ZLVFKHQELV

)UDJPHQWVRISODWHVDQGERZOVZLWKSRWWHUVWDPSV7HUUDVLJLOODWD3URYLQFHRI *DXOVWFHQWXU\UGFHQWXU\$'SLHFHV

1LFHFROOHFWLRQRI7HUUD6LJLOODWDERZOVDQGSODWHV1RUWK$IULFDDQG*DOOLD QG  WK FHQWXU\ $' /LWWOH VSOLQWHUV RI RQH ERZO DUH PLVVLQJ RWKHUZLVH intact. SLHFHV

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

759 7HUUD6LJLOODWD)UDJPHQWHPLW7¤SIHUVWHPSHOProvinz Gallien, 1.   -K Q &KU )UDJPHQWH YRQ 7HUUD 6LJLOODWD 6FKŠVVHOQ XQG 7HOOHUQ PLW 7¤SIHUVWHPSHO GHU 7¤SIHU &$/996 /D *UDXIH VHQTXH  &(1625,196 ,WWHQZHLOHU  0$57,$/,6 5KHLQ zabern), PRIMVS (Montans), SECVNDANVS (Rheinzabern), )5217,196 $0$%,/,6 &$5$1796 0$79$&96 )(6796 /H]RX[  0$&&$596 /D *UDXIHVHQTXH  $0$ %,/,6 59),196 '$*20$ 0(&&2 48,1796 /D *UDXIHVHQTXH 6WŠFN 500,â&#x20AC;&#x201C;

 *URgHU )DOWHQEHFKHU RĂśmische Kaiserzeit, ca. 2. Jh. n. Chr. H 18,7cm, Ă&#x2DC; 15,2cm. Glanztonware mit Griesbewurf. 0LW 6FKUHLEHQ YRQ $OWH .XQVW  *UD}N 1LFROH 'HJHU 0DLQ] YRQ  .RSLH $XVJURgHQ)UDJPHQWHQ]XVDPPHQJHVHW]WGDEHL NOHLQH5HWXVFKHQDQGHQ%UXFKNDQWHQ u

3URYHQLHQ]([$[HO:HEHU.¤OQ )UDJPHQWVRISODWHVDQGERZOVZLWKSRWWHUVWDPSV7HUUDVLJLOODWD3URYLQFHRI *DXOVWFHQWXU\UGFHQWXU\$'SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

760 7HUUD 6LJLOODWD%LOGVFKHUEHQ 3URYLQ] *DOOLHQ    -K Q Chr. Fragmente von Terra Sigillata SchĂźsseln und Tellern mit verschiedenen Motiven und Ornamenten. 6WŠFN 450,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ5%6ŠGGHXWVFKODQGVHLWGHQHU-DKUHQ )UDJPHQWVRISODWHVDQGERZOVZLWKLPDJHVDQGRUQDPHQWV7HUUDVLJLOODWD 3URYLQFHRI*DXOVWFHQWXU\UGFHQWXU\$'SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

761 6DPPOXQJ 7HUUD 6LJLOODWD6FKDOHQ 5¤PLVFKH .DLVHU]HLW   -KQ&KU7HOOHUXQG6FKDOHQWHLOZHLVHPLW5Â&#x201D;GFKHQRGHU 6WHPSHOGHNRU k   FP  6WŠFN Eine kleine Restau rierung gebrochener Fragmente, wenige kleine Absplitterungen, sonst Ăźberwiegend intakt. 500,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ erworben aus dem Nachlass eines Zahnarztes. &ROOHFWLRQRI7HUUD6LJLOODWDSODWHVDQGERZOV5RPDQ,PSHULDO3HULRGVW WKFHQWXU\$'3DUWLDOO\ZLWKRUQDPHQWDOGHFRU/LWWOHIUDJPHQWVRIRQHERZO are broken and reattached, little splinters at few pieces are missing, otherwise mostly intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ +*5KHLQODQG3IDO]HUZRUEHQFDEHL$OWH.XQVW *UD}N1LFROH 'HJHU0DLQ] /DUJH EODFNJOD]HG IROGHG EHDNHU 5RPDQ DERXW QG FHQWXU\ $' Reassembled from large fragments, little retouchings at the cracks. :LWKOHWWHU IURP$OWH.XQVW *UD}N1LFROH'HJHU0DLQ]GDWHG FRS\  9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

764 .OHLQH6DPPOXQJU¤PLVFKHU7HUUD1LJUD.HUDPLN-KQ Chr. a) Kaminformbecher mit Rädchendekor. H 15cm. Aus Scherben zusammengesetzt, kleine Absplitterungen an den Bruchkanten, sonst vollständig. b) Kleiner Steilwandbecher mit Rädchendekor. H 9,9cm. Intakt. c) Tiefe, leicht konische Schale PLWSUR}OLHUWHP5DQG+FPkFP.OHLQH$EVSOLWWHUXQJ DP )Xg 2EHU~Â&#x201D;FKH HWZDV EHVWRgHQ G  %DXFKLJHU %HFKHU PLW ausschwingendem Rand. H 6 cm. Mit Griesbewurf. 6WŠFN u 3URYHQLHQ]([$:HEHU.¤OQ

6PDOO FROOHFWLRQ RI 5RPDQ WHUUD QLJUD FHUDPLFV VW  QG FHQWXU\ $' D  Beaker with scrolled decor. Reassembled from fragments, tiny splinters at the FUDFNVDUHPLVVLQJRWKHUZLVHFRPSOHWHE 6PDOOEHDNHUZLWKVFUROOHGGHFRU ,QWDFWF &RQLFDOERZO/LWWOHVSOLQWHUVRIWKHIRRWDQGWLQ\~DNHVRIWKHEODFN JOD]HDUHPLVVLQJG 6PDOOFXSZLWKJULWSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

765 6DPPOXQJ U¤PLVFKHU .HUDPLN Darunter zwei einhenklige, bauchige Kannen, ein Unguentarium, ein kleiner Becher, eine kleine Schale, dazu eine Terrakotta in Form einer Cucumis mit ZHLgHU(QJREH6WŠFN Teilweise fragmentiert und gebrochen. 250,â&#x20AC;&#x201C; 3URYHQLHQ]([6DPPOXQJ3LVFDWRU;DQWHQ

Collection of Roman pottery. Two jugs with one handle, one small mug, one small bowl, one unguentarium and one terracotta in form of a cucumis. Partly fragmented. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

351


766 6FK¤QH 6DPPOXQJ *HEUDXFKVNHUDPLN a) Zylindrische Flasche PLWHLQHPEUHLWHQNDQQHOLHUWHQ%DQGKHQNHO5¤PLVFK-K Q&KU5¤WOLFKHU7RQPLW6SXUHQYRQZHLgHU(QJREH+ Intakt. b) Bauchige Henkelkanne mit langem, zylindrischem +DOVXQGDXVJHSUÂ&#x201D;JWHUUXQGHQ/LSSH+HQNHOLVWNDQQHOLHUWXQG läuft nach oben spitz zu. RĂśmisch, 1. Jh. n. Chr. Heller Ton. + FP /HLFKWH $EVSOLWWHUXQJHQ VRQVW LQWDNW F  %DXFKLJH +HQNHONDQQHPLW.OHHEODWW¤IIQXQJ5¤PLVFK-KQ&KU Heller Ton. H 22,5cm. Intakt. d) Schrägwandschale mit gerun GHWHP%RGHQXQGDEJHVHW]WHUQDFKDXgHQJHERJHQHU/LSSHPLW 6SXUHQ YRQ ZHLgHU (QJREH 'DEHL HLQ QDFK REHQ JHERJHQHU Deckel mit Knopfgriff. RĂśmisch, 1. Jh. n. Chr. Roter Ton. H 8 cm, Ă&#x2DC; 17,5cm (Schale), 17,2cm (Deckel). Intakt. e) Konische Schale mit geschwungenem Rand. Germanisch, 4. Jh. n. Chr. Grauer Ton. H 8,2cm, Ă&#x2DC; 16cm. Gebrochen, gelebt und modern ergänzt. f) Einhenklige Tasse. Ă&#x2013;stlicher Mittelmeerraum, 1. H. 1. Jt. v. Chr. Roter Ton. Ă&#x2DC; 9,7cm. Intakt. Halbkugelige Schale vom Niederrhein. Bronzezeitlich. H 9,5cm, Ă&#x2DC; 17,5cm. Zusammen gesetzt, modern ergänzt. g) Mittelalterlicher Dellenbecher mit Glasur. Mitteldeutschland. H 7,5cm, Ă&#x2DC; 12 cm. Gebrochen und geklebt. h) Mittelalterlicher Becher mit Rillen aus hellem Ton. +FP,QWDNWL %HFKHUPLW5LQJIXgDXVURWHP7RQ%URQ zezeitlich. H 11 cm. Kleiner Bruch am Rand. j) Zwei Deckel aus rotem und grauem Ton. Ă&#x2DC; 11cm und 10cm. Intakt. 6WŠFN 750,â&#x20AC;&#x201C; 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ Nice collection of utilitarian pottery. Cylindrical bottle with one handle. 5RPDQUGWKFHQWXU\$'5HGFOD\ZLWKWUDFHVRIZKLWHHQJREH,QWDFW -XJZLWKORQJF\OLQGULFDOQHFNDQGURXQGOLS5RPDQVWFHQWXU\$'/LJKW FOD\ 6OLJKW VSOLWRIIV RWKHUZLVH LQWDFW 7UHIRLO MXJ 5RPDQ VW  QG FHQWX U\ $' /LJKW FOD\ ,QWDFW 6ODQWVLGHG ERZO ZLWK D OLG 5RPDQ VW FHQWXU\ $'5HGFOD\ZLWKWUDFHVRIZKLWHHQJREH,QWDFW&RQLFDOERZO*HUPDQLF WK FHQWXU\ $' *UH\ FOD\ %URNHQ DQG UHDVVHPEOHG PRGHUQ DGGLWLRQ 2QHKDQGOHGFXS(DVWHUQ0HGLWHUUDQHDQVWKDOIVWPLOOHQQLXP5HGFOD\ Intact. Hemispherical bowl from the Lower Rhine. Bronze Age. Broken and UHDVVHPEOHGPRGHUQDGGLWLRQV0HGLHYDOFXSZLWKJOD]H0LGGOH*HUPDQ\ %URNHQDQGUHDVVHPEOHG0HGLHYDOFXSZLWKJURRYHVPDGHRIOLJKWFOD\,QWDFW Cup made of red clay. Bronze Age. Small clip at the rim. Two lids made of red and grey clay. Intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

767 6DPPOXQJ U¤PLVFKH *HEDXFKV XQG )HLQNHUDPLN Kaiserzeit, 1. -KQ&KU,QNOXVLYHHLQXQG]ZHLKHQNHOLJHU.DQQHQXQG Flaschen, Schalen und Bechern, einem Unguentarium, Minia WXUJHIÂ&#x201D;gHQ XQG HLQHP JURgHQ KHQNHOORVHQ 7RSI VRZLH GUHLHU Deckel. Teilweise mit Rillendekor, eine Flasche mit formgetĂśp ferten Henkeln, auf denen Zweige dargestellt sind, drei StĂźcke PLW%HPDOXQJLQ)RUPYRQGXQNOHQ/LQLHQ+HUYRU]XKHEHQLVW u.a. ein Skyphos mit Daumenrast und seitlichen Voluten. H bis 19,6cm, Ă&#x2DC; bis 17,4cm. 6WŠFN Wenige gebrochene und wie der angesetzte Fragmente, wenige kleine Absplitterungen oder Fehlstellen, sonst Ăźberwiegend intakt. 1.000,â&#x20AC;&#x201C; 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ erworben aus dem Nachlass eines Zahnarztes. &ROOHFWLRQ RI 5RPDQ SRWWHU\ ,PSHULDO 3HULRG VW  WK FHQWXU\ $' ,QFO RQHDQGWZRKDQGOHGMXJVDQGERWWOHVERZOVDQGPXJVRQHXQJXHQWDULXP one large pot, and also three lids. Partially with grooved decor, one bottle with moulded formed handles depicting branches, three pieces with painting

352

LQIRUPRIGDUNOLQHV1RWDEO\LVHJDVN\SKRVZLWK}QHGHFRUDWHGKDQGOHV )HZIUDJPHQWVDUHEURNHQDQGUHDWWDFKHGIHZOLWWOHVSOLQWHUVDQGIUDJPHQWV are missing, otherwise mostly intact. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

768 9LHUU¤PLVFKH7UDQVSRUWDPSKRUHQa) Typ Dressel 1 C fĂźr Wein. +-K(QGH-KY&KU%UDXQHU7RQ+FPPLW 6WÂ&#x201D;QGHUFP+DOVXEHLGH+HQNHOIHKOHQ)XgVSLW]HDEJHEUR chen, sonst intakt, mit Meeresbewuschs. 0LW6WÂ&#x201D;QGHU b) Typ .RULQWK%IŠU:HLQ(QGH-K-KY&KU+HOOEUDXQHU7RQ +FPPLW6WÂ&#x201D;QGHUFP/¤FKHU+DOVXQG+HQNHOSDUWLH intakt, teilweise mit Meeresbewuchs. 0LW6WÂ&#x201D;QGHU c) Ampho renfragment von Hals u. Henkeln. Typ Dressel 1 A fĂźr Wein. 2. +-K(QGH-KY&KU%UDXQHU7RQ+FP0LW0HH resbewuchs. d) Amphorenfragment von Hals u. Henkeln. Typ 'UHVVHOIŠU:HLQ+-KY&KU(QGH-KQ&KU Hellbrauner Ton. H 26 cm. Mit Meeresbewuchs. 6WŠFN 750,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ 0/ 0ŠQFKHQ HUZRUEHQ LQ GHQ HU ELV HU-DKUHQ &ROOHFWLRQRI$QFLHQWWUDQVSRUWDPSKRUDHD 7\SH'UHVVHO&IRUZLQH1HFN DQGKDQGOHVDUHPLVVLQJWRSRIWKHIRRWLVEURNHQRWKHUZLVHLQWDFWZLWKVHD encrustations. :LWKVWDQGE 7\SH&RULQWK%IRUZLQH:LWKKROHVLQWKHEHO O\QHFNDQGKDQGOHVLQWDFWZLWKVHDHQFUXVWDWLRQV:LWKVWDQGF )UDJPHQW RIQHFNDQGKDQGOHV7\SH'UHVVHO$IRUZLQH:LWKVHDHQFUXVWDWLRQVG  )UDJPHQWRIQHFNDQGKDQGOHV7\SH'UHVVHOIRUZLQH:LWKVHDHQFUXVWD tions. SLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851

769 9LHUU¤PLVFKH7UDQVSRUWDPSKRUHQa) Typ Dressel 1 C fĂźr Wein. +-K(QGH-KY&KU5RWEUDXQHU7RQ+FP%HL de Henkel fehlen, sonst intakt, z. T. mit Meeresbewuchs. b) Typ 3\$IŠU:HLQ-KY&KU%UDXQHU7RQ+FP FP PLW 6WÂ&#x201D;QGHU *URgH 7HLOH GHU 9DVHQZDQG IHKOHQ +DOV X Henkelpartie intakt, z. T. mit Meeresbewuchs. 0LW6WÂ&#x201D;QGHU c) $PSKRUHQIUDJPHQWYRQ+DOVX+HQNHOQ7\S'UHVVHOIŠU :HLQ+-KY&KU(QGH-KQ&KU*HOEEUDXQHU7RQ +FP0LW0HHUHVEHZXFKVG $PSKRUHQIUDJPHQWYRQ+DOV u. einem Henkel. H 28 cm. Mit Meeresbewuchs. 6WŠFN 750,â&#x20AC;&#x201C; 3URYHQLHQ] ([ 6DPPOXQJ 0/ 0ŠQFKHQ HUZRUEHQ LQ GHQ HU ELV HU-DKUHQ &ROOHFWLRQ RI $QFLHQW WUDQVSRUW DPSKRUDH  D  7\SH 'UHVVHO  & IRU ZLQH %RWKKDQGOHVDUHPLVVLQJRWKHUZLVHLQWDFWZLWKVHDHQFUXVWDWLRQVE 7\SH3\ 4 A for wine. Big parts of the belly are missing, neck and handles are intact ZLWKVHDHQFUXVWDWLRQV:LWKVWDQGF )UDJPHQWRIQHFNDQGKDQGOHV7\SH 'UHVVHOIRUZLQH:LWKVHDHQFUXVWDWLRQVG )UDJPHQWRIQHFNDQGRQH KDQGOH:LWKVHDHQFUXVWDWLRQVSLHFHV 9(5.$8)7:,(%(6(+(1.(,1(5Â?&.*$%(62/'$69,(:(' 125(7851


770 Sechs rĂśmische Transportamphoren. a) Typ Almagro 51 C fĂźr *DUXP-K+-KQ&KU5RWEUDXQHU7RQ+FP PLW 6WÂ&#x201D;QGHU  FP +HQNHO IHKOHQ )XgVSLW]H X %DXFK LQWDNW 6SXUHQ YRQ 0HHUHVEHZXFKV Mit Ständer!  E  $PSKRUHQIUDJ PHQWGHUXQWHUHQ%DXFKSDUWLH%UDXQHU7RQ+FPFP PLW6WÂ&#x201D;QGHU0LW0HHUHVEHZXFKVMit Ständer! F $PSKRUHQ IUDJPHQWYRP7\S'UHVVHOIŠU2OLYHQ¤O+-K(QGH -KQ&KU%UDXQHU7RQ+FP%RGHQIHKOW+DOVX+HQNHO LQWDNW]7JHNOHEWVWDUNHU0HHUHVEHZXFKVG $PSKRUHQIUDJ PHQWYRP7\S<DVVLDGD.HD\/;9IŠU:HLQ-K-K Q&KU'XQNHOEUDXQHU7RQ+FP%RGHQX%DXFKIHKOHQ VRQVW LQWDNW ] 7 PLW 0HHUHVEHZXFKV H  $PSKRUHQIUDJPHQW YRP7\S*DOOLFDIŠU:HLQ-KY&KU$QIDQJ-KQ &KU'XQNHOEUDXQHU7RQ+FP%RGHQX7HLOGHU%DXFK ZDQG IHKOHQ VRQVW LQWDNW PLW 0HHUHVEHZXFKV I  $PSKRUHQ IUDJPHQWYRP7\S$JRUÂ&#x2019;*IŠU:HLQ-K-KQ&KU +HOOEUDXQHU7RQ+FP%DXFKX%RGHQIHKOHQVRQVWLQWDNW PLW0HHUHVEHZXFKV6 StĂźck! u Provenienz: Ex Sammlung M.L., MĂźnchen, erworben in den 1950er bis 1960er Jahren. . Collection of Ancient transport amphorae. a) Type Almagro 51 C for garum. +DQGOHVDUHPLVVLQJRWKHUZLVHLQWDFWZLWKVHDHQFUXVWDWLRQVWith stand! b) Fragment of the bottom part. With stand! c) Fragment of type Dressel 20 for olive oil. Bottom is missing, neck and handles are intact, partly glued, with QLFHVHDHQFUXVWDWLRQVG )UDJPHQWRIW\SH<DVVLDGD.HD\/;9IRUZLQH Neck and handles are intact, bottom is missing. e) Fragment of type Gallica IRUZLQH%RWWRPDQGSDUWRIWKHEHOO\LVPLVVLQJRWKHUZLVHLQWDFWZLWKVHD LQFUXVWDWLRQVI )UDJPHQWRI7\SH$JRUÂ&#x2019;*IRUZLQH%RWWRPDQGEHOO\LV PLVVLQJRWKHUZLVHLQWDFWZLWKVHDLQFUXVWDWLRQV6 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

771 Vier rĂśmische Transportamphoren u. zwei Bleianker. a) Typ 'UHVVHOIŠU:HLQ+-KY&KU(QGH-KQ&KU 5RWEUDXQHU7RQ+FPPLW6WÂ&#x201D;QGHUFP%RGHQVSLW]HHU KDOWHQ+DOVX+HQNHOIHKOHQVRQVWLQWDNWMit Ständer! E 7\S 'UHVVHO  IŠU *DUXP (QGH  -K Y &KU  (QGH  -K Q &KU+HOOEUDXQHU7RQ+FPPLW6WÂ&#x201D;QGHUFP%RGHQ VSLW]HIHKOWVRQVWLQWDNWPLW0HHUHVEHZXFKVMit Ständer! F  $PSKRUHQIUDJPHQWYRP7\S0DQD$IŠU*DUXP+-K $QIDQJ-KY&KU%UDXQHU7RQ+FP+HQNHOX+DOV LQWDNW%RGHQX%DXFKIHKOHQPLW0HHUHVEHZXFKVG $PSKR UHQIUDJPHQWYRP7\S5KRGHVIŠU:HLQ-K$QIDQJ-K Y&KU%UDXQHU7RQ+FP+HQNHOX+DOVLQWDNW%DXFKX %RGHQIHKOHQH %OHLDQNHUVWRFNPLW0HHUHVEHZXFKV/FP I %OHLDQNHUVWRFNPLW0HHUHVEHZXFKV/FP6 StĂźck! u Provenienz: Ex Sammlung M.L., MĂźnchen, erworben in den 1950er bis 1960er Jahren. &ROOHFWLRQRI$QFLHQWWUDQVSRUWDPSKRUDHD 7\SH'UHVVHOIRUZLQH1HFN and handles are missing, otherwise intact, top of the foot intact. With stand! E 7\SH'UHVVHOIRUJDUXP7RSRIWKHIRRWLVPLVVLQJRWKHUZLVHLQWDFW ZLWK VHDLQFUXVWDWLRQV With stand! c) Fragment of type Mana A for ga UXP%RWWRPDQGEHOO\DUHPLVVLQJRWKHUZLVHLQWDFWZLWKVHDLQFUXVWDWLRQVG  Fragment of type Rhodes for wine. Bottom and belly are missing, otherwise LQWDFWH I 7ZRVWRFNVRI5RPDQDQFKRUV6 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Amphorenfragment mit Stempel. +Â&#x201D;OIWH(QGH-KQ&KU 7\S *DOOLFD  IŠU :HLQ +  FP %UDXQHU 7RQ Ein Henkel weist Stempel RIVP auf.+DOVXQG+HQNHOSDUWLHWHLOZHLVHLQWDNW PLWVFK¤QHP0HHUHVEHZXFKV u Provenienz: Ex Sammlung H. G., Bayern, seit 1960er Jahren. Fragment of transport amphora of type Gallica 5 for wine. 2nd Half 1st FHQWXU\(QGQGFHQWXU\$'2QHKDQGOHVKRZVVWDPS5,931HFNDQG KDQGOHSDUWPDLQO\LQWDFWZLWKQLFHVHDHQFUXVWDWLRQV VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

773 Amphorenhenkel mit Legionsstempel. 5¤PLVFK-KQ&KU /FDFP+HOOURWHU7RQ)UDJPHQWHLQHV$PSKRUHQKHQNHOV PLWGHP6WHPSHO/(9*(0 /HJLR9*HPLQDSLD}GHOLV  )UDJPHQW u Provenienz: Ex Ăśsterreichische Privatsammlung M.S., 1980er Jahre. Â?EHUGLH/HJLRQ9*HPLQDPLWGHU(KUHQEH]HLFKQXQJÂ&#x20AC;SLD}GHOLVyLVWZHQLJ EHNDQQW9HUPXWOLFKZDUVLHHLQH/HJLRQGHUU¤PLVFKHQ$UPHH%LVKHUZXUGHQ QXULQ9LQGRERQD KHXWLJHV:LHQ /HJLRQV]LHJHODXVGHP-DKUQ&KU JHIXQGHQ,Q9LQGRERQDZDUDXFKGLH/HJLR;*HPLQDYRQQ&KUELV ins 5. Jahrhundert stationiert. )UDJPHQWRIDQDPSKRUDKDQGOHZLWKWKHVWDPS/(9*(0 /HJLR9 *HPLQDSLD}GHOLV 5RPDQQGUGFHQWXU\$' VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

e /DPSHPLW]ZHL'HO}QHQ5¤PLVFK+Â&#x201D;OIWH-KQ&KU7\S /RHVFKFNH9,,,PLW+HQNHO+HOOHU7RQPLWEUDXQHPÂ?EHU]XJ / FP $XI GHP 6SLHJHO ]ZHL 'HO}QH $XI GHU 8QWHUVHLWH +HUVWHOOHUPDUNH+DOEPRQGXQG/0$',(&,QWDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLWGHU Ausfuhrgenehmigung der israelischen AntikenbehĂśrde. Bei Gorny & Mosch $XNWLRQ/RVXQG/RV 5RPDQ FOD\ ODPS RI WKH W\SH /RHVFKFNH 9,,, ZLWK KDQGOH /LJKW FOD\ ZLWK EURZQVOLS7KHGLVFXVVKRZVWZRGROSKLQV0RXOGPDUNRQERWWRPZLWK/DWLQ LQVFULSWLRQ5RPDQVWKDOIQGFHQWXU\$',QWDFW VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

775 Tonlampe mit Schäfer. 5¤PLVFK0LWWH-KQ&KU/RHVFKFNH 7\S ,9 6FKXOWHU ,, % 5¤WOLFKHU 7RQ PLW URWHP Â?EHU]XJ / FP $XI GHP 6SLHJHO HLQH PÂ&#x201D;QQOLFKH )LJXU LQ 7XQLND XQG PLW7LHUIHOOQDFKUHFKWVVWHKHQGXQGVLFKDXIHLQ6WDEVWŠW]HQG GDYRU]ZHL=LHJHQXQGHLQJHEHXJWHU%DXP$XIGHU8QWHUVHLWH :HUNVWDWWPDUNH Â?EHU]XJ SDUWLHOO DEJHULHEHQ 6SUŠQJH VRQVW LQWDNW u Provenienz: Bei Gorny & Mosch Auktion 260, 2018, Los 188; ex Sammlung +*5KHLQODQG3IDO] Roman clay lamp depicting a shepherd with two goats and a tree. Roman, mid 1st century A.D. Slip partially rubbed off, small cracks, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

353


 Tonlampe mit Kämpfern. 5¤PLVFK-KQ&KU/RHVFKFNH7\S ,96FKXOWHU,9%5¤WOLFKHU7RQPLWURWEUDXQHPEHU]XJ/ FP$XIGHP6SLHJHO]ZHLQDFNWHN”PSIHQGH0”QQHU}JXUHQ $XI GHU 8QWHUVHLWH :HUNVWDWWPDUNH &&/29& XQG NOHLQHU .UHLV GDUXQWHU EHU]XJ SDUWLHOO DEJHULHEHQ SDUWLHOO G©QQHU %HODJLQWDNW u Provenienz: Bei Gorny & Mosch Auktion 260, 2018, Los 669; ex Sammlung +*5KHLQODQG3IDO] 5RPDQFOD\ODPSGHSLFWLQJWZRQDNHGPHQ}JKWLQJ:RUNVKRSPDUNRQEDVH Roman, 1st century A.D. Slip partially rubbed off, otherwise intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

777 Zwei Tonlampen. 5¤PLVFK  +”OIWH GHV  -K Q &KU   / FP 7\S /RHVFKFNH 9,,, PLW +HQNHO +HOOU¤WOLFKHU 7RQ $XI GHP 6SLHJHO HLQ $GOHU DXI GHU 6FKXOWHU (LHUVWDE *URg WHLOVYHUVLQWHUW+HQNHOPLW)HUWLJXQJVYDULDQWH /FP7\S /RHVFKFNH9,,,PLW+HQNHO+HOOHU7RQPLWURWHPEHU]XJ$XI GHP6SLHJHOYLHU3DOP]ZHLJHNUHX]I¤UPLJDQJHRUGQHW$XIGHU 8QWHUVHLWH,QVFKULIW9HUVLQWHUWLQWDNW2 Stück!  u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV Collection of two Roman clay lamps depicting an eagle and four palm leaves. Roman, 2nd half of 1st century A.D. Traces of sinter, intact. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

e Spätantike Lampe mit Phryger. 1RUGDIULND-KQ&KU/ FP +HOOURWHU 7RQ 7\S +D\HV ,, )ODFKHU %RGHQ ]DSIHQ I¤UPLJHU*ULIIHLI¤UPLJHU&RUSXVXQGJHUXQGHWH6FKQDX]HPLW %UHQQORFK=ZHL(LQI©OOO¤FKHULP6SLHJHO$XIGHP6SLHJHOGLH %©VWHHLQHVMXQJHQ0DQQHVPLWODQJHP+DDUSKU\JLVFKHU0©W ]H XQG 0DQWHO $XI GHU 6FKXOWHU .UHLV 'UHLHFN XQG 5RVHW WHQRUQDPHQWHLP:HFKVHO$XIGHP%RGHQ]ZHLNRQ]HQWULVFKH .UHLVH2EHU~”FKHWHLOVYHUVLQWHUWVRQVWLQWDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW der Ausfuhrgenehmigung der israelischen Antikenbehörde. Bei Gorny & 0RVFK$XNWLRQ/RV Late Roman terracotta lamp depicting youth with Phrygian cap. North Africa, WKWKFHQWXU\$'6XUIDFHSDUWLDOO\ZLWKWUDFHVRIVLQWHU VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung spätantike Lampen. 5¤PLVFKXQG1RUGDIULNDQLVFK -KQ&KU/YRQELVFP0HLVWKHOOURWHU7RQPLW URWHPEHU]XJ$OOHPLW]DSIHQI¤UPLJHP*ULII(LQH/RHVFKFNH 7\SXV9,,,DXIGHP6SLHJHOHLQPLWHLQHP/¤ZHQN”PSIHQGHU 0DQQ :HUNVWDWWPDUNH DXI 8QWHUVHLWH YLHU 7\S +D\HV ,, DXI GHQ 6SLHJHOQ HLQH 6HUDSLVE©VWH HLQ ODXIHQGHU /¤ZH ]ZHL 5RVHWWHQ ]ZHL GDYRQ PLW YHJHWDELOHQ 2UQDPHQWHQ DXI GHU 8QWHUVHLWH5 Stück!=ZHLPLW6SU©QJHQVRQVWLQWDNW u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5JHNDXIWDXV GHUQLHGHUUKHLQLVFKHQ3ULYDWVDPPOXQJ03YRQGHVVHQ9DWHULQGHQHU HU-DKUHQHUZRUEHQ &ROOHFWLRQRI/DWH5RPDQFOD\ODPSVWKWKFHQWXU\$'$PRQJWKHPRQH ZLWKDOLRQ}JKWRQHZLWK6HUDSLVRQHZLWKDOLRQWZRZLWKURVHWWHV7ZRZLWK crackings, otherwise intact. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Kleine Sammlung antiker Öllampen. D  k  XQG FP =ZHL SXQLVFKH /DPSHQ PLW GUHL 6FKQDX]HQ FD  -K Y &KU (LQ )UDJPHQWGHUJU¤gHUHQ/DPSHJHEURFKHQXQGZLHGHUDQJHVHW]W VRQVW LQWDNW E  / FP /RHVFKFNH 9,,, PLW YHU]LHUWHP *ULII XQG6FKQDX]H5¤PLVFKH.DLVHU]HLW-KQ&KU,QWDNWF  /FP/RHVFKFNH;;;,,,PLW=ZHLJPXVWHUQ%\]DQ] -KQ&KU2EHU~”FKHHWZDVEHULHEHQVRQVWLQWDNWG /FP %\]DQWLQLVFKH/DPSHPLW3XQNWGHNRU-KQ&KU.OHLQH $ESODW]XQJHQXQGIHLQH5LVVHH /FP6S”WDQWLNHNXJHOLJH /DPSHRKQH9HU]LHUXQJ-KQ&KU'HUQLFKWVHKUKRFK JHEUDQQWH7RQLVWDQGHU2EHU~”FKHEU©FKLJXQGWHLOZHLVHDEJH SODW]W6 Stück! u 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ erworben aus dem Nachlass eines Zahnarztes. Small Collection of Ancient oil lamps. a) Two Punic lamps with three nozzles. $ERXW UG FHQWXU\ %& 2QH IUDJPHQW LV EURNHQ DQG UHDWWDFKHG RWKHUZLVH LQWDFWE /RHVFKFNH9,,,ZLWKGHFRUDWHGKDQGOHDQGQR]]OH5RPDQ,PSHULDO 3HULRGVWUGFHQWXU\$',QWDFWF /RHVFKFNH;;;,,,ZLWKGHFRULQIRUP RIEUDQFKHV%\]DQWLQHWKWKFHQWXU\$'6XUIDFHVOLJKWO\UXEEHGRWKHU ZLVHLQWDFWG %\]DQWLQHODPSZLWKGHFRULQIRUPRIURZVRIGRWVWKWK century A.D. Few little splinters are missing, few small cracks. e) Late Roman JOREXODUODPSZLWKRXWGHFRUWKWKFHQWXU\$'6XUIDFHSDUWLDOO\DUHFKLS ped off. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei spätantike Öllampen. D /FP)URVFKW\SXVDXVGXQNHO JU©QHP7RQ-KQ&KU$XIGHU6FKXOWHU=ZHLJ:HUN VWDWWPDUNH DXI GHU 8QWHUVHLWH XQGHXWOLFK ,QWDNW E  /  FP %\]DQWLQLVFKH /DPSH PLW .QRSIKHQNHO DXV KHOOEUDXQHP 7RQ PLW5HVWHQGXQNHOEUDXQHU(QJREH-KQ&KU$XIGHU 6FKXOWHUDXIEHLGHQ6HLWHQMH]ZHL9¤JHOVHLWOLFKHLQHV=ZHLJHV $XIGHU8QWHUVHLWHDFKWVSHLFKLJHV5DG,QWDNW2 Stück! u 3URYHQLHQ]([6DPPOXQJ(+6©GGHXWVFKODQGYRU 7ZRWHUUDFRWWDODPSVD )URJW\SHPDGHRIGDUNJUHHQFOD\UGWKFHQWX U\$'2QWKHVKRXOGHUEUDQFKRQWKHERWWRPEOXUUHGPDUNRIZRUNVKRS ,QWDFWE %\]DQWLQHODPSZLWKNQRSKDQGOHPDGHRIEULJKWEURZQFOD\ZLWK UHVWRIGDUNEURZQVOLSWKWKFHQWXU\$'2QWKHVKRXOGHURQHDFKVLGH WZRELUGDURXQGDEUDQFK2QWKHERWWRPZKHHOZLWKHLJKWVSRNHV,QWDFW2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

354


 Fragment eines Wandziegels mit dem Stempel der Legio VII Claudia (Renovatum). 8PQ&KUFP[[P[FP 5¤WOLFKHU7RQPLWKHOOHU9HUSXW]VFKLFKW,QGHU9HUSXW]VFKLFKW 6WHPSHO  /(* 9,, &/w Stempelvariation sonst nicht bekannt. $XVEUŠFKHGHU9HUSXW]VFKLFKWVRQVWJXWHUKDOWHQ u Provenienz: Ex Sammlung R. B. seit 2000. 9JO]XGLHVHP6WŠFN.=LHJHOHULQ5(  .RORQQH(LQH 9H[LOODWLRGHUXQWHU*DOEDDXVJHKREHQHQ/HJLRQ9,,*HPLQDZXUGHQQ &KUQDFK/DPEDHVLVJHVFKLFNWXPGLHGRUWVWDWLRQLHUWH/HJLR,,,$XJXVWD zu ersetzen. )UDJPHQWRIDSODVWHUHGZDOOEULFNRIWKH/HJLR9,,&ODXGLD 5HQRYDWXP 7KH plaster partially crackled, otherwise well preserved. Nothern Africa, about 158 A.D. A rare variant of the stamp! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 +\SRNDXVWHQ=LHJHO PLW 6WHPSHO GHU /(*,2 ; *HPLQD 5¤ PLVFKQ&KU[FP5¤WOLFKHU7RQ'LFNHU TXDGUDWLVFKHU=LHJHOPLW6WHPSHOLQ6RKOHQIRUP/(*;*3) /HJLR;*HPLQD3LD)LGHOLV GDYRU(IHXEODWW6LQWHUREHUH UHFKWH (FNHQ XQG OLQNH XQWHUH (FNH PLW IHKOHQGHQ )UDJPHQ WHQ u

 )UDJPHQWHLQHV=LHJHOVPLW6WHPSHOGHU/HJLR;;,5DSD[FP [FP5¤WOLFKHU7RQ)UDJPHQWPLWUHFKWHFNLJHP6WHPSHO ;;,,QWDNW u Provenienz: Ex Sammlung Piscator, 1959. 'LHXQWHU$XJXVWXVXPGDV-DKUY&KUDXVJHKREHQH/HJLR;;,5DSD[ KDWWHQXUHLQHNXU]H:LUNXQJVJHVFKLFKWHLQGHUVLHELVLQGLHHU-DKUHGHV 1. Jhs. n. Chr. hauptsächlich zur Sicherung der Rheingrenze eingesetzt wurde. Nach der Niederschlagung des Aufstands des Saturninus 89 n. Chr. wurde GLH/HJLRQDQGLH'RQDXVWUDIYHUVHW]WZRVLHYHUPXWOLFKEHL.Â&#x201D;PSIHQJHJHQ GLHVDUPDWLVFKHQ,D]\JHQDXIJHULHEHQZXUGH Fragment of a brick with rectangular, only partly preserved stamp of Legio ;;,5DSD[ZHOOSUHVHUYHGEHWZHHQ$' VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Fragment mit dem Stempel eines privaten Ziegelherstellers. -K Q&KU[FP+HOOHU7RQ=LHJHOIUDJPHQWPLWWHLOZHLVH HUKDOWHQHP6WHPSHOÂ $77,/,$(),50>$@wXQGKDOEUXQGHU +DQGPDUNH,QWDNW u

3URYHQLHQ]([6DPPOXQJ+6FKPLGW:LHQVHLWHU-DKUHQ U. Brandl, Untersuchungen zu den Ziegelstempeln rÜmischer Legionen, Passauer Universitätsschriften zur Archäologie Bd. 6, 1999, S. 119 ff.

3URYHQLHQ]([6DPPOXQJ)ULW]HPHLHU 9JO ]X GLHVHP 6WŠFN 8 %UDQGO 8QWHUVXFKXQJHQ ]X GHQ =LHJHOVWHPSHOQ U¤PLVFKHU/HJLRQHQ3DVVDXHU8QLYHUVLWÂ&#x201D;WVVFKULIWHQ]XU$UFKÂ&#x201D;RORJLH   1U,QGHU3HUVRQ$WWLOLDGLHELVKHUQXUYRQ6WHPSHOQDXV&DUQXQWXP bekannt ist, wird eine Frau vermutet. Sie betrieb dort offensichtlich eine private Ziegelei, vielleicht als Pächterin.

Square shaped tile of the hypocaust heating system bearing a stemp of the /HJLR;*HPLQD3LD)LGHOLV5RPDQ$'6LQWHUFRUQHUVRIWKH right and the lower left side with missing fragments.

Fragment of a tile with handmark and stamp of a private brickmaker, obviously DZRPDQÂ $77,/,$wIURP&DUQXQWXPZKROHDVHGWKHIDEULF,QWDFWQG century A.D.

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 )UDJPHQW HLQHV =LHJHOV GHU /HJLR ;,,,, * HPLQD  FD ]ZHLWH +Â&#x201D;OIWH-KQ&KU[FP)UDJPHQWHLQHV=LHJHOVPLW 6WHPSHOÂ /(*;,,,,*wXQG$EGUXFNHLQHU6DQGDOH,QWDNW u

 Ziegelfragment mit Privatstempel. -KQ&KU[[FP 5¤WOLFKHU7RQ0LWREORQJHPHLQJHWLHIWHQ6WHPSHOÂ&#x20AC;&316 1y UHWURJUDG ,QWDNW u

Provenienz: Ex Sammlung Fritzemeier 1986.

)UDJPHQW RI D EULFN ZLWK UHFWDQJXODU VWDPS RI /HJLR ;,,,, *HPLQD ZHOO preserved, second half of 1st century A.D. VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 )UDJPHQWHLQHV=LHJHOVPLW6WHPSHOGHU/HJLR;9$SROOLQDULV71 Q&KUFP[FP5¤WOLFKHU7RQ)UDJPHQWPLW 6WHPSHO /(*;9$32w0¤UWHODX~DJHQ u 3URYHQLHQ]([6DPPOXQJ)ULW]HPHLHU 'LH/HJLR;9$SROOLQDULVZDUYRP-DKUQ&KUELV]XLKUHP$E]XJLP -DKUQ&KUQDFK.DSSDGRNLHQLQ&DUQXQWXPVWDWLRQLHUW )UDJPHQWRIDEULFNZLWKUHFWDQJXODUVWDPSRI/HJLR;9$SROOLQDULVSUHVXPDEO\ IURP&DUQXQWXPOD\HUVRIPRUWDUFD$' VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Aus bayerischer Privatsammlung, erworben aus Slg. Fritzemeier  Tile fragment with rectangular stamp of a private fabrication with inscription LQUHYHUVHQGFHQWXU\$',QWDFW VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Vier Ziegelfragmente. 7UDQVUKHQDQD ;DQWHQ XD D  FP [ FP[FP5¤WOLFKHU7RQ0LW6WHPSHO 9,9)wE FP[ FP[FP5¤WOLFKHU7RQ0LW6WHPSHO 553)wF FP[ FP[FP5¤WOLFKHU7RQ0LW6WHPSHOG FP[FP[ FP%HLJHIDUEHQHU7RQ0LW6WHPSHOSehr selten! 4 StĂźck! u 3URYHQLHQ]([6DPPOXQJ)ULW]HPHLHU Four brick fragments with stamps. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

355


 RĂśmischer Bleianker. .DLVHU]HLW    -K Q &KU / FP $QNHUVWRFNPLWUHFKWHFNLJHP0LWWHOVWŠFN,QWDNWPLW0HHUHVEH ZXFKV u Provenienz: Ex Sammlung M.L., MĂźnchen, erworben in den 1950er bis 1960er Jahren. 6WRFNRID5RPDQDQFKRUZLWKUHFWDQJXODUFHQWHUSLHFHPDGHRIOHDG,PSHULDO 3HULRGVWWKFHQWXU\$',QWDFWZLWKVHDHQFUXVWDWLRQV VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL %URQ]H}JXUHQ 6SÂ&#x201D;W]HLW  SWROHPÂ&#x201D;LVFKH (SRFKH   FD Y&KUD + RKQH6RFNHO FP%URQ]HYROOJXVV%UHWWDU WLJJHVWDOWHWH6WDWXHWWHGHU*¤WWLQ+DWKRUPLW.XKNRSIGDUŠEHU HLQH.RPSRVLWNURQHEHVWHKHQGDXV.XKJHK¤UQPLWGD]ZLVFKHQ OLHJHQGHU6RQQHQVFKHLEHXQGGHU)HGHUNURQHGHV$PXQ*UŠ QH3DWLQDOHLFKWNRUURGLHUW6SLW]HGHU.URQHDEJHEURFKHQUH VWDXULHUWHU%UXFKŠEHUGHP)XgEHUHLFKDXI3OH[LJODV6RFNHO + FP  E  + RKQH 6RFNHO  FP %URQ]HYROOJXVV $XVVFKUHL WHQGH6WDWXHWWHGHV+DUSRNUDWHVPLW-XJHQGORFNHGHQUHFKWHQ )LQJHU DQ GHQ 0XQG JHOHJW KLQWHQ Â?VH *UŠQH 3DWLQD OHLFKW NRUURGLHUWGLH)ŠgHDEJHEURFKHQDXI3OH[LJODV6RFNHO FP  2 StĂźck! u 3URYHQLHQ]([6DPPOXQJ:7.¤OQVHLW Two full cast bronze objects dating from the Late to the Ptolemaic Period. a) Hathor wearing a composite crown. Green patina, break at feet area restored, tip of crown missing. b) Statuette of Harpocrates. Green patina, feet missing. FD%& 2 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von kleinen Ushebtis. 'ULWWH =ZLVFKHQ]HLW FD  Y&KU+FDFP*UŠQJODVLHUWH)D\HQFH)ŠQIPXPL HQI¤UPLJH 8VKHEWLV PLW DXIJHPDOWHQ .RSIEÂ&#x201D;QGHUQ GLH $UPH PLWGHQJHPDOWHQ:HUN]HXJHQ+DFNHXQG+DQGS~XJŠEHUGHU %UXVWJHNUHX]W5 StĂźck!*ODVXUDEJHULHEHQ%HPDOXQJWHLOZHLVH HUKDOWHQ u 3URYHQLHQ]([6DPPOXQJ57*1RUGGHXWVFKODQG%HL*RUQ\ 0RVFK $XNWLRQ/RV

 Halskette und Skarabäen. +DOVNHWWH PLW DQWLNHQ YRUGHUDVLDWL VFKHQ .DUQHROSHUOHQ IŠQI 6NDUDEÂ&#x201D;HQ DXV 6WHDWLW HLQHP 'RS SHOVLHJHODXV6WHDWLWXQGHLQHU)D\HQFH}JXUGHU+DWKRUkFD FP 0RGHUQ NRPELQLHUW XQG DXIJHIÂ&#x201D;GHOW Erworben in den HU ELV HU -DKUHQ  'D]X YLHU HLQ]HOQH 6NDUDEÂ&#x201D;HQ DXV 6WHDWLW /  ELV FP 'DV JU¤gWH 6WŠFN PLW NOHLQHQ )HKO VWHOOHQ Gekauft 2019 aus der niederrheinischen Privatsammlung 03YRQGHVVHQ9DWHULQGHQHUHU-DKUHQHUZRUEHQ 5 StĂźck! u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ:5 1HFNODFHFRQVLVWLQJRI$QFLHQW:HVWHUQ$VLDWLFFRUQHOLDQEHDGV}YHVFDUDEV PDGHRIVWHDWLWHDGRXEOHVHDOPDGHRIVWHDWLWHDQGDIDLHQFH}JXUHRI+DWKRU Modern combination and strunged up. Plus four scarbs made of steatite. Little fragments of one piece are missing. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ6NDUDEÂ&#x201D;HQXQGNOHLQHU2EMHNWH1RUGDIULND/HYDQWH XD /   FP 'DUXQWHU VHFKV 6NDUDEÂ&#x201D;HQ ŠEHUZLHJHQG DXV 6WHDWLWHLQ6NDUDERLGDXV)D\HQFHHLQZHLWHUHU6LHJHOVWHLQPLW 5RVHWWH DXV 6WHDWLW XQG HLQHU DXV )D\HQFH HLQ 6LHJHOVWHLQ DXV 6WHDWLW LQ %URQ]H JHIDVVW HLQ $PXOHWW LQ )RUP HLQHV 3DS\UXV =HSWHUVDXV)D\HQFHHLQMDQXVN¤S}JHU$QKÂ&#x201D;QJHUDXV)D\HQFH HLQU¤PLVFKHU+RO]ZŠUIHOHLQH3IHLOVSLW]HDXV%URQ]HXQGYLHU (LVHQQÂ&#x201D;JHO8 StĂźck! u Provenienz: Aus der sĂźddeutschen Sammlung C.P., erworben beim $XNWLRQVKDXV/HPSHUW]LQGHQELVIUŠKHQHU-DKUH Collection of scarabs and small objects. Northern Africa, Levante. Six scarabs mostly made of steatite, one faience scaraboid, one seal stone made of steatite and one made of faience, one steatite seal stone surrounded by bronze, one faience amulet in the form of a papyrus scepter, one faience amulet with two heads, one Roman dice made of wood, one bronze arrowhead and four iron nails. 8 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 )©QI NOHLQH 2EMHNWH 1RUGDIULND +    FP =ZHL EXQWH *ODV~DVFKHQ ]ZHL )D\HQFHN¤SIFKHQ XQG HLQ 6LHJHOVWHLQ DXV .DUQHRO5 Stück!  u 3URYHQLHQ]([6.3DULVHUZRUEHQLP3DULVHU.XQVWKDQGHO

&ROOHFWLRQ RI }YH IDLHQFH VPDOO XVKDEWLV 0XPP\IRUP VKDSH DUPV FURVVHG RYHUFKHVWKHDGEDQGVSDLQWHG*UHHQJOD]HPRVWO\ZRUQRIIRWKHUZLVHLQWDFW 7KLUG,QWHUPHGLDWH3HULRGFD%&5 pieces!

Five small objects. Northern Africa. Two coloured bottles made of glas, two faience heads and one seal stone made of cornelian. 5 pieces!

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

356


 Sammlung Miniaturen. 1RUGDIULND 6S”W]HLW ELV +HOOHQLVPXV 'DUXQWHU HLQ 8GMDW$QK”QJHU / FP LQWDNW  DXV JU©Q W©UNLVHP(PDLOHLQ7RQPRGHOI©UHLQH0LQLDWXU$PSKRUD + FP LQWDNW  HLQ 6WHDWLW6NDUDE”XV / FP LQWDNW  VRZLH GUHLRYDOH7RQDEGU©FNH]ZHLGDYRQPLWHLQHU6”XOHOHKQHQGHQ 9HQXVXQGHLQHPLW7ULVNHOHV +FP)UDJPHQWHIHKOHQ  6 Stück! u 3URYHQLHQ]$XVGHU6OJ'..RSHQKDJHQYRUPDOVDXVHLQHU1RUGHXURS” LVFKHQ6DPPOXQJHUZRUEHQLQGHQHUHU-DKUHQ &ROOHFWLRQRI1RUWK$IULFDQPLQLDWXUHREMHFWVLQFOXGLQJDQHQDPHOXGMDWH\H pendant, a clay impression with an amphora, a steatite scarab and three oval FOD\LPSUHVVLRQVZLWKD9HQXVOHDQLQJRQDFROXPQDQGRQHZLWKWULVNHOHV Late period to Hellenism. Partially fragmentary. 6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung Ägyptiaca und anderes. 'DUXQWHU HOI $PXOHWW}J©U FKHQDXV)D\HQFHXQG6WHLQ +FP HLQ/¤ZHQVNDUDE”XV /FP HLQ.XKDQK”QJHU /FP HLQ6FKODQJHQDXIVDW] + FP HLQH)LJ©UFKHQ +FP XQGHLQH6FKPXFNQDGHOPLW 9RJHO / DOOHYLHUDXV%URQ]HHLQZHLEOLFKHU7HUUDNRWWD NRSI + FP  ]ZHL 3IHLOHU XQG HLQH .OLQJH DXV VFKZDU]HP 2EVLGLDQ /FP 20 Stück!3DUWLHOOPLWNOHLQHQ%HVWRgXQ JHQJU¤gWHQWHLOVLQWDNW u 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEHVW”QGHQ GHU 0©Q]KDQGOXQJ .DUO .UHVV0©QFKHQYRU &ROOHFWLRQRIVPDOOREMHFWV}JXUHVIURPID\HQFHVWRQHDQGEURQ]HDQGRWKHU objects. Partially small details missing, mostly intact. 20 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von dreizehn Steingefäßen des Alten Reiches. D  + FP 'LRULW .OHLQHV EHFKHUDUWLJHV 6DOEJHI”g PLW ~DFKHP %RGHQXQGDEJHVHW]WHP5DQG(LQ7HLOGHU5DQG]RQHHUJ”Q]W '\QDVWLHY&KUE +FPkFP$ODEDVWHU .XJHOLJHV *HI”g :LQ]LJHU $XVEUXFK DP 5DQG VRQVW LQWDNW  '\QDVWLH XP  Y &KU F  + FP *UDXHU 6WHLQ 6FKODQNHV/LEDWLRQVJHI”gPLWEUHLWHP5DQG5DQG]RQHHUJ”Q]W 0LWWOHUHV 5HLFK XP  Y &KU G  + FP FP XQG FP 'UHL HLI¤UPLJH 6FKPLQNJHI”gH DXV JU©QHP JUDXHP XQG VDQGIDUEHQHP6WHLQPLW~DFKHP5DQG.OHLQHUH%HVWRVVXQJHQ VRQVWLQWDNW 6W©FN '\QDVWLHXPY&KUH +FP 'LRULW.OHLQHV~DFKHV6DOEJHI”gLQ)ODVFKHQIRUPPLWVHLWOLFKHQ 6FKQXU¤VHQKHQNHOQ(LQHVHDEJHEURFKHQNOHLQH%HVWRVVXQJ XQWHQ 3U”G\QDVWLVFKH 3HULRGH  Y &KU I  + FP 7UDYHUWLQ .OHLQHV ~DFKHV  6DOEJHI”g LQ )ODVFKHQIRUP PLW ZLQ]LJHQ VHLWOLFKHQ 6FKQXU¤VHQKHQNHOQ /RFK DP 5DQG J  + FP 9LHU NOHLQH 6DOE RGHU /LEDWLRQVJHI”gH DXV 6HUSHQWLQ XQG6WHDWLWPLWVSLW]HPRGHU~DFKHQ%RGHQLQJXWHU(UKDOWXQJ 6W©FN $OWHV5HLFKFDY&KUK +FDFP ,PLWDWLRQHLQHV6DOEJHI”gHVDXVGHP1HXHQ5HLFKDXV7UDYHUWLQ GHU%RGHQQHXDQJHNOHEW13 Stück! u 3URYHQLHQ]([6DPPOXQJ5:+HVVHQ)DPLOLHQEHVLW]VHLWYRU &ROOHFWLRQ RI VHYHUDO VPDOO VWRQH YHVVHOV GDWLQJ IURP WKH 2OG .LQJGRP D  'LRULWFRQFDYHIRRWHGEHDNHU5HVWRUDWLRQLQWKHXSSHUSDUW'\QDVW\ %&E $ODEDVWHUVSKHULFDOYHVVHO7LQ\VSOLWDWULPRWKHUZLVHLQWDFW 1st dynasty, about 2900 B.C. c) Slender libation vessel. Restauration at rim. 0LGGOH.LQJGRPFD%&G 7KUHHRYRLGXQJXHQWYHVVHOVZLWK~DWRIIVHW ULPVWKG\QDVW\DERXW%&H DQGI 7ZR~DWERWWOHVKDSHGXQJXHQW YHVVHOVZLWKWXEXODUKDQGOHV%&J )RXURIIHULQJYHVVHOVPDGH

IURPVWHDWLWHDQGVHUSHQWLQ2OG.LQJGRPFD%&K ,PLWDWLRQ RID1HZ.LQJGRPPDNHXSYDVHERWWRPQHZDQGJOXHG13 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL NRSWLVFKH 3DS\UXV)UDJPHQWH    -K Q &KU D  / FD FP+FDFP XQJHUDKPW 5DKPHQ[FP3DS\UXV IUDJPHQWPLWYHUEODVVWHUNRSWLVFKHU6FKUHLEVFKULIWE /FP + FP XQJHUDKPW  5DKPHQ [FP 3DS\UXVIUDJPHQW PLWNRSWLVFKHU6FKULIW2 Stück!$XIJHOHJWXQGPLW3DVVHSDUWRXW LQYHUJROGHWHQ5DKPHQ u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV 7ZR&RSWLFSDS\UXVIUDJPHQWVSDVVHSDUWRXWDQGJROGIUDPHVWKWKFHQW AD. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQ]HKQNRSWLVFKHQ6WRII)UDJPHQWHQD [FP 5DKPHQ[FP %UDXQH:ROOZLUNHUHLDXI/HLQHQ(LQVDW] HLQHU7XQLNDPLWRUQDPHQWDOHP0XVWHU6HKUIUDJPHQWLHUWDXI 6WRIIJHOHJWLQ3OH[LJODVJHUDKPW-KQ&KUE [FP 5DKPHQ  [ FP  %UDXQH :ROOZLUNHUHL DXI /HLQHQ )UDJ PHQWHLQHU7XQLNDPLW7LHUGDUVWHOOXQJHQ$XI6WRIIJHOHJWXQWHU *ODVJHUDKPWPLWDOWHP$XINOHEHU-KQ&KUF [ FP 5DKPHQ  [ FP  6FKZDU]URWEUDXQH :ROOZLUNH UHLDXI/HLQHQ=LHUVWUHLIHQ YRQHLQHP9RUKDQJ" /¤ZHQIULHV XQG~RUDOHV0XVWHU,QWDNWDXI6WRIIJHOHJWJHUDKPWKLQWHQDO WHU$XINOHEHU-KQ&KUG [FP 5DKPHQ[ FP 5RWEODXJHOEJU©QH:ROOZLUNHUHLDXI/HLQHQ)ORULVWLVFKH %RUG©UH,QWDNWDXI5LSVJHOHJWJHUDKPWKLQWHQDOWHU$XINOHEHU FD-KQ&KUDXV$OH[DQGULDH [FP 5DKPHQ[ FP 5RWEHLJHJU©QH:ROOZLUNHUHLDXI/HLQHQ%RUG©UHPLW ~RUDOHQ0RWLYHQXQGPHQVFKOLFKHQ)LJXUHQ*XWHUKDOWHQDXI /HLQHQJHOHJWJHUDKPW-KQ&KUI [FP 5DKPHQ [FP %HPDOWHV6WXFNIUDJPHQWPLWVFKZDU]ZHLgHP*LW WHUPXVWHU GDUXQWHU 7ULJO\SKHQ)ULHV $XI /HLQHQ JHNOHEW XQG JHUDKPW+HUNXQIWXQEHNDQQWJ [FP5DKPHQ [ FP %UDXQJU©QH:ROOZLUNHUHLDXI/HLQHQ%RUG©UHPLW'DU VWHOOXQJ YRQ 0HQVFKHQ ]ZLVFKHQ ~RUDOHQ 0XVWHUQ ,QWDNW DXI /HLQHQJHOHJWJHUDKPW-KQ&KUK [FP 5DKPHQ [FP :ROOZLUNHUHLDXIPRQRFKURPEODXHP/HLQHQ=LHU VW©FNPLW0HGDLOORQVGLH]ZLVFKHQ:HLQVW¤FNHQOLHJHQGD]ZL VFKHQPHQVFKOLFKH%©VWHQ~DQNLHUWYRQ+DVHQ/¤ZHQ*D]HOOH ,QWDNWDXIURWHV/HLQHQJHOHJW3OH[LJODV5DKPXQJDOWHU$XINOH EHU-KQ&KUL [FP 5DKPHQ[FP %UDXQ URVWIDUEHQH :ROOZLUNHUHL DXI /HLQHQ (LQVDW]VW©FN YRQ HLQHP .LVVHQLQGHUREHUHQ5HLKHLP0HGDLOORQHLQHVWLOLVLHUWH%©VWH LQGHUXQWHUHQ$PSKRUHQ]ZLVFKHQ$UNDGHQ%HOLHEWHV0XVWHU $XI6WRIIJHOHJWJHUDKPWDOWHU$XINOHEHU-KQ&KUM  [FP 5DKPHQ[FP %UDXQH:ROOZLUNHUHLDXI/HL QHQ(LQVDW]HLQHU7XQLNDPLWHLQHP0XVWHUDXV©EHUHLQDQGHU OLHJHQGHQ0HGDLOORQV,QDXVJHVFKQLWWHQH6WRII8QWHUODJHJHOHJW XQWHU*ODVJHUDKPWLQWDNW-KQ&KU10 Stück! Sehr gut HUKDOWHQHXQGJHS~HJWH6DPPOXQJYRQLQWHUHVVDQWHQ6W©FNHQ u 3URYHQLHQ]([6DPPOXQJ5:+HVVHQ)DPLOLHQEHVLW]VHLWYRU Collection of ten very well maintained ancient Coptic textile fragments, made IURPOLQHQDQGZRRORYHUDSHULRGIURPWKHWKWRWKHWKFHQWXULHV$'10 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

357


 Drei Bronzestatuetten. 9RUGHUDVLDWLVFKY&KUD + FP0Â&#x201D;QQOLFKH)LJXUPLW~DFKHP.¤USHU$UPHYRUGHU%UXVW KDOWHQG 7UÂ&#x201D;JW +DOVVFKPXFN XQG HLQHQ ]ZHLUHLKLJHQ *©UWHO 9RJHODUWLJHU .RSI PLW JURgHQ $XJHQ 0LW =DSIHQ 6FK¤QH JU©QH3DWLQD9JO90©OOHU)U©KH3ODVWLNLQ*ULHFKHQODQGXQG 9RUGHUDVLHQ   7DIHO 9,,, 1U  E  +  FP )ODFKHU VÂ&#x201D;XOHQDUWLJHU.¤USHUGHUVLFKQDFKXQWHQYHUM©QJW$UPHVLQG DXI6FKXOWHUK¤KHDQJHZLQNHOWZREHLHLQ$UPQDFKREHQXHLQ $UP QDFK YRUQH ]HLJW /DQJHV VWLOLVLHUWHV *HVLFKW PLW JURgHQ $XJHQ XQG ]DSIHQI¤UPLJHP $XIVDW] 9JO 9 0©OOHU )U©KH 3ODVWLNLQ*ULHFKHQODQGXQG9RUGHUDVLHQ  7DIHO;/,,,1U F +FP0Â&#x201D;QQOLFKH)LJXUPLW%DUWXQG.RSIEHGHFNXQJ LQ 2UDQWHQKDOWXQJ 'HU .¤USHU LVW ]\OLQGHUI¤UPLJ VWHKW DXI ]ZHL)©gHQ9JO90©OOHU)U©KH3ODVWLNLQ*ULHFKHQODQGXQG 9RUGHUDVLHQ  7DIHO;/,,,1U3 Stück! u 3URYHQLHQ]([5HVWEHVWÂ&#x201D;QGH0©Q]KDQGOXQJ.DUO.UHVV0©QFKHQYRU 7KUHH EURQ]H }JXULQHV :HVWHUQ $VLDWLF    %& D  0DOH }JXUH ZLWK~DWERG\DUPVLQIURQWRIWKHFKHVW%LUGOLNHKHDGZLWKELJH\HV1LFH JUHHQSDWLQDE )ODWERG\EHFRPHVQDUURZHUGRZQZDUG2QHDUPSRLQWVXS ward and one arm forward. Long Face with big eyes and pointed attachment RQWKHKHDGF 0DOH}JXUHZLWKEHDUGDQGLQRUDQVSRVWXUH3 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 .¤USHUHLQHV.LOL\D,GROV:HVWDVLDWLVFKFDY &KU+FDFP:HLgHUIHLQNULVWDOOLQHU0DUPRU6WDUNVWLOLVLHUWHU ~DFKHU.¤USHUPLWGLDJRQDODQJHZLQNHOWHQ8QWHUDUPHQHLQHP VSLW] ]XODXIHQGHQ 8QWHUN¤USHU X HLQHP ODQJHQ G©QQHQ +DOV .RSIX6SLW]HYRQ8QWHUN¤USHUIHKOHQSDUWLHOOYHUVLQWHUW u

 'UHL .LOL\D,GRO.¤SIH :HVWDVLDWLVFK FD    Y &KUD %UHLWHU.RSIPLWODQJHUG©QQHU1DVHXSODVWLVFKHU$Q JDEHGHU2KUHQ+FDFP:HLgHUIHLQNULVWDOOLQHU0DUPRU $P+DOVJHEURFKHQWHLOVYHUVLQWHUW6SXUHQYRQURWHU)DUEHE  +RKHUVSLW]]XODXIHQGHU.RSIPLWODQJHUVFKPDOHU1DVHXSOD VWLVFKHU$QJDEHGHU2KUHQ+FDFP:HLgHUIHLQNULVWDOOL QHU0DUPRU$P+DOVJHEURFKHQ5©FNVHLWHX+DOVYHUVLQWHUW F %UHLWHU.RSIPLWODQJHUG©QQHU1DVHXSODVWLVFKHU$QJDEH GHU2KUHQ+FP:HLgHUIHLQNULVWDOOLQHU0DUPRU$P+DOV JHEURFKHQJU¤gWHQWHLOVYHUVLQWHUW3 Stück! u Provenienz: Ex Nachlass E.T., München 1980er Jahre. :HVWHUQ$VLDWLFDERXW%&D %URDGKHDGRIDPDUEOH LGRO .LOL\DW\SH %URNHQDWWKHQHFNSDUWLDOO\VLQWHUHGWUDFHVRIUHGFRORXU E 3RLQWHGKHDGRIDPDUEOHLGRO .LOL\DW\SH %URNHQDWWKHQHFNEDFNDQG QHFNSDUWLDOO\VLQWHUHGF %URDGKHDGRIDPDUEOHLGRO .LOL\DW\SH %URNHQDW the neck, mostly sintered. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHL .LOL\D,GRO.¤SIH :HVWDVLDWLVFK FD    Y &KUD %UHLWHU.RSIPLWODQJHUEUHLWHQ1DVHXSODVWLVFKHU$Q JDEHGHU2KUHQ+FDFP:HLgHUIHLQNULVWDOOLQHU0DUPRU $P+DOVJHEURFKHQJU¤gWHQWHLOVYHUVLQWHUWE %UHLWHU.RSIPLW ODQJHUG©QQHU1DVHXSODVWLVFKHU$QJDEHGHU2KUHQXQG$X JHQ+FDFP:HLgHUIHLQNULVWDOOLQHU0DUPRU$P+DOVJH EURFKHQVFKZDU]H)Â&#x201D;UEXQJDP+LQWHUNRSIWHLOZHLVHYHUVLQWHUW F %UHLWHU.RSIPLWODQJHUG©QQHU1DVHXSODVWLVFKHU$QJDEH GHU 2KUHQ + FD  FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU $P +DOVJHEURFKHQDP+LQWHUNRSIYHUVLQWHUW3 Stück! u Provenienz: Ex Nachlass E.T., München 1980er Jahre.

Provenienz: Ex Nachlass E.T., München 1980er Jahre.

0DUEOHLGRORIWKH.LOL\DW\SH:HVWHUQ$VLDWLFDERXW%& Head and fragment of lower body are missing, partially sintered. VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL.LOL\D,GRO.¤SIH:HVWDVLDWLVFKFDY &KU D  +RKHU VSLW] ]XODXIHQGHU .RSI PLW SODVWLVFKHU $QJDEH GHU 2KUHQ + FD  FP :HLgHU IHLQNULVWDOOLQHU 0DUPRU $P +DOVJHEURFKHQJU¤gWHQWHLOVYHUVLQWHUWE %UHLWHUQDFKKLQWHQ DXVODGHQGHU.RSIPLWVSLW]]XODXIHQGHU1DVH+FP:HLgHU IHLQNULVWDOOLQHU 0DUPRU $P +DOV JHEURFKHQ )UDJPHQW DP +LQWHUNRSIIHKOWJU¤gWHQWHLOVYHUVLQWHUW2 Stück! u Provenienz: Ex Nachlass E.T., München 1980er Jahre. :HVWHUQ$VLDWLFDERXW%&D 3RLQWHGKHDGRIDPDUEOH LGRO .LOL\DW\SH %URNHQDWWKHQHFNPRVWO\VLQWHUHGE %URDGKHDGRIDPDU EOHLGRO .LOL\DW\SH ZLWKSRLQWHGQRVH%URNHQDWWKHQHFNPRVWO\VLQWHUHG2 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

358

:HVWHUQ$VLDWLFDERXW%&D %URDGKHDGRIDPDUEOH LGRO .LOL\DW\SH %URNHQDWWKHQHFNPRVWO\VLQWHUHGE %URDGKHDGRID PDUEOHLGRO .LOL\DW\SH %URNHQDWWKHQHFNDWWKHEDFNGDUNFRORUDWLRQ SDUWO\VLQWHUHGF %URDGKHDGRIDPDUEOHLGRO .LOL\DW\SH %URNHQDWWKH neck, sintered at the back. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 /RW)UDJPHQWHYRQ.LOL\D,GROHQFDY&KU:HLgHU IHLQN¤UQLJHU 0DUPRU :HVWDVLDWLVFK +   FP 12 Stück! 7HLOZHLVHPLW6LQWHU u 3URYHQLHQ]([1DFKODVV(70©QFKHQ(UZRUEHQLP0©QFKQHU.XQVWKDQGHO in den 1980er Jahren. Bei Gorny & Mosch Auktion 260, 2028, Los 695. )UDJPHQWVIURPLGROVPDGHRIZKLWHPDUEOH:HVWHUQ$VLDWLF$ERXW %&3DUWLDOO\ZLWKVLQWHU12 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!


 Rassel in Form eines Vogels. ,QGXV.XOWXU FD  Y &KU / FP+FP%HLJHU7RQPLW%HPDOXQJLQGXQNHOEUDXQJU©Q XQGURW6WLOLVLHUWHU9RJHOPLW~DFKHP6WDQGERGHQXQGNOHLQHP /RFK DXI GHP .¤USHU 'LH $XJHQ GHU 6FKQDEHO XQG GDV *H}HGHU GXUFK %HPDOXQJ DQJHJHEHQ Mit Bestimmungszettel des Sammlers!6WHOOHQZHLVHEHULHEHQLQWDNW u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHU-DKUHELV 5DWWOHLQIRUPRIDFOD\ELUGZLWKSDLQWLQJLQGDUNEURZQJUHHQDQGUHG,QGXV DUHDDERXW%&3DUWLDOO\ZRUQLQWDFWWith collector`s note! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von neolithischen Pfeilspitzen und Kleinwerkzeugen. :HVWDIULNDXPY&KU/FP9HUVFKLHGHQIDUELJHU )HXHUVWHLQ 6FKDUIH 3IHLOVSLW]HQ VRZLH NOHLQH JH]Â&#x201D;KQWH 6Â&#x201D;JHQ XQG6FKDEHU21 Stück!6HKUJXWHU(UKDOWXQJV]XVWDQG u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELV ,QWHUHVWLQJFROOHFWLRQRI1HROLWKLFVDZQDUURZSHDNVDQGVKDYHUV:HVW$IULFD about 2200 B.C. 21 pieces! Very good condition! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung Steinwerkzeuge. 1HROLWKLVFK    Y &KU =ZHL 6WHLQEHLOH / FP )XQGRUW -©WODQG 'Â&#x201D;QHPDUN XQG FP DXV)OLQWXQGHLQH$[W /FP DXV%DVDOW3 Stück! $OOHLQWDNWHLQHVPLW)XQGRUW$QJDEH u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUZRUEHQXP  &ROOHFWLRQRIWZR~LQWVWRQHVDQGRQHEDVDOWD[HRQH~LQWVWRQHD[HIRXQGHGLQ -XWODQG'HQPDUN LQVFULSWLRQRQWKHD[H 1HROLWKLFPLOOHQLXP %&,QWDFW3 pieces!

 Sammlung Steinwerkzeuge. 3DOÂ&#x201D;ROLWKLVFK X QHROLWKLVFK /  FP $XV )HXHUVWHLQ 'DUXQWHU GUHL %HLOH HLQ 'ROFK GUHL 6FKDEHU ]ZHL Â&#x160;[WH HLQ )DXVWNHLO PLW $XVVSDUXQJHQ I©U YLHU )LQJHUVRZLHHLQ+DFNEHLODXV7RXORXVH 2OGRZDQ0LR-DKUH YRUKHXWH 14 Stück!,QWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 'U$9%D\HUQHUZRUEHQXQWHUDQGHUHPDXIGHQ$XNWLRQHQEHL0©Q] =HQWUXP5KHLQODQG$XNWLRQ/RVHX$XNWLRQ  &ROOHFWLRQRI1HROLWKLFKDQGD[HVRI~LQWVWRQHLQFOXGLQJDGDJJHUD[HVVKD YHUV DQG D FKRSSHU 2OGRZDQ  PLR \HDUV EHIRUH WRGD\  3DOHROLWKLF DQG QHROLWKLF,QWDFW14 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Speerspitze und Trense. %URQ]H]HLW 6©GRVWHXURSD  +Â&#x201D;OIWH  -W Y &KU 6SHHUVSLW]H / FD FP  PLW ODQ]HWWI¤UPLJHP %ODWW PLW 0LWWHOJUDW XQG YLHUNDQWI¤UPLJHU $QJHO 6I¤UPLJHU JHVFKZXQJHQHU7HLOHLQHU3IHUGHWUHQVH /FDFP PLW]ZHL /¤FKHUQ2 Stück!*U©QH3DWLQDLQWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVHUZRUEHQDXV Sammlung A.A., München, zwischen 1992 und 1996. Bronze spearhead and part of a horse bit. Bronze Age, Southeast Europe, 2nd half 1st millenium B.C. Green patina, intact. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Drei neolithische Schalen. $XV ,WDOLHQ +DQGJHW¤SIHUW =ZHL JU¤gHUH KDOEUXQGH 6FKDOHQ XQG HLQ NOHLQHV KDOEUXQGHV 6FKÂ&#x201D;OFKHQ DXV EUDXQHP 7RQ 3 Stück! 7HLOZHLVH IUDJPHQWLHUW XQGJHEURFKHQ u 3URYHQLHQ]([.OXJHU

VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

7KUHHQHROLWKLFERZOV)URP,WDO\+DQGPDGHSRWWHU\7ZRELJJHURQHVDQG one small one. Dark clay. Partly fragmented. 3 pieces!

 Sammlung Steinwerkzeuge. 1HROLWKLVFK    Y &KU 'DUXQWHUHLQH+DUWNQDXID[WDXVVFKZDU]HP6WHLQ /FP)2 5©JHQPLWPRGHUQHP+RO]JULII HLQH$[WDXVVFKZDU]HP6WHLQ /   XQG HLQH 3IHLOVSLW]H DXV U¤WOLFKVFKZDU]HP 6WHLQ / FP 3 Stück!$OOHLQWDNWHLQHVPLW)XQGRUW$QJDEH u

VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJ+DUWNQDXID[WHUZRUEHQ EHL+LUVFK1DFKI$XNWLRQ/RVH[6OJ'U6LHJIULHG=LPPHU DQGHUH$[WXQG3IHLOVSLW]HHUZRUEHQXP

 Rheinischer Kugeltopf der Badorfer Keramik. -KQ&KU +  FP %DGRUIHU .HUDPLN 3LQJVGRUI  6FKZDU]JUDXHU 7RQ *URgHU .XJHOWRSI PLW DXVVFKZLQJHQGHU /LSSH 9HUHLQ]HOW PLQLPDOH5LVVHVRQVWLQWDNW u 3URYHQLHQ]([$:HEHU.¤OQ

Collection of two axes of black stone and one arrow head of stone. Neolithic, PLOOHQLXP%&$OOLQWDFW3 pieces!

5KHQLVKVSKHULFSRWWHU\WKWKFHQWXU\$'%DGRUIHUSRWWHU\ 3LQJVGRUI  6RPH}QH}VVXUHVRWKHUZLVHLQWDFW

VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

359


 Sammlung Ikonen. 8P    -K Q &KU D  + FP % FP 5XVVLVFK *URgH +DUWKRO]SODWWH ]ZHL 6SRQNL .RZ WVFKHJ 7HPSHUD DXI .UHLGHJUXQG PLW WHLOZHLVHU 9HUJROGXQJ )HLQH0DOHUHLPLWPHKUHUHQ6]HQHQ]XU$XIHUVWHKXQJXQG+¤O OHQIDKUW,PXQWHUHQ7HLO%HVFK”GLJXQJGHU)DUEHQVFKLFKWGXUFK )HXHU LP REHUHQ 7HLO HLQ 6SUXQJ 0DOHUHL JXW HUKDOWHQ E  + FP%FP*ULHFKLVFK+DUWKRO]SODWWHPLW~RUDOHP5H OLHI7HPSHUDDXI.UHLGHJUXQGPLWWHLOZHLVHU9HUJROGXQJ'DU VWHOOXQJ YRQ &KULVWXV 3DQWRNUDWRU DXI GHP 7KURQ (LQH (FNH DEJHEURFKHQSDUWLHOO9HUOXVWGHU5HOLHIGHWDLOV0DOHUHLJXWHUKDO WHQDXgHUHLQHUNOHLQHQ%HVWRgXQJF +FP%FP*ULH FKLVFK =ZHL G©QQH +RO]SODWWHQ HLQHU $OWDUO©QHWWH 7HPSHUD DXI.UHLGHJUXQGPLWWHLOZHLVHU9HUJROGXQJ6]HQHGHU9HUN©Q GLJXQJDXIDUFKLWHNWRQLVFKHQ+LQWHUJUXQGLPXQWHUHQ%HUHLFK HLQH ,QVFKULIW ,Q PRGHUQHQ 5DKPHQ JHIDVVW SDUWLHOO 6SU©QJH %HVWRgXQJHQXQG%HVFK”GLJXQJHQ'D]XHLQH7DVFKHQLNRQHPLW 0DULDPLWGHP&KULVWXVNLQGXQGNOHLQHQK¤O]HUQHQ$OWDU~©JHOQ LQ6FKQLW]DUEHLWPLWGHQYLHU(YDQJHOLVWHQ5 Stück! Zwei Ikonen PLW*XWDFKWHQ,NRQHQPXVHXP6FKORVV$XWHQULHG u

 .OHLQH 6DPPOXQJ YRQ VHFKV SUDHNROXPELVFKHQ 0HWDOOREMHNWHQ D  k FP 6LOEHUOHJLHUXQJ %DUW]XSIHUw LQ UXQGHU )RUP (WZDV NRUURGLHUW VRQVW VHKU JXW HUKDOWHQ ,QND RGHU .RORQLDO XP  Q &KU E  / FP 6LOEHUOHJLHUXQJ %DUW]XSIHUw LQ 3LQ]HWWHQIRUP.RUURGLHUWVRQVWVHKUJXWHU=XVWDQG,QNDRGHU .RORQLDOXPQ&KUF /FP.XSIHU%DUW]XSIHUwLQ 3LQ]HWWHQIRUPPLW]ZHL9ROXWHQ*U©QH3DWLQDLQWDNW&DOLPD FDQ&KUG /FPJ.XSIHU*ROG/HJLHUXQJ 7XPEDJD .OHLQHU$QK”QJHU 7XQMDw LQ)RUPHLQHV0DQQHV PLW )HGHUNURQH XQG ]ZHL JURgHQ 2KUVSXOHQ GLH DXFK DOV $XIK”QJH¤VHQ GLHQWHQ *U©QVSDQ VRQVW LQWDNW 4XLPED\D  Q &KU H  k FP J *ROGEOHFK JHK”PPHUW 1DVHQULQJ ,QWDNW 6LQ¦ FD  Q &KU I  % FP %URQ]HEOHFK )UDJPHQWLHUWHU NOHLQHU .RSI PLW HLQJHOHJWHQ 3XSLOOHQ*U©QH3DWLQD0RFKHFDY&KU6 Stück! u

3URYHQLHQ] ([ 1DFKODVV .DULQ .RUWH %D\HUQ GDYRU )DPLOLHQEHVLW] Deutschland seit den 1920er Jahren.

&ROOHFWLRQRIVL[SUHFROXPELDQPHWDOZRUNREMHFWVFRPSULVLQJWZR,QFDDQG one Calima tweezers, one gold Sinú nose ornament, a small Tumbaga an thropomorphic pendant from the Quimbaya culture and a rare fragmented Mochica copper head. All in very good condition. 6 pieces!

Collection of Russian and Greek icons: a) Big icon with multiple miniature Christ scenes; b) Carved icon with Christ Pantocrator; c) An icon in form of a lunette with Annunciation; plus a pocket icon with Madonna and Child and DSDLURIVPDOOFDUYHGDOWDUZLQJVZLWKWKH(YDQJHOLVWVWKWKFHQWXU\ $' 3DUWLDOO\ FKLSSLQJ FUDFNV DQG GDPDJH IURP }UH SLFWXUHV PRVWO\ LQ D good condition. 5 pieces! Two icons with expert reports from Icon Museum Schloss Autenried! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung osmanischer Keramik.    -K Q &KU 9LHU ZHLgJUXQGLJH7HOOHUGDYRQGUHLPLW~RUDOHP'HNRUXQGHLQHU PLW*HE”XGH k[MHFDFP[FP &DQDNNDOH -KPLQ%HVWRgXQJHQ$XgHUGHPHLQZHLgJUXQGLJHV6FK”OFKHQ +FPkFP LPFKLQHVLVFKHQ6WLOXQGHLQ7¤SIFKHQPLW EODXHP%OXPHQGHNRU +FP $XgHUGHP]ZHL6FKHUEHQ8 Stück! u 3URYHQLHQ] ([ 1DFKODVV .DULQ .RUWH %D\HUQ GDYRU )DPLOLHQEHVLW] Deutschland seit den 1920er Jahren. =XU6FKDOHPLW*HE”XGHYJO&DPEULGJH)LW]ZLOOLDP0XVHXP& Collection of ottoman pottery comprising four Canakkale dishes, two mini DWXUHYHVVHOVDQGDQGWZRVKHUGVWKWKFHQWXU\$'0LQRUGHQWV8 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 *ROGHQH *HZDQGQDGHO &DOLPD    Q &KU / FP J /DQJH *HZDQGQDGHO PLW UXQGHU 6FKHLEH DOV REHUHP $EVFKOXVV*ROG,QWDNW u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. *ROGHQFORDNSLQ,QWDFW&DOLPD$' VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Drei praekolumbische Ketten. D  / FD FP .HWWH DXV FUHPHIDUEHQHQ 0XVFKHOVFKHLEHQ PLW NOHLQHQ ]DSIHQDUWLJHQ $QK”QJHUQ 1HXH )”GHOXQJ LQWDNW &KLP¦ FD  Q &KUE /FP.HWWHDXVNOHLQHQEUDXQHQEHLJHQXQGJU©QHQ 0XVFKHOVFKHLEFKHQ 1HXH )”GHOXQJ LQWDNW 7DLURQD   Q &KU F  / FD FP .HWWH DXV NOHLQHQ EHLJHEUDXQHQ 0XVFKHOVFKHLEHQPLWEURQ]HQHQJORFNHQI¤UPLJHQ$QK”QJHUQ HLQ$QK”QJHUDXVEUDXQOLOD6WHLQ*U©QH3DWLQDLQWDNW7DLURQD Q&KU3 Stück! u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. 7KUHHSUHFROXPELDQVKHOOEHDGQHFNODFHVRQHZLWKEHOOVKDSHGSHQGDQWV9HU\ JRRGFRQGLWLRQPRGHUQVWUDQJ&KLP¦DQG7DLURQDFD$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

360


 Sammlung von Kettengliedern aus Jade. *XDQDFDVWHQ &KU.HWWHQJOLHGHUDXVSROLHUWHPKHOOJU©QHQXQGGXQNHOJU©QHQ -DGHLW LQ 6WDEIRUP HLQHU JURgHQ .XJHO UXQGHQ 6FKHLEHQ =\OLQGHUQ XQG HLQHU $Q]DKO ]RRPRUSK JHVWDOWHWHU 6WHLQH 30 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Collection of jade beads in various shapes and sizes. Very good condition! 30 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Bronzene Kettenglieder. 6LQ¦FDQ&KU+MHZHLOV FDFP$QK”QJHU+FDFP%URQ]H/HJLHUXQJ6LHEHQNOHLQH NXJHOI¤UPLJH $QK”QJHU GLH MHZHLOV HLQ PHQVFKOLFKHV *HVLFKW XQGHLQHVHPLWHLQHPGDUDXIVLW]HQGHQ7LHU]HLJHQ'D]XJH K¤UWHLQDOVPHQVFKOLFKHU.RSIJHDUEHLWHWHU$QK”QJHUPLW5DV VHOIXQNWLRQ DXI GHP ]ZHL 9¤JHO 5©FNHQ DQ 5©FNHQ VLW]HQ 8 Stück!.RUURGLHUWZHLWJHKHQGLQWDNW u

 6DPPOXQJ YRQ SUDHNROXPELVFKHQ 2EMHNWHQ DXV %URQ]H D  / FP%URQ]H9LHU1DGHOQDPREHUHQ(QGHDOV7LHUN¤SIHJH VWDOWHW *U©QH 3DWLQD LQWDNW 6LQ¦  Q &KU E  % FD FP %URQ]H .OHLQH 0DVNH YHUPXWOLFK DXVJHVFKQLWWHQHV 0LW WHOVW©FNHLQHV3HNWRUDOVGLH$XJHQZHLgJHI”UEW*U©QH3DWLQD HWZDVEU©FKLJ0RFKHQ&KUF +FP%URQ]H$Q K”QJHULQ)RUPHLQHV+DOEPRQGHVDXIGHPHLQ5DXEYRJHOLQ 9RUGHUDQVLFKWVWHKWGHUYRQ]ZHL9¤JHOQPLWODQJHQ6FKQ”EHOQ ~DQNLHUWZLUG*U©QH3DWLQDLQWDNW6LQ¦Q&KUG / FP%URQ]H5HFKWHFNLJH$SSOLNDWLRQLQ)RUPHLQHVPHQVFK OLFKHQ*HVLFKWHVPLW.RSIVFKPXFN*U©QH3DWLQDLQWDNWH / MHZHLOVFDFP(LQ6WHUQXQGHLQ)UDJPHQW*U©QH3DWLQD,QND Q&KU9 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 0.%D\HUQ &ROOHFWLRQRISUHFROXPELDQEURQ]HREMHFWVFRPSULVLQJIRXU6LQ¦ELUGVWDII} QLDOV $' DVPDOOPDVNIURPWKH0RFKHFXOWXUH  A.D.), a Sinú pendant showing three birds, a Moche application in form of DKXPDQIDFHDQGRQH,QFDVWDUDQGDIUDJPHQW $' 9 pie ces!

3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg.

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Sinú copper alloy chain links with human faces once linked together to form DQHFNODFHWKHFHQWUDOSLHFHZLWKWZRELUGVDWWKHWRSDQGUDWWOHIXQFWLRQ:HOO SUHVHUYHG$'8 pieces!

 Sammlung von vier tumiförmigen Beilen. ,QNDQ&KU D /FP%URQ]H%UHLWHV5LWXDOEHLOPLWKDOEPRQGI¤UPLJHU 6FKQHLGHRKQH*ULII*U©QH3DWLQDPLW6SXUHQYRQ7H[WLOLHQE  /FP%URQ]H5LWXDOEHLOPLWEUHLWHP6FKDIW*U©QH3DWLQD 7H[WLOUHVWH 6FKQHLGH HWZDV EHVFK”GLJW F  / FP %URQ]H .OHLQHV5LWXDOEHLO*U©QH3DWLQD$EGU©FNHYRQ7H[WLOLHQG / FP%URQ]H5LWXDOEHLOPLWODQJHPJHUDGHQ6FKDIW*U©QH 3DWLQD $XVEUXFK DP REHUHQ 7HLO GHV 6FKDIWHV 7H[WLOUHVWH 4 Stück! u

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Teile von Abschlussborten. 1D]FDFDQ&KUD +MHZHLOV FDFP*HI”UEWH$OSDNDZROOH,Q9HUVFKOLQJXQJVWHFKQLNKHUJH VWHOOWH%O©WHQXQGHLQ3DSDJHLDOV7HLOGHU$EVFKOXVVERUWHHLQHV 7RWHQWXFKHV3 Stück! u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. 7H[WLOH1D]FDRXWHUPRVWERUGHULQIRUPRI~RZHUVDQGDSDUURWPDGHIURP FRORXUHGDOSDFDZRRO9HU\JRRGFRQGLWLRQ$ERXW$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3.HUZRUEHQ  &ROOHFWLRQRIIRXU,QFDFRSSHUFHUHPRQLDOWXPLZHOOSUHVHUYHGJUHHQSDWLQD DQGWH[WLOHVFUDSV$'4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Dreikantstein. %DKLD GH &DYDTXH] FD  Y   Q &KU / FP +HOOJU©QHU .DONVWHLQ 6WDUN VWLOLVLHUWHV *HVLFKW GLH $XJHQXQGGHU0XQGDOVNOHLQHVFKPDOH.HUEHQJHVWDOWHWDP REHUHQEUHLWHQ(QGHGLH+DDUHLP=DKQVFKQLWWPXVWHUDQJHJHEHQ =ZHLGLDJRQDOH'RSSHOOLQLHQV\PEROLVLHUHQGLH$UPH,QWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH 9JO ]X GLHVHP 6W©FN &OD\ 6KDPDQV DQG 6WRQH -DJXDUV 0XVHXP RI (WKQRJUDSK\%XGDSHVW  61U :HGJHVKDSHGVWRQHPDGHIURPJUHHQLVKOLPHVWRQHVKRZLQJDKXPDQIDFHLQ rigorously stylized form. Restored at top, otherwise intact. Bahia de Cavaquez, FD%&$' VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

361


 Kleines Steinidol. 0H]FDOD 3U”NODVVLVFK FD   Y &KU + FP *UDXHU 6WHLQ )ODFKH VWHKHQGH PHQVFKOLFKH )LJXU PLW NXU]HQGXUFKHLQHEUHLWH)XUFKHYRQHLQDQGHUJHWUHQQWHQ%HLQHQ (LQH KRUL]RQWDOH 5LQQH WUHQQW GLH %HLQH YRP 8QWHUN¤USHU GHU NDQWLJH IDVW TXDGUDWLVFKH .RSI PLW GHP VFKHPDWLVFKHQ *HVLFKWLVWYRP5XPSIGXUFK]ZHLWLHIHVHLWOLFKH(LQNHUEXQJHQ DEJHVHW]W,QWDNW u 3URYHQLHQ]$XVGHU3ULYDWVDPPOXQJ-66©GGHXWVFKODQGLQGHQHU HU-DKUHQLPHQJOLVFKHQ.XQVWKDQGHOHUZRUEHQ $ 0H]FDOD VWRQH }JXUH /DWH 3UHFODVVLF SHULRG &DUYHG ZLWK ~DWWHQHG IRUHKHDGDQGJURRYHGPRXWKORQJWRUVRDQGVKRUWOHJV,QWDFWFD B.C. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Drei männliche Figuren aus verschiedenen praekolumbischen Kulturen. D +FP5¤WOLFKHU7RQ6WDWXHWWHHLQHV6FKDPDQHQ PLW JURgHU NXJHOLJHU +DOVNHWWH XQG 1DVHQ XQG 2KUS~¤FNHQ DP OLQNHQ $UP K”QJW HLQ NOHLQHU 5XQGVFKLOG $EEU©FKH LP XQWHUHQ %HUHLFK 0D\D  Q &KU E  + FP *UDXHU 7RQ 6WDWXHWWH HLQHV 6FKDPDQHQ GHU DXI HLQHU QLHGULJHQ %DQN VLW]WXQGPLWEHLGHQ+”QGHQHLQHGLFNH6FKODQJHXPNODPPHUW K”OW DP OLQNHQ $UP K”QJW HLQ NOHLQHU 5XQGVFKLOG $XI GHP .RSI WU”JW HU HLQHQ .UDQ] GDV JXW DXVPRGHOOLHUWH *HVLFKW ]HLJW 7”WRZLHUQDUEHQ ,P XQWHUHQ 7HLO DEJHEURFKHQ UHFKWHV 2KU IHKOW /D 7ROLWD  Y Q &KU F  + FP 7RQ PLW EUDXQU¤WOLFKHU%HPDOXQJ6WDWXHWWHHLQHVVLW]HQGHQ0DQQHVPLW EUHLWHU +DOVNHWWH JURgHQ 2KUVSXOHQ XQG HLQHP +DDUVFKPXFN DXVNXU]HQ)HGHUQ%HVWRgXQJDQGHU1DVHVRQVWLQWDNW0D\D FDQ&KU3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV

 Pärchen aus Stein. $WODQWLVFKH $EGDFKXQJ FD    Q &KU+FP/FP'XQNOHUSRU¤VHUYXONDQLVFKHU6WHLQ (LQH)UDXOLQNVXQGHLQ0DQQUHFKWVVWHKHQQHEHQHLQDQGHUDQ GHQ 2EHUDUPHQ PLWHLQDQGHU YHUEXQGHQ %HLGH KDEHQ MHZHLOV HLQH+DQGDXIGHQ8QWHUOHLEJHOHJWGLH)UDXWU”JWLPUHFKWHQ $UP HLQHQ DEJHVFKODJHQHQ PHQVFKOLFKHQ .RSI GHU 0DQQ K”OW LQ GHU JHVHQNWHQ 5HFKWHQ HLQHQ UXQGHQ XQGH}QLHUEDUHQ *HJHQVWDQG .OHLQH $XVEHVVHUXQJ DP UHFKWHQ 2EHUDUP GHU )UDXVRQVWLQWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH Naked couple, standing next to each other, connected together with their upper arms. The woman holds a human head in her right arm. Restoration DWXSSHUULJKWDUPRIWKHZRPDQRWKHUZLVHLQWDFW$WODQWLF:DWHUVKHGFD $' VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Mann, der sich den Kopf hält. &KDUFKœ FD    Q &KU + FP *UDXHU 7RQ PLW URWEUDXQHU %HPDOXQJ 1DFNWHU VWHKHQGHU0DQQXPGLH7DLOOHHLQHQEUHLWHQ*©UWHOWUDJHQGGHU DP 5©FNHQ PLW HLQHU HUKDEHQHQ RYDOHQ 6FKOLHgH YHU]LHUW LVW 'HU0DQQKDWHLQHKDOEODQJH3RQ\IULVXUXQGKHEWGHQUHFKWHQ $UP ZLH VDOXWLHUHQG DQ GHQ .RSI GLH /LQNH KDW HU DXI GHQ 5©FNHQJHOHJW)DFKP”QQLVFKUHVWDXULHUWH%U©FKHDP+DOVXQG DPUHFKWHQ2EHUDUPVRQVWLQWDNW u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 0.%D\HUQ 9HUPXWOLFK]HLJWGLH*HVWHDQGDVVGHU0DQQ.RSIVFKPHU]HQ]XHUWUDJHQ KDWGLHHUPLWGHP.DXHQYRQ.RND%O”WWHUQEHN”PSIW $VPDOO&DUFKœVWDWXHWWHRIDPDQFHZLQJFRFDDQGKROGLQJKLVKHDG GXHWR his headache?). Clay painted in reddish brown. Neatly restored at neck area DQGULJKWXSSHUDUPRWKHUZLVHLQWDFWFD$' VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

362

Three male statuettes: a) Standing priest or god. Lower section broken off. 0D\DFD$'E 6KDPDQVHDWHGKROGLQJDVHUSHQW'DPDJHVDW ERWWRP/D7ROLWDFD%&$'F 6WDWXHWWHRIDFURXFKLQJPDQ ,QWDFW0D\DFD$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 9LHU SUDHNROXPELVFKH }J©UOLFKH *HI”gH D  + FP 7RQ PLW U¤WOLFKHU*ODVXU.RSIJHI”gPLWGHP*HVLFKWHLQHV0DQQHVGHU HLQH XQWHU GHP .LQQ JHEXQGHQH +DXEH WU”JW $XV PHKUHUHQ )UDJPHQWHQ UHVWDXULHUW 0RFKH 9 FD  Q &KU E  + FP*UDXHU7RQPLWKHOOHPEHU]XJ6LW]HQGH+RKO}JXUPLW KRKHU URWHU +DXEH XQG JURgHQ URWHQ 6SXOHQRKUULQJHQ $UPH XQG%HLQHOLQNVQXULP$QVDW]YRUKDQGHQUHFKWVJDQ]YHUORUHQ -DPD&RDTXHQ¤UGOLFKH.©VWHFDQ&KUF +FP 5¤WOLFKJUDXHU 7RQ 6WHKHQGH ZHLEOLFKH )LJXU PLW QDFNWHP 2EHUN¤USHU XQG NXU]HP QHW]DUWLJHP 6FKXU] GLH +DDUH ]X ]ZHL VHLWOLFKHQ =¤SIHQ JHGUHKW DP +LQWHUNRSI JHWHLOW XQG LQ GHQ 1DFNHQ IDOOHQG 5HFKWH %UXVW IHKOW VRQVW LQWDNW 7XPDFR YQ&KUG +FDFP+RKO}JXUHLQHVKRFNHQGHQ 0HQVFKHQ PLW GUHLHFNLJHP /HQGHQVFKXU] XQG KRKHU +DXEH GLHDQGHQ6HLWHQLQMHZHLOVHLQH/DVFKHPLWDXIJHOHJWHQ.XJHOQ DXVO”XIW'LH)LJXUKDWEHLGH+”QGH]XP.LQQHUKREHQ,QWDNW %DKLDYQ&KU4 Stück! u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. Four Precolumbian clay statuettes: a) Mochica portrait head vessel wearing DKHDGGUHVVHQFLUFOHGE\DKHDGEDQG5HVWRUHGIURPVHYHUDOIUDJPHQWVFD $'E 6HDWHGKROORZ}JXUHZHDULQJDUHGGRRPHGKHDGGUHVVDQG large spool earrings. Roots of left arm and leg, completly missing at right side. $'F 6WDQGLQJZRPDQZLWKORLQFORWKDQGOREHGFRLIIXUH5LJKW EUHDVWPLVVLQJRWKHUZLVHLQWDFW7XPDFR%&$'G &URXFKLQJ KXPDQ}JXUHZLWKGRRPHGKHDGGUHVVERWKKDQGVUDLVHGWRWKHFKLQ,QWDFW %DKLDFD%&$'4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 Zwei kleine sitzende Figuren. -DPD&RDTXHXQG/D7ROLWDD + FP+HOOJUDXHU7RQPLW5HVWHQYRQGXQNOHU%HPDOXQJ6LW]HQ GHP”QQOLFKH)LJXUPLWXQWHUJHVFKODJHQHQ%HLQHQGHUDXVODGHQ GH+LQWHUNRSIPLWHLQHUJODWWHQ+DXEHJHVFKP©FNWGLH2KUHQ GXUFKERKUW5HFKWHU)XgEHVFK”GLJWVRQVWLQWDNW/D7ROLWDFD YQ&KUE +FP/HLFKWU¤WOLFKHU7RQPLW5HVWHQ YRQGXQNOHU%HPDOXQJ+RKO}JXUHLQHVKRFNHQGHQ0DQQHVPLW 6FKXU]GLHUHFKWH+DQG]XP0XQGJHI©KUWGLHOLQNHOLHJWDXI GHP.QLH(UWU”JWHLQH+DXEHXQG2KUULQJHDQGHQ+DQGJH OHQNHQ$UPUHLIH.OHLQH%HVWRgXQJDPUHFKWHQ2KUULQJVRQVW LQWDNW-DPD&RDTXHFDYQ&KU2 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 0.%D\HUQ 7ZRVPDOOVLWWLQJFOD\}JXULQHVD 6ROLG}JXUHRIDVLWWLQJPDQZLWKKLVOHJV FURVVHG 2QH PLQRU GDPDJH DW ULJKW IHHW RWKHUZLVH LQWDFW /D 7ROLWD  %&$'E +ROORZ}JXUHRIDVTXDWWLQJPDQKROGLQJKLVULJKWKDQG up to the mouth. Tiny chip at right earring, otherwise perfect condition, Jama &RDTXH%&$'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHLSU”NROXPELVFKH2EMHNWHD  + FP 5¤WOLFKHU 7RQ PLW EU”XQOLFKHU%HPDOXQJ.RSIYRQGHU+RKO}JXUHLQHV:©UGHQ WU”JHUV ,P *HVLFKW HQJ ]XVDPPHQVWHKHQGH $XJHQ XQG HLQH KHUYRUVSULQJHQGH1DVHDQGHU6WLUQDQPRGHOOLHUWHU6FKPXFN $P 2EHUNRSI IIQXQJ YLHOOHLFKW ]XP (LQVDW] HLQHV *HI”gHV ,QWDNW 0DQWHQR FD  Q &KU E  + FP 5¤WOLFKHU 7RQ PLW 5HVWHQ YRQ VFKZDU]HU %HPDOXQJ 6WDWXHWWH HLQHV 6LW ]HQGHQGHUHLQHQPLWGUHLJURgHQUXQGHQ6FKHLEHQYHU]LHUWHQ 8PKDQJ HLQHQ SODVWLVFK PRGHOOLHUWHQ .RSIVFKPXFN XQG DXI GHP5©FNHQHLQHQNOHLQHQ6DFNWU”JW,QWDNW-DPD&RDTXHFD  Q &KU F  + FP 5¤WOLFKHU 7RQ PLW 5HVWHQ YRQ VFKZDU]HU%HPDOXQJ+RKO}JXULQHLQ)RUPHLQHV0HQVFKHQPLW +XQGHJHVLFKW,QWDNW7XPDFRFDYQ&KU3 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH 7KUHH3UHFROXPELDQFOD\REMHFWVD +HDGRIDKROORZ}JXULQHRIDGLJQLWDU\ ,QWDFW0DQWHQRFD$'E 6HDWHGVWDWXHWWHRIDPDQZHDULQJ DULFKO\GHFRUDWHGFORDN-DPD&RDTXH$'F +ROORZ}JXULQH ZLWKDGRJIDFH7XPDFRDERXW%&$',QWDFW3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 2EHUWHLO HLQHU ZHLEOLFKHQ )LJXU 0DFKDOLOOD&KRUUHUD FD  Y&KU+FDFP7RQPLW5HVWHQYRQ%HPDOXQJLQ URWHP*LWWHUPXVWHU)ODFKDXVJHIRUPWHU.RSIXQG2EHUN¤USHU HLQHU KDQGJHIHUWLJWHQ )LJXU PLW VHSDUDW DQJHDUEHLWHWHQ $XJHQ 1DVH XQG %U©VWHQ GLH $UPH DOV 6WXPPHO JHVWDOWHW 'LH 2K UHQSDUWLHLVWMHZHLOVYRQYLHUNOHLQHQ/¤FKHUQGXUFKERKUWMit 7/$QDO\VHYRP2NWREHU u

 Sammlung von fünf präkolumbischen Köpfchen. D  + FP *UDXHU 7RQ .RSI HLQHU +RKO}JXU GLH HLQHQ DOWHQ ]DKQORVHQ 0DQQPLWHLQJHIDOOHQHP0XQGXQGHLQJHULW]WHQ)DOWHQDXIGHQ :DQJHQGDUVWHOOW)HKOVWHOOHQDQ1DVHXQG0XQGVRQVWLQWDNW /D7ROLWDFDYQ&KU H[+LUVFK$XNWLRQ 6HSWHPEHU1U E +FDFP*UDXHU7RQPLWU¤W OLFKEUDXQHP EHU]XJ .RSI HLQHU ZHLEOLFKHQ +RKO}JXU PLW .RSISXW]EUHLWHP1DVHQULQJXQGGUHL.LQQS~¤FNHQ7HLOHGHV .RSISXW]HV XQG GHU 1DVH IHKOHQ VRQVW LQWDNW -DPD&RDTXH FD  Q &KU H[ +LUVFK $XNWLRQ   6HSWHPEHU 1U F +FDFP*UDXHU7RQPLW%HPDOXQJLQ &UHPH XQG 2UDQJH .RSI HLQHU ZHLEOLFKHQ +RKO}JXU PLW KR KHP.RSISXW]GHUPLWVHLWOLFKHQ$SSOLNDWLRQHQYHU]LHUWLVW,Q WDNW -DPD&RDTXH FD  Q &KU H[ +LUVFK $XNWLRQ 6HSWHPEHU1U G +FP+HOOHU7RQ.RSI HLQHUZHLEOLFKHQ+RKO}JXUPLWKRKHP.RSISXW]DXVNOHLQHQ)H GHUQXQGPLWGUHLIDFKHQ2KUULQJHQ'DV*HVLFKWLVWPLWHLQHP 1DVHQXQGHLQHP.LQQS~RFNJHVFKP©FNW)HKOVWHOOHQDP+LQ WHUNRSI VRQVW LQWDNW -DPD&RDTXH FD  Q &KU H[ +LUVFK$XNWLRQ6HSWHPEHU1U H +FP 'XQNHO JHEUDQQWHU 7RQ .RSI HLQHU ZHLEOLFKHQ +RKO}JXU PLW HLQHUHQJDQOLHJHQGHQ+DXEH'UHLIDFK2KUULQJHQXQG1DVHQ S~RFN,QWDNW H[+LUVFK$XNWLRQ6HSWHPEHU1U  5 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH &ROOHFWLRQ RI }YH IHPDOH OLWWOH KHDGV IURP KROORZ }JXUHV ZHDULQJ LPSUHVVL YHKHDGJHDUV7HUUDFRWWDDQGJUH\FOD\PRVWO\LQWDFW-DPD&RDTXHDQG/D 7ROLWDFD%&$'5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL SU”NROXPELVFKH .HUDPLN2EMHNWH /D 7ROLWD FD  Y  Q&KUD +FP+HOOJUDXHU7RQ.RSIHLQHUP”QQOL FKHQ+RKO}JXUPLW2KUULQJHQXQGHLQHPEUHLWHQ.RSIEDQGGDV YRUQHLQHLQHQJURgHQ.QRWHQDXVO”XIW'LHEUHLWHIIQXQJDP 2EHUNRSI O”VVW YHUPXWHQ GDVV GLH 6WDWXH DOV 7U”JHU I©U HLQHQ 7HOOHUYHUZHQGHWZXUGH%HVFK”GLJXQJHQDQGHQ2KUHQVRQVW LQWDNW ([+LUVFK$XNWLRQ6HSWHPEHU1U  E FP[FDFP+HOOJUDXHU7RQ.OHLQH5HOLHISODWWHPLW GHU'DUVWHOOXQJHLQHVHQJXPVFKOXQJHQOLHJHQGHQ3DDUHVLQ'U DXIVLFKW2EHQ]ZHLIDFKJHERKUW3DUWLHOOGXQNOH9HUI”UEXQJHQ VRQVWLQWDNW2 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH 7ZRFHUDPLF3UH&ROXPELDQREMHFWV/D7ROLWDFD%&$'D  0RXOGPDGH KROORZ }JXULQH KHDG ZHDULQJ DQ RUQDPHQWHG KHDG EDQGDJH PRGHOOHGVHSDUDWHO\6PDOOGDPDJHVDWWKHHDUVRWKHUZLVHLQWDFWE 0RXOG PDGH}JXULQHGHSLFWLQJDUHFOLQLQJFRXSOHLQHPEUDFH7KHPRGHOOLQJLVUHOLHI like, the back is coarse. Partly dark stains, otherwise intact. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]([*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ 'HXWVFKODQG HU -DKUH EHL +LUVFK 1DFKIROJHU $XNWLRQ /RV 7RUVRRIDKDQGPDGH}JXUHPDGHIURPFOD\ZLWKUHPDLQVRIDSDLQWHGODWWLF pattern. The eyes, the nose and the mouth were applied to the face separately DQGLQFLVHG6XUIDFHZHDWKHUHGVPDOOGDPDJHRQWKHEDFNVLGH0DFKDOOLOD &KRUUHUDFD%&:LWK7/DQDO\VLVIURP VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

363


 Zwei Köpfchen. 9DOGLYLD0LWWOHUH.©VWHFDY&KU D  + FP *UDXHU 7RQ PLW 5HVWHQ YRQ U¤WOLFKHU %HPDOXQJ 6WDUN VWLOLVLHUWHU .RSI HLQHU ZHLEOLFKHQ )LJXULQH DXV 0RGHO JHSUHVVW PLW HLQHU WUDSH]I¤UPLJHQ (LQWLHIXQJ LP 6WLUQEHUHLFK 8QWHQDEJHVSOLWWHUWE +FDFP6WDUNVWLOLVLHUWHU.RSIHLQHU ZHLEOLFKHQ )LJXULQH PLW JHULW]WHQ +DDUHQ ,P XQWHUHQ %HUHLFK DEJHEURFKHQ2 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH 9JO ]X GLHVHQ 6W©FNHQ &OD\ 6KDPDQV DQG 6WRQH -DJXDUV 0XVHXP RI (WKQRJUDSK\%XGDSHVW  6I1U 7ZRVPDOO9DOGLYLDVW\OL]HGIHPDOHKHDGVFOD\ZLWKUHPDLQVRIDUHGGLVKVOLS :HOOSUHVHUYHGFD%&2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL0LQLDWXU.¤SIH$WODQWLVFKH$EGDFKXQJ6S”WH3HULRGHFD Q&KUD +FP7RQPLWKHOOEUDXQHPEHU]XJ XQG URWHU %HPDOXQJ 0”QQOLFKHU .RSI PLW 1DVHQS~RFN XQG HLQHU HQJ DQOLHJHQGHQ $GOHU+DXEH PLW .LQQULHPHQ REHUH *HVLFKWVK”OIWH URW EHPDOW ,QWDNW  E  + FP %HVFKUHLEXQJ ZLH YRUKHUJHKHQG 5DVVHOIXQNWLRQ .OHLQH %HVWRgXQJHQ VRQVW LQWDNW2 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUHH[+LUVFK1DFKIROJHU$XNWLRQ /RV 7ZR PLQLDWXUH PDOH KHDGV HDFK ZHDULQJ DQ HDJOHFDS &OD\ ZLWK UHGGLVK brown slip and remains of black painting. Small bruises on smaller head, WKH RWKHU LQWDFW $WODQWLF :DWHUVKHG /DWH 3HULRG FD    $' 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei kleine Masken. 0LWWHODPHULNDFDYQ&KUD + FP*UDXHU7RQ0DVNHPLWGHP*HVLFKWHLQHV0DQQHVPLW YRQHLQHUZXOVWLJHQ6WLUQSDUWLH©EHUVFKDWWHWHQVFKPDOHQ$XJHQ HLQHUDXIJHZRUIHQHQ~HLVFKLJHQ1DVHXQGHLQHPEUHLWHQ0XQG PLWZXOVWLJHQ/LSSHQ'DVJODWWH+DDULVWLQGHU0LWWHJHVFKHLWHOW GLH2KUHQKDEHQ/¤FKHUGHU6FK”GHO]XU$XIK”QJXQJKRUL]RQWDO GXUFKERKUW ,QWDNW E  + FP *UDXHU 7RQ 0DVNH PLW ZHLW JH¤IIQHWHP0XQGXQGJURgHQDXIJHULVVHQHQUXQGHQ$XJHQGHU 1DVHQU©FNHQVDWWHOI¤UPLJ,QWDNW2 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 0.%D\HUQ Two small Middle American masks with characteristic faces, made from gray FOD\,QWDFWFD%&$'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHLNOHLQHSUDHNROXPELVFKH2EMHNWHDXVYHUVFKLHGHQHQ.XOWXUHQ D /FDFP*UDXHU7RQPLW5HVWHQYRQVFKZDU]HU%HPDOXQJ 0LVFKZHVHQ PLW )LVFKVFKZDQ] PHQVFKOLFKHQ +”QGHQ XQG )©gHQXQGHLQHP5DXEWLHUJHVLFKWGDVYRQHLQHP6WUDKOHQNUDQ] HLQJHUDKPWLVW,QWDNW7XPDFRYQ&KUE /FP 7RQPLWU¤WOLFKEUDXQHUXQGVFKZDU]HU(QJREH3IHLIHLQ)RUP HLQHVNOHLQHQ$IIHQ,QWDNW-DPD&RDTXHQ&KUF + FP7RQPLWRFNHUIDUEHQHUXQGU¤WOLFKHU%HPDOXQJ.OHLQHU VWHKHQGHU0DQQPLWNXU]HP6FKXU]0HKUIDFKJHNOHEW-DPD &RDTXHQ&KU3 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 0.%D\HUQ 7KUHH VPDOO SUHFROXPELDQ REMHFWV PDGH IURP FOD\ D  +\EULG EHLQJ SDUW KXPDQ DQG SDUW}VK ,QWDFW 7XPDFR  %&   $' E  2FDULQD LQ IRUPRIDOLWWOHPRQNH\,QWDFW-DPD&RDTXH$'F 6WDWXHWWH RIDVWDQGLQJPDQ6HYHUDOJOXHGEUHDNV-DPD&RDTXH$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ I©QI NOHLQHQ SUDHNROXPELVFKHQ 2EMHNWHQ DXV verschiedenen Kulturen. D +FDFP*UDXHU7RQPLWVFKZDU]HU (QJREH.OHLQH5DVVHOPLWVWLOLVLHUWHP-DJXDU=ZHL/¤FKHUDP 5©FNHQ]XU$XIK”QJXQJGXUFKERKUWLQWDNW0DQWHQR Q&KUE kFP*UDXHU6WHLQ5XQGH6SLQQZLUWHOLQ)RUP HLQHU.U¤WH,QWDNW&KDYLQ+RFKODQGFDY&KUF k FDFP*UDXHU6WHLQ6SLQQZLUWHOLQ)RUPHLQHVQLFKWQ”KHU]X EH]HLFKQHQGHQ7LHUHV,QWDNWZLHEG kFP*UDXHU6WHLQ 6SLQQZLUWHOLQ)RUPHLQHVNOHLQHQ$IIHQGLHUHFKWH9RUGHUSIRWH LQ GHQ 0XQG JHVWHFNW ,QWDNW ZLH F H  / FP %U”XQOLFKHU 6WHLQ/LQVHQI¤UPLJH6SLQQZLUWHOPLWHLQJHULW]WHQJHRPHWULVFKHQ 0XVWHUQ,QWDNWZLHG5 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 0.%D\HUQ $FROOHFWLRQRI}YHVPDOOSUHFROXPELDQREMHFWV2QHUDWWOHPDGHIURPJUH\LVK FOD\LQIRUPRIDMDJXDU 0DQWHR$' DQGIRXUORRPZHLJKWV three of them zoomorphic, one with incised ornamental decoration, Chavin, %&$OOLQYHU\JRRGFRQGLWLRQ5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHL VLW]HQGH 0LQLDWXU6WDWXHWWHQ %DKLD  Y   Q &KU +    FP 7RQ PLW 5HVWHQ YRQ %HPDOXQJ 'UHL NOHLQH VLW]HQGH)LJ©UFKHQGLH$UPHDXIGLH.QLHJHVW©W]WGHQ.RSI LQ GHQ +”QGHQ KDOWHQG -HGH WU”JW HLQH KRKH +DXEH 3 Stück! ,QWDNW u Provenienz: Bei Gorny & Mosch Auktion 260, 2018, Los 509; ex Sammlung 0.%D\HUQ 7KUHH PLQLDWXUH IHPDOH VHDWHG }JXULQHV ZLWK WKHLU KDQGV UHVWLQJ RQ WKHLU NQHHVWKHKHDGVLQWKHLUKDQGV,QYHU\JRRGFRQGLWLRQ%DKLD%& A.D. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

364


 6DPPOXQJ YRQ SUDHNROXPELVFKH 0HQVFKHQ XQG 7LHU}J©UFKHQ aus verschiedenen Kulturen. D /FP*UDXHU7RQPLWU¤WOL FKHU%HPDOXQJ*©UWHOWLHU)DUEHOHLFKWDEJHULHEHQVRQVWLQWDNW 9DOGLYLDY&KUE +FP*UDXHU7RQ6WDUNVWL OLVLHUWH6WDWXHWWHHLQHU)UDX,QWDNW+HUNXQIWZLHDF +FP *UDXHU7RQ5DXENDW]HVLFKDQHLQHQ6WDPPNODPPHUQG,Q WDNW&KDYLQY&KUG +MHZHLOVFP*UDXHU7RQ =ZHL2SRVVXPVMHZHLOVDQLKUHQ6FKZÂ&#x201D;Q]HQNQDEEHUQG,QWDNW +HUNXQIWZLHFH $OOLJDWRU,QWDNW+HUNXQIWZLHFI /FP *UDXHU 7RQ .OHLQHV %Â&#x201D;QNFKHQ LQ )RUP HLQHV JHVFKZÂ&#x201D;Q]WHQ YLHUI©gLJHQ 7LHUHV ,QWDNW +HUNXQIW ZLH F J  / FP *UDX HU7RQ)OLHJHQGHU9RJHO,P%UXVWEHUHLFKXQGDQHLQHP)O© JHONOHLQH%HVWRgXQJVRQVWJXWHUKDOWHQ0RGHUQH$XIKÂ&#x201D;QJXQJ 3DUDFDV%&K +FP*UDXHU7RQPLWVFKZDU]HU (QJREH (XOH ,QWDNW PRGHUQH 6RFNHOXQJ +HUNXQIW ZLH J 9 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ 0.%D\HUQ Nice collection of nine zoomorphic miniature statuettes from the early cultures RI9DOGLYLD FD%& &KDYLQ FD%& DQG3DUDFDV %& LQFOXGLQJDQRZOD~\LQJELUGWZRRSRVVXPVDQDPDGLOOR DMDJXDUFOLQJLQJWRDWUXQNDQGD9DOGLYLDIHPDOH}JXULQH$OOYHU\ZHOOSUH served. 9 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 9LHUNOHLQHSUÂ&#x201D;NROXPELVFKH2EMHNWHD /FDFP*UDXHU7RQ PLWKHOOEUDXQHU(QJREHXQGJHRPHWULVFKHP5LW]GHNRU3IHLIHLQ )RUPHLQHVVHKUVWLOLVLHUWHQYLHUI©gLJHQ7LHUHVPLWNOHLQHUYRU VSULQJHQGHU6FKQDX]H=XU3IHLIIXQNWLRQPHKUIDFKJHORFKW,Q WDNW&ROLPDYQ&KUE /FDFP%HVFKUHLEXQJ ZLH D D XQG E H[ +LUVFK$XNWLRQ  6HSWHPEHU 1U   F  + FD FP *UDXHU 7RQ PLW %HPDOXQJ LQ 5RW XQG 6FKZDU]PLW5LW]GHNRU.OHLQHVUXQGHVELNRQLVFKHV*HIÂ&#x201D;gPLW PHQVFKOLFKHP*HVLFKWGLH2KUHQDOV]ZHL+HQNHOJHVWDOWHW,Q WDNW&DUFKLQ&KUG +FP.RSIHLQHU6WDWXHWWH PLWYRUVSULQJHQGHU1DVHXQGDXIJHOHJWHU)ULVXUGLH+DDUHDOV 6WULFKOLQLHQ LQ GHQ 7RQ JHULW]W +DDU DP 2EHUNRSI DEJHSODW]W VRQVW JXW HUKDOWHQ (FXDGRU FD  Q &KU  6W©FN 0LW 7/ Analyse für d)! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH)©UG 7/$QDO\VH Four small Precolumbian objects: a) Zoomorphic whistle made from clay, co YHUHGZLWKOLJKWEURZQVOLSDQGJHRPHWULFDOLQFLVLRQVLQVKDSHRIDIRXUOHJJHG DQLPDO,QWDFW&ROLPD$'E $VD ,QWDFW&ROLPD $'F 6PDOOKXPDQHI}J\YHVVHO,QWDFW&DUFKL$'G 0DOH KHDGRIDVWDWXHWWHZLWKDFORVHO\PRXOGHGFRLIIXUHGHSLFWHGZLWK}QHYHUWLFDOO\ LQFLVHGOLQHV&RLIIXUH~DNHGRIIRQFURZQRIKHDGRWKHUZLVHZHOOSUHVHUYHG Ecuador, ca. 800 A.D. :LWK7/DQDO\VLVIRUG SLHFHV

 6DPPOXQJ YRQ 2EMHNWHQ DXV YHUVFKLHGHQHQ SUDHNROXPELVFKHQ Kulturen.  NOHLQH 2EMHNWH DXV 7RQ GDUXQWHU ]ZHL 'HFNHOIUDJPHQWH PLW 6FKODQJH XQG )URVFK HLQ 9DOGLYLD,GRO HLQH&KDQFD\/DPD6WDWXHWWHHLQ*HIÂ&#x201D;gIUDJPHQWPLWVLW]HQGHP 0DQQGHU7HRWLKXDFDQ.XOWXUHLQ0RFKH.RSIJHIÂ&#x201D;gGUHLDXV 0RGHOQ JHSUHVVWH PHQVFKOLFKH )LJXUHQ HLQ -DJXDU XQG HLQ .DLPDQ.RSI20 Stück! u 3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. Collection of small clay objects from different Precolumbian cultures comprising D9DOGLYLD}JXULQHWZROLGIUDJPHQWVWKUHHPRGHOSUHVVHGKXPDQ}JXUHV VHYHUDOHI}J\KHDGVDQGGLIIHUHQWDQLPDO}JXUHV$OOTXLWHZHOOSUHVHUYHG20 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQ]HKQSUDHNROXPELVFKHQ3IHLIHQXQG0LQLDWXU}JX ren. D +FP+HOOHU7RQPLWVFKZDU]HU%HPDOXQJ.OHLQHU 3DSDJHLHQYRJHO,QWDNW&KDQFD\FDE +FP+HO OHU 7RQ PLW VFKZDU]HU %HPDOXQJ 6LW]HQGHU 9RJHO PLW DXVJH EUHLWHWHQ)O©JHOQ,QWDNW&KDQFD\FDF /FDFP +HOOHU7RQPLWVFKZDU]HU%HPDOXQJ/LHJHQGH)LJXUPLWVSLW ]HU0©W]HG /FDFP+HOOHU7RQPLWVFKZDU]HU%HPDOXQJ 9LHUI©gLJHV7LHU *©UWHOWLHU" ,QWDNW&KDQFD\FD H  + FP 'XQNOHU 7RQ .RSI HLQHV 5DXEYRJHOV )UDJPHQW 0LWWHODPHULNDI /FP5¤WOLFKHU7RQ2FDULQDLQ)RUPHLQHV +XQGHV ,QWDNW 9LF¦V FD  Y Q &KU J  + FD FP 3IHLIH LQ )RUP HLQHV /DVWHQWUÂ&#x201D;JHUV 6DFN KLQWHQ DEJHEURFKHQ VRQVWLQWDNW0RFKHQ&KUK /FP+HOOHU7RQPLW VFKZDU]HU%HPDOXQJ3IHLIHLQ)RUPHLQHVNOHLQHQ7XFDQV,Q WDNW&KDQFD\FDL /FP7RQPLWEHLJHUXQG VFKZDU]HU%HPDOXQJ)O¤WHPLWYLHU/¤FKHUQGHUHQHLQHV(QGH LQHLQHPPHQVFKOLFKHQ.RSIDXVOÂ&#x201D;XIW0LWWLJUHVWDXULHUWHU%UXFK *XDQDFDVWH1LFR\D XP  Q &KU M  / FP 5¤WOLFKHU 7RQ .RSIHLQHV5HSWLOVPLWODQJHU6FKQDX]HXQGJH]DFNWHP.DPP )UDJPHQW9HUDFUX] " FDQ&KU10 Stück! u 3URYHQLHQ] $XV GHU 6DPPOXQJ +: %D\HUQ VHLW GHQ HU -DKUHQ erworben in den 1980er Jahren; ex Sammlung M.B., Hamburg. 1LFHFROOHFWLRQRIFOD\ZKLVWOHLQVWUXPHQWVDQGPLQLDWXUH}JXULQHVAll in very good condition! 10 pieces! VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÃ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

365


 6DPPOXQJ YRQ YLHU SUDHNROXPELVFKHQ 7RQREMHNWHQ XQG SIHL fen. D  + FP 'XQNHOJUDXHU 7RQ )O¤WH DP REHUHQ (QGH PHQVFKOLFKHU .RSI PLW )HGHUVFKPXFN *HNOHEWHU %UXFK LP REHUHQ%HUHLFK9HUVLQWHUXQJHQ0D\DFDQ&KUE  /FDFP%UDXQHU7RQPLW5LW]GHNRU)O¤WHLQ)RUPHLQHVNX JHOLJHQ9RJHOV.OHLQH$EVWRgXQJHQDQGHQ)©gHQXQG)O©JHOQ VRQVWLQWDNW*XDQDFDVWHFDQ&KUF +FDFP7RQ PLWEHLJHUVFKZDU]HUXQGURWHU%HPDOXQJ*HI”gLQ)RUPHLQHV 9RJHOVPLWDEQHKPEDUHP.RSI0HKUHUHJHNOHEWH%U©FKHDP .RSIVRQVWLQWDNW*UDQ&KLULTXLQ&KUG +FP 7RQPLWEHLJHUVFKZDU]HUXQGURWHU%HPDOXQJ.OHLQH6WDWXHW WHHLQHU0XWWHUGLHHLQ.LQGLPUHFKWHQ$UPK”OW,QWDNW*UDQ &KLULTXLQ&KU4 Stück! u

 =ZHL SUDHNROXPELVFKH *HI”gH D  + FP k FD FP *UDXHU 7RQPLWU¤WOLFKHPEHU]XJXQG%HPDOXQJPLWVFKZDU]HQXQG FUHPHIDUEHQHQ)HOGHUQ%UHLWH6FKDOHPLWGUHL1RSSHQI©gFKHQ LQQHQPLW5LW]GHNRULP.DPPVWULFK0XVWHUYHU]LHUW*HNOHEWHU %UXFKVRQVWLQWDNW*XDQDFDVWH1LFR\DFDQ&KUE  + FP 7RQ PLW VFKZDU]HU %HPDOXQJ .OHLQH DXV 0RGHO ~DFK JHSUHVVWH 6WDWXHWWH PLW EUHLWHP +DOVNUDJHQ XQG KRKHU KDOEUXQGHU .RSIEHGHFNXQJ GLH $UPH DXI GLH %UXVW JHOHJW .OHLQHUH %HVWRgXQJHQ VRQVW LQWDNW 0RFKH ,,, FD  Q Chr. 2 Stück! 35u

3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV

Two Precolumbian objects: a) Shallow bowl standing on nubbs, painted in EODFN DQG FUHDP RQ D UHGGLVK JURXQG 2QH FUDFN UHVWRUHG RWKHUZLVH LQ WDFW *XDQDFDVWH1LFR\D FD  $' E  6PDOO }JXULQH ZLWK GRRPHG headdress and wide collar, the arms resting on his breast. Small bumps, other ZLVHLQWDFW0RFKH,,,FD$'2 pieces!

Four small Middle American clay objects: a) Flute. Glued breakage at upper SDUW0D\DFD$'E :KLVWOHLQIRUPRIDVSKHULFDOELUG7LQ\ GDPDJHV*XDQDFDVWH$'F 9HVVHOVKDSHGDVELUGZLWKDGH tachable head. Glued breakages at head, otherwise in good condition. Gran &KLULTXL$'4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQQHXQSUDHNROXPELVFKHQ2EMHNWHQDXVYHUVFKLHGH nen Kulturen. D /FDFP6HUSHQWLQ$[W*HORFKWLQWDNW &KRUUHUD " Y&KUE +FDFP.OHLQHHLQKHQNHOLJH NXJHOLJH.DQQHDP5DQGPLWHLQJHULW]WHPJHRPHWULVFKHQ'H NRU+HQNHOIHKOWHLQLJH6SU©QJH0DQWHJQDQ &KUF +FP6LHEHQNOHLQH7HUUDNRWWD.¤SIH*XWHUKDO WHQ0D\DXQG9HUDFUX]FDQ&KU9 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[3ULYDWEHVLW] C.M., Berlin. Familienbesitz seit den 1920er Jahren. Collection of nine well preserved Precolumbian objects from different cultures: DVWRQHD[H &KRUUHUD"%& DURXQGHGMXJZLWKRQHQRZPLVVLQJ KDQGOH 0DQWHQD$' VHYHQVPDOOWHUUDFRWWDKHDGV 0D\D DQG9HUDFUX]FD$' 9 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQI©QISUDHNROXPELVFKHQ2EMHNWHQD +FP7RQ PLWEHLJHUXQGU¤WOLFKHU%HPDOXQJ0DVVLYHVWHKHQGHZHLEOLFKH )LJXUVLHWU”JWHLQHQ1DVHQULQJXQGHLQH+DOVNHWWHPLW3HNWRUDO 2KUULQJH XQG HLQH KDOEUXQGH +DXEH /LQNHU $UP XQG %HLQH DEJHEURFKHQ%DKLDYQ&KUE +FP RKQH6RFNHO  0HQVFKOLFKHU.RSIPLW1DVHQULQJ2KUULQJHQXQGKRKHU+DXEH .OHLQHU$XVEUXFKREHQVRQVWLQWDNW%DKLDYQ&KUF  +FP0DVVLYH7RQ}JXUPLWEHLJHUXQGVFKZDU]HU%HPDOXQJ XQG DXIZ”QGLJHP .RSI XQG .¤USHUVFKPXFN /LQNHU $UP IHKOWUHFKWH+DQGDEJHEURFKHQ9HUDFUX]Q&KUG  +FP0DVVLYH7RQ}JXUPLWEHLJHUXQGVFKZDU]HU%HPDOXQJ XQG DXIZ”QGLJHP .RSI XQG .¤USHUVFKPXFN 5HFKWHU $UP DEJHEURFKHQVRQVWLQWDNW9HUDFUX]Q&KUH +FP kFP7RQ6WHLOZDQGLJHNOHLQH6FKDOHSRO\FKURPEHPDOWPLW HLQHU }J©UOLFKHQ 6]HQH XQG GDU©EHU OLHJHQGHQ +LHURJO\SKHQ *URgHU$XVEUXFK0D\DFDQ&KU5 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RV6DPPOXQJ );02EHUED\HUQHU-DKUH &ROOHFWLRQ RI }YH SUHFROXPELDQ REMHFWV FRPSULVLQJ WZR PDVVLYH FOD\ }JXUHV IURPWKH9HUDFUX]FXOWXUH $' D%DKLDKHDGDQGD}JXULQH  %&$' DQGD0D\DERZO $' 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

366

3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$%HUOLQ 'HXWVFKODQGHU-DKUHELV

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHLSUDHNROXPELVFKH2EMHNWHD +FP5¤WOLFKHU7RQ)UDJ PHQWLHUWH%©VWHGHV5HJHQJRWWHV7ODORFPLWRIIHQHP0XQGXQG EULOOHQDUWLJHQ $XJHQULQJHQ $XVEUXFK DQ GHU OLQNHQ 6HLWH GHV .RSIVFKPXFNHV 0L[WHNLVFK FD  Q &KU E  + FP k FP 5¤WOLFKHU 7RQ 6WHLOZDQGLJH 6FKDOH PLW OHLFKW JH UXQGHWHP%RGHQXQG6SXUHQYRQ%HPDOXQJ,QWDNW0D\DFD  Q &KU F  k FP 5¤WOLFKHU 7RQ )ODFKHU 7HOOHU LQQHQ EHPDOW PLW HLQHP YLHUEO”WWULJHQ %O©WHQPRWLY XQG HLQHP )OHFKWPXVWHU)DUEHWHLOZHLVHYHUULHEHQVRQVWLQWDNW*XDQDFD VWH1LFR\DFDQ&KU3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Three Middle American clay objects: a) Fragmented bust of the Rain God 7ODORF0L[WHFFD$'E 0D\DQERZO,QWDFWFD $'F )ODWSODWHZLWK~RZHUDQGZLFNHUZRUNGHFRUDWLRQ,QWDFW*XDQDFDVWH 1LFR\DFD$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 (LQSUDHNROXPELVFKHV*HI”gXQGHLQ.RSIIUDJPHQW-DPD&RDTXH Q&KUD +FDFP7RQPLWGXQNHOXQGU¤WOLFK EUDXQHP EHU]XJ %DXFKLJH 9DVH PLW VSLW]HP %RGHQ ]ZHL NOHLQHQ VFKODXIHQI¤UPLJHQ +HQNHOQ XQG KRKHP $XVJXVV DQ HLQHU 6HLWH NOHLQH QLFKW PHKU HUNHQQEDUH $SSOLNDWLRQ )DUEH HWZDV DEJHULHEHQ VRQVW LQWDNW E  + FP *UDXHU 7RQ PLW U¤WOLFK EUDXQHP EHU]XJ .RSIIUDJPHQW HLQHU ZHLEOLFKHQ +RKO}JXUPLWKRKHU+DXEHXQGVHLWOLFKHQ/DVFKHQLP*HVLFKW 7”WRZLHUXQJVQDUEHQ XQG HLQ EUHLWHU 1DVHQULQJ 6HLWOLFKH /DVFKHQ WHLOZHLVH DEJHEURFKHQ VRQVW LQWDNW KLQWHQ PRGHUQH $XIK”QJXQJ2 Stück! u 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU $-DPD&RDTXHYHVVHODQGDHODERUDWHGKHDGIUDJPHQWLQJRRGFRQGLWLRQFD $'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!


 9LHU SUDHNROXPELVFKH 2EMHNWH &KLP¦ FD    Q &KU D +FP6FKZDU]JHVFKPDXFKWHU7RQ*URgHU&KXPLOFRw 7RUVR /LQNHV %HLQ DEJHEURFKHQ %HVFK”GLJXQJHQ DQ GHU 1DVHXQGDP.RSIE +FP6FKZDU]JHVFKPDXFKWHU7RQ $XVJXVVIUDJPHQW LQ )RUP HLQHV PHQVFKOLFKHQ .RSIHV PLW ]\OLQGHUI¤UPLJHU .RSIEHGHFNXQJ %HVFK”GLJXQJHQ DP 5DQG F  + FP 6FKZDU] JHVFKPDXFKWHU 7RQ $XVJXVVIUDJPHQW HLQHV *HI”gHV LQ )RUP HLQHV PHQVFKOLFKHQ .RSIHV PLW ]\OLQGHUI¤UPLJHU .RSIEHGHFNXQJ G  + FP 6FKZDU] JHVFKPDXFKWHU7RQ.OHLQHVWHLOZDQGLJH6FKDOH$XVEU©FKHDP 5DQG4 Stück! u

 =ZHL]RRPRUSKHSUDHNROXPELVFKH*HI”gH0RFKH9FD Q&KUD +FP*UDXHU7RQPLWU¤WOLFKHUXQGFUHPHIDUEHQHU %HPDOXQJ 6WHLJE©JHOJHI”g LQ )RUP HLQHV 7UXWKDKQV PLW DXI GLH %UXVW JHOHJWHP .RSI +HQNHO DEJHEURFKHQ )DUEH HWZDV YHUULHEHQE +FP*UDXHU7RQPLWU¤WOLFKHPEHU]XJXQG VFKZDU]HU %HPDOXQJ 6WHLJE©JHOJHI”g PLW TXDGHUI¤UPLJHP .¤USHUDXIGHPHLQ)DEHOZHVHQPLW.DW]HQNRSIVLW]W6SU©QJH LQGHU*ODVXUEHLGH2KUHQDEJHEURFKHQ2 Stück! u

3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ Helene Ferro, Bayern, vor 1968.

Two late Mochica zoomorphic vessels: a) Turkey, handle lost, surface slightly worn off. b) Small stirrup vessel in form of a fabulous creature lying on a cu ERLGERG\&UDFNVLQWKHFRDWHDUVPLVVLQJFD$'2 pieces!

)RXU %ODFNZDUH REMHFWV IURPH WKH &KLP¦FXOWXUH FRPSULVLQJ D ODUJH &KXPLOFRwWRUVRDVPDOOERZODQGWZRIUDJPHQWHGVSRXWVFD A.D. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 *HI”gLQ)RUPHLQHVVLW]HQGHQ$IIHQ6LQX5LR0DJGDOHQD Q&KU " +FP5¤WOLFKJUDXHU7RQPLWGXQNHOJUDXHU %HPDOXQJ .OHLQHV *HI”g LQ )RUP HLQHV VLW]HQGHQ $IIHQ GHU VLFKPLWGHUUHFKWHQ+DQGGHQUXQGOLFKHQ.RSINUDXOWZ”KUHQG GLHOLQNHDXIGHPDQJH]RJHQHQ.QLHUXKW/HLFKWUHVWDXULHUW u Provenienz: Bei Gorny & Mosch Auktion 256, 2018, Los 558; bei Hirsch 1DFKIROJHU $XNWLRQ   /RV  H[ 6DPPOXQJ :HVWHUPDQQ Deutschland, 1960er Jahre. Small vessel in form of a seated monkey scratching its head. Clay with GDUNJUH\FRDWVOLJKWO\UHVWRUHG6LQX5LR0DJGDOHQD " FD A.D. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQYLHUSUDHNROXPELVFKHQ2EMHNWHQD +FP5¤W OLFKHU7RQ2YRLGHVDQWKURSRPRUSKHV*HI”gPLWDSSOL]LHUWHP PHQVFKOLFKHP.RSIXQG]ZHLDQPRGHOOLHUWHQ$UPHQXQG)© gHQ5HLFKH%HPDOXQJLQ5RWXQG6FKZDU]2EHUHU7HLOGHVOLQ NHQ$UPHVIHKOWVRQVWLQWDNW*XDQDFDVWHQ&KUE  +FP7RQ+RKO}JXUHLQHVVLW]HQGHQ0HQVFKHQGLH$UPH DXIGLH6FKHQNHOJHVW©W]W%HPDOXQJLQ%UDXQXQG6FKZDU]DXI EHLJHP*UXQG,QWDNW*UDQ&KLULTXLFDQ&KUF / FP+FDFP7RQ+RKO}JXUHLQHV2SRVVXPV%HPDOXQJLQ %UDXQXQG6FKZDU]DXIEHLJHP*UXQGDXIGHP5©FNHQJURgH UXQGHIIQXQJ,QWDNW*UDQ&KLULTXLFDQ&KUG + FDFP7RQ+RKO}JXUHLQHVKRFNHQGHQ0DQQHVPLWJH]DFN WHP .RSIVFKPXFN LQ GHU 5HFKWHQ 6FKDOH KDOWHQG %HPDOXQJ LQ 5RW XQG 6FKZDU] ,QWDNW *XDQDFDVWH  Q &KU 4 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Collection of four precolumbian objects: a) Anthropomorphic polychrome ves VHO3DUWRIOHIWDUPPLVVLQJRWKHUZLVHLQWDFW*XDQDFDVWH$' E 6HDWHGPDQSDLQWHGLQEURZQDQGEODFN,QWDFWF 2SRVVXPZLWKURXQGHG VSRXWDWEDFN,QWDFW%RWKIURPWKH*UDQ&KLULTXL&XOWXUHFD $'G 6HDWHGPDQZLWKERZO,QWDFW*XDQDFDVWH$'4 pie ces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$%HUOLQ 'HXWVFKODQGHU-DKUHELV

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL SUDHNROXPELVFKH *HI”gH D  + FP 5¤WOLFKHU 7RQ PLW FUHPHIDUEHQHU %HPDOXQJ *HI”g LQ )RUP HLQHU (XOH GLH DXI GHP 5©FNHQ HLQHQ KRKHQ $XVJXVV WU”JW )DUEH HWZDV DEJHULHEHQ UHFKWHV $XJH EHVFK”GLJW $XVJXVV JHEURFKHQ XQG ZLHGHUJHNOHEW0RFKH,,,FDQ&KUE +FP7RQ PLW %HPDOXQJ LQ +HOOEUDXQ %UDXQ XQG 6FKZDU] DXI EHLJHP *UXQG .OHLQHV %DQGKHQNHO.”QQFKHQ PLW KRKHP $XVJXVV ,QWDNW0LWWOHUH1D]FD3KDVHFDQ&KU2 Stück! u 3URYHQLHQ]$XVGHQ5HVWEHVW”QGHQGHU0©Q]KDQGOXQJ.DUO.UHVV0©QFKHQ vor 1980. 7ZR3UHFROXPELDQFOD\YHVVHOVD 2ZOSDLQWHGZLWKFUHDPGHFRUKLJKVSRXW RQWKHEDFNGDPDJHDWULJKWH\HVSRXWFUDFNHGDQGJOXHG0RFKH,,,FD $'E 6PDOO1D]FDSRWZLWKVWULSKDQGOHDQGKLJKVSRXW,QWDFW $'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHL*HI”gHD +FP'XQNHOJUDXHU7RQ*HI”gLQ3LOJHU~D VFKHQ)RUPwPLW]ZHL5HOLHIVDXIGHU9RUGHUXQG5©FNVHLWH GHU $XVJXVV DOV PHQVFKOLFKHV *HVLFKW JHVWDOWHW %HVFK”GLJXQJ DP$XVJXVVHWZDVDEJHULHEHQVRQVWLQWDNW,QNDQ &KUE +FP'XQNHOJUDXHU7RQ6WHLJE©JHOJHI”gPLWKRKHP $XVJXVVDP$QVDW]GHV+HQNHOVMHZHLOVHLQ9RJHOPRGHOOLHUW DP$XVJXVVVLW]WHLQ(FKVHQZHVHQ:LQ]LJHV/RFKVRQVWLQWDNW &KLP¦Q&KUF +FP'XQNHOJUDXHU7RQ%DX FKLJHV*HI”gPLWPHQVFKOLFKHP.RSIXQG]ZHLG©QQHQ$UPHQ GHU$XVJXVVDOVKRKHU=\OLQGHUJHVWDOWHW9RP+LQWHUNRSIDXV YHUO”XIW HLQ %DQGKHQNHO ,QWDNW &KLP¦  Q &KU 3 Stück! u Provenienz: Bei Gorny & Mosch Auktion 260, 2018, Los 528; ex Sammlung Helene Ferro, Bayern, vor 1968. 7KUHHEODFNZDUHYHVVHOVD 3LOJULPERWWOHIRUPVSRXWDVKXPDQIDFH6PDOO EUHDNVDWULPRWKHUZLVHLQWDFW,QFD$'E 6WLUUXSYHVVHOZLWK birds and a lizzard. Tiny hole, chippings at edge, otherwise intact. Chimú, $'F %XOERXVYHVVHOZLWKKXPDQKHDGVSRXWIRUPHGDVF\OLQG ULFDOKHDGJHDU7LQ\VSOLWVDWULPRWKHUZLVHLQWDFW&KLP¦$' 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

367


 9LHUSUDHNROXPELVFKH2EMHNWH&KDQFD\/DXULQ&KU D  + FP *UDXHU 7RQ PLW EHLJHU VFKZDU]HU XQG URVWURWHU %HPDOXQJ*URgHU]ZHLKHQNHOLJHU.UXJDXIGHU6FKXOWHU]RQH EHLJHV )HOG PLW VFKZDU]HQ 7XSIHQ XQWHQ YRQ HLQHP 0”DQGHUEDQG DEJHVFKORVVHQ GDV DXFK GLH +HQNHO YHU]LHUW 8QWHUWHLO PRQRFKURP URVWURW $XV PHKUHUHQ )UDJPHQWHQ ]XVDPPHQJHVHW]W NOHLQHU $XVEUXFK LQ GHU :DQG XQG DP $XVJXVV E  + FP *UDXHU 7RQ PLW EHLJHU VFKZDU]HU XQG URVWURWHU %HPDOXQJ .OHLQHU NQLFNZDQGLJHU .UXJ LP REHUHQ 7HLOEHLJHV)HOGPLWGXQNHOEUDXQHQ7XSIHQDPXQWHUHQ5DQG NOHLQH0”XVHGDUJHVWHOOW8QWHUWHLOPRQRFKURPURVWURW.OHLQH %HVFK”GLJXQJHQ DP .¤USHU XQG DP $XVJXVV F  + FP 0DVVLYHUU¤WOLFKHU7RQPLWURWEUDXQHU(QJREHXQG%HPDOXQJLQ 'XQNHOEUDXQXQG:HLgJHORFKW:HLEOLFKH)LJXU &KXPLOFRw  PLW KRKHU KDOENUHLVI¤UPLJHU .RSIEHGHFNXQJ 2KUVSXOHQ XQG +DOVNHWWH /HLFKWH %HVFK”GLJXQJHQ VRQVW LQWDNW G  + FP .OHLQHUH%HVWRgXQJHQVRQVWLQWDNWJHORFKW %HVFKUHLEXQJZLH F 4 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ Helene Ferro, Bayern, vor 1968. )RXUSUHFROXPELDQREMHFWV&KDQFD\/DXULFD$'D 9HU\UDUH and large polychrome globular stirrup jar. Body restored from several pieces, one fragment at spout missing. b) Small jug, minor damages at rim and body, RWKHUZLVHLQWDFWF DQGG 7ZR&KXPLOFRVwPDGHIURPPDVVLYHUHGGLVKFOD\ painted in black and white. Minor damages, otherwise intact. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHL SUDHNROXPELVFKH *HI”gH XQG HLQH 3IHLIH D  + FP 6FKZDU]JHVFKPDXFKWHU7RQ%DQGKHQNHOJHI”gPLW.QLFNZDQG XQG KRKHP $XVJXVV LP YRUGHUHQ 7HLO VLW]W HLQH )LJXU PLW XQWHUJHVFKODJHQHQ%HLQHQGLHPLWEHLGHQ+”QGHQHLQHQ%HFKHU K”OW=ZHLJURgHJHORFKWH2KUVSXOHQXQGHLQ+XWPLWUHFKWHFNLJHQ 6FKHLEHQDXIGHU9RUGHUXQG+LQWHUVHLWHVFKP©FNHQGHQ.RSI $XVPHKUHUHQ)UDJPHQWHQ]XVDPPHQJHVHW]W&KLP¦ Q &KU E  + FD FP *UDXHU 7RQ PLW U¤WOLFKHP EHU]XJ .XJHOLJHV'RSSHO*HI”gDXINRQLVFKHP6WDQGULQJGHUYRUGHUH $XVJXVV DOV PHQVFKOLFKHU .RSI PLW ]ZHL G©QQHQ $UPHQ JHVWDOWHW GHU LQ HLQH )O¤WH EO”VW =ZHL JHNOHEWH %U©FKH 9LU¦ Y&KUQ&KUF /FP*UDXHU7RQPLWU¤WOLFKHP EHU]XJ3IHLIHLQ*HVWDOWHLQHV3DSDJHLV+LQWHQDEJHEURFKHQ VRQVWLQWDNW*XDQDFDVWHQ&KUG +FPkFP *HOEOLFKHU 7RQ 5XQGH KRFKZDQGLJH 6FKDOH DXI KRKHP 6WDQGULQJDXgHQPLWKHOOURWHPEHU]XJDQGHU,QQHQZDQGPLW URWHQ 6WUHLIHQ EHPDOW LP *UXQG NOHLQH 9RJHO}JXU $XVEUXFK DP)XgVRQVWLQWDNW&KLULTXLQ&KU4 Stück! u 3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUZRUEHQ Four Precolumbian objects: a) Spouted vessel with seated man holding a be DNHU5HVWRUHGIURPVHYHUDOSLHFHV$'E 6SRXWHGYHVVHOZLWK KXPDQKHDGSOD\LQJD~XWH5HVWRUHG9LU¦%&$'F 2FDULQD *XDQDFDVWH$'G 3DLQWHGURXQGHGERZORQ~DWVWDQG'DPDJH DWVWDQG&KLULTXL$'4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHL SUDHNROXPELVFKH *HI”gH &KLP¦ FD    Q &KU D  + FP 6FKZDU] JHVFKPDXFKWHU 7RQ 6WHLJE©JHOJHI”g PLWHLQHP]\OLQGULVFKHQVLFKQDFKREHQYHUM©QJHQGHQ.¤USHU ~DQNLHUWYRQ]ZHLEUHLWHQ5RWHOOHQ$P$XVJXVV$QVDW]NOHLQHV WUHSSHQI¤UPLJHV*HELOGH,QWDNW&KLP¦FDQ&KU E +FP6FKZDU]JHVFKPDXFKWHU7RQ(LQKHQNHOLJH.DQQH PLWUHOLH}HUWHU'DUVWHOOXQJHLQHV.ULHJHUVLPJHSXQNWHWHQ)HOG ,QWDNW &KLP¦ FD    Q &KU  F  + FP 6FKZDU] JHVFKPDXFKWHU 7RQ (LI¤UPLJHV 6WHLJE©JHOJHI”g EHVWHKHQG DXVGHQQDFKJHELOGHWHQ6FKDOHQYRQGUHL0XVFKHOQGLHJURgH 0LWWOHUHELOGHWGHQ.¤USHU$XVJXVVDPREHUHQ5DQGEHVWRgHQ VRQVWLQWDNW0RFKHFDYQ&KU3 Stück! u 3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$%HUOLQ 'HXWVFKODQGHU-DKUHELV 7KUHHEODFNZDUH&KLP¦VWLUUXSYHVVHOVDOOLQYHU\JRRGFRQGLWLRQ A.D. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQYLHUSUDHNROXPELVFKHQ*HI”gHQ*XDQDFDVWH Q&KUD +FPkFP%U”XQOLFKHU7RQ%DXFKLJHV *HI”gPLWDXVODGHQGHP5DQGXQG]ZHLSODVWLVFKHQ3DSDJHLHQ PLWVHLWOLFKHQ)O©JHOQ$XVEU©FKHDP5DQGE +FPkFP *UDXHU 7RQ PLW %HPDOXQJ LQ 5RWW¤QHQ +DOEUXQGH 6FKDOH PLW ULQJI¤UPLJ DXVJHDUEHLWHWHP 5DQG DQ GHU $XgHQZDQG 6WULFKGHNRU XQG DQPRGHOOLHUWHP .RSI XQG 6FKZDQ] HLQHU 6FKLOGNU¤WH )DFKP”QQLVFK UHVWDXULHUW F  + FP k FP *UDXHU 7RQ PLW U¤WOLFKHU %HPDOXQJ .XJHOLJHU +HQNHOWRSI PLW KHUDXVPRGHOOLHUWHP PHQVFKOLFKHQ *HVLFKW 6SUXQJ LQ GHU $XgHQZDQGG +FPkFP*UDXHU7RQ.XJHOLJHU7RSI PLW KHUDXVPRGHOOLHUWHP VWLOLVLHUWHQ .DW]HQJHVLFKW XQG OLQHDUHU %HPDOXQJ LQ 6FKZDU] XQG 5RWW¤QHQ .OHLQHUH $EEU©FKH DP $XVJXVVVRQVWJXWHUKDOWHQ4 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV &ROOHFWLRQRIIRXUHI}J\ERZOVIURPWKH*XDQDFDVWHFXOWXUHSDUWO\SDLQWHGLQ FUHDPUHGDQGGDUNEURZQ$OOTXLWHZHOOSUHVHUYHGFD$'4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHLSUDHNROXPELVFKH*HI”gHD +FP*UDXHU7RQ.OHLQHV OLQVHQI¤UPLJHV .QLFNZDQGJHI”g PLW 'RSSHODXVJXVV XQG %DQGKHQNHO 'LH SRO\FKURPH %HPDOXQJ LQ %HLJH 5RW %UDXQ *UDXXQG6FKZDU]]HLJWDXIEHLGHQ6HLWHQHLQHQ9RJHO.OHLQH %HVWRgXQJHQDP$XVJXVVVRQVWLQWDNW1D]FDVS”WH3KDVH9, FD    Q &KU  E  + FP *UDXHU 7RQ PLW U¤WOLFKHU XQGFUHPHIDUEHQHU%HPDOXQJ%DXFKLJHV*HI”gLQ)RUPHLQHV 3DWWLVRQ.©UELVPLWNXU]HP$XVJXVVXQG]ZHLNOHLQHQVHQDXI GHU6FKXOWHU3DUWLHOODEJHULHEHQH)DUEH)UDJPHQWDP$XVJXVV IHKOW,QNDFDQ&KU2 Stück! u 3URYHQLHQ]([6DPPOXQJ96%HUOLQHUZRUEHQHU-DKUHELVH[ Gorny & Mosch Auktion 206, 2012, Los 500. 7ZR3UH&ROXPELDQYHVVHOVD 6PDOOOHQWRLGGRXEOHVSRXWHGYHVVHOZLWKEDQG handle depicting two birds, painted in cream, red, brown, grey and black. 6PDOOGDPDJHVDWWKHULP/DWH1D]FD$'E *OREXODUYHVVHO in form of a pumpkin. Painted in cream and red. Small fragment of spout PLVVLQJVXUIDFHSDUWLDOO\ZRUQRII,QFDFD$'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

368


 6DPPOXQJ YRQ VLHEHQ SUDHNROXPELVFKHQ *HI”gHQ *XDQDFDVWH FDYQ&KUD +FPkFP7RQPLWU¤WOLFKHP EHU]XJ =\OLQGULVFKHU 'UHLIXgEHFKHU PLW FUHPHIDUEHQHU %HPDOXQJ LQ NUHLVI¤UPLJHQ 0XVWHUQ XQG 6WUHLIHQ )©gH DEJHEURFKHQ E  + FP k FP 7RQ PLW U¤WOLFKHP EHU]XJ )ODFKH 'UHLIXgVFKDOH PLW $SSOLNDWLRQHQ DQ GHU 8QWHUVHLWHXQG5HVWHQYRQVFKZDU]HUJHRPHWULVFKHU%HPDOXQJ .OHLQH %HVFK”GLJXQJHQ VRQVW LQWDNW F  + FP 7RQ PLW U¤WOLFKHP EHU]XJ .OHLQHV NXJHOLJHV *HI”g PLW $SSOLNDWLRQ HLQHV $IIHQNRSIHV XQG YLHU *OLHGPDgHQ $EEUXFK DP 5DQG VRQVW JXW HUKDOWHQ G  + FP 7RQ PLW U¤WOLFKHP EHU]XJ .OHLQHVNXJHOLJHV*HI”gDXI]ZHL6HLWHQPLW$SSOLNDWLRQHQYRQ $IIHQN¤SIHQXQGYLHU*OLHGPDgHQ,QWDNWH +FP7RQPLW U¤WOLFKHP EHU]XJ .RUE”KQOLFKH 6FKDOH PLW PHQVFKOLFKHP *HVLFKWXQG$SSOLNDWLRQHQDXIGHP+HQNHO,QWDNWI +FP k  7RQ PLW U¤WOLFKHP EHU]XJ .OHLQH 'UHLIXgVFKDOH GLH )©gH PLW PHQVFKOLFKHQ .¤SIHQ XQG $UPHQ YHU]LHUW 5HVWH VFKZDU]HU %HPDOXQJ *HNOHEWH %U©FKH J  + FP k FP 7RQ PLW U¤WOLFKHP EHU]XJ .OHLQH 'UHLIXgVFKDOH GLH )©gH PLW (QWHQN¤SIHQ YHU]LHUW 5HVWH VFKZDU]HU %HPDOXQJ .OHLQHU $XVEUXFKDP5DQG7 Stück! u

 Sammlung von praekolumbischen Schalenfüßen. *XDQDFDVWH VS”WHSRO\FKURPH3HULRGHQ&KUD +FDFP 7RQ PLW URWHU XQG VFKZDU]HU %HPDOXQJ DXI FUHPHIDUEHQHP *UXQG =ZHL )©gH HLQHU JU¤gHUHQ 6FKDOH GLH PHQVFKOLFKH *HVLFKWHUPLW7LHUVFKQDX]HQ]HLJHQE +FP7RQPLWURWHU XQGVFKZDU]HU%HPDOXQJDXIFUHPHIDUEHQHP*UXQG6FKDOHQIXg PLWPHQVFKOLFKHP*HVLFKW5DVVHOIXQNWLRQF +FP7RQPLW URWHU XQG VFKZDU]HU %HPDOXQJ DXI FUHPHIDUEHQHP *UXQG 6FKDOHQIXgPLWPHQVFKOLFKHP*HVLFKWG +7RQPLWURWHU XQG VFKZDU]HU %HPDOXQJ DXI KHOOEUDXQHP *UXQG 7LHUNRSI PLW DXIJHULVVHQHP 0DXO XQG 5HLg]”KQHQ H  + FP 7RQ PLWURWHUXQGVFKZDU]HU%HPDOXQJDXIFUHPHIDUEHQHP*UXQG .OHLQH+RKO}JXULQ)RUPHLQHUPHQVFKOLFKHQ)LJXUPLWLQGLH +©IWHQJHVWHPPWHQ$UPHQXQGKRKHP.RSISXW]5 Stück! u

3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV

 .HUX%HFKHU ,QND .RORQLDO]HLW QDFK  + FP +RO] PLWURWHUGXQNHOEUDXQHUJU©QHUXQGRFNHUIDUEHQHU%HPDOXQJ DXIVFKZDU]HP*UXQG+RKHU%HFKHUDXINRQLVFKHP6WDQGIXg LQ]ZHL=RQHQEHPDOW'LHXQWHUH=RQH]HLJWHLQHXPODXIHQGH 'DUVWHOOXQJ JURgHU URWHU %O©WHQ Z”KUHQG GLH REHUH HLQH -DJGV]HQH DXI HLQ ZROIV”KQOLFKHV 5DXEWLHU PLW JH~HFNWHP )HOO DEELOGHW6SUXQJLP+RO]UHVWDXULHUWVRQVWLQWDNW u

Collection of seven fairly well preserved Guanacaste vessels including a large F\OLQGULFDOWULSRGERZO IHHWPLVVLQJ DVPDOOWULSRGSODWHWZRVSKHULFDOERZOV WZRWULSRGERZOVDQGRQHERZOVKDSHGDVDEDVNHW%&$'7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von praekolumbischen Miniaturgefäßen und Köpfen. 0LWWHODPHULNDFDYQ&KUD +FP7RQPLWURW EUDXQHPEHU]XJ=RRPRUSKHV*HI”gPLWEUHLWHP$XVJXVVDXI GHP5©FNHQ0HKUIDFKUHVWDXULHUWNOHLQHU$EEUXFKDPOLQNHQ %HLQE +FP7RQPLWURWEUDXQHPEHU]XJ=ZHL'UHL IXg6FKDOHQWHLOZHLVHPLW5LW]GHNRUXQG7LHUNRSI$SSOLNDWLRQ LQJXWHU(UKDOWXQJF +FP7RQPLWURWEUDXQHPEHU]XJ 6HFKVNOHLQHNXJHOLJH*HI”gHWHLOZHLVHPLW$SSOLNDWLRQ(QJR EH SDUWLHOO DEJHULHEHQ VRQVW JXW HUKDOWHQ G  + FD FP +HOO EUDXQHU 7RQ 6WDUN VWLOLVLHUWHV PHQVFKOLFKHV .¤SIFKHQ KLQWHQ +DDUNUDQ] 2KUHQ XQG 1DVH GXUFKERKUW ,QWDNW H  [FP 5¤WOLFKHU 7RQ PLW 5HVWHQ FUHPHIDUEHQHU %HPDOXQJ 5HFKWHN NLJHUIUDJPHQWLHUWHU*HI”gIXgPLWUHOLH}HUWHU'DUVWHOOXQJHLQHV :©UGHQWU”JHUVI +FP+HOOEUDXQHU7RQ.RSIPLW/LSSHQ VFKPXFNXQGNXJHOI¤UPLJHQ2KUULQJHQ12 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Collection of 12 miniature vessels from the Guanacaste culture, comprising a zoomorphic vessel, two tripod bowls and six spherical vessels. Apart from PLQRUGDPDJHVDOOZHOOSUHVHUYHGFD%&$'12 pieces VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV

&ROOHFWLRQRI}YH*XDQDFDVWHKXPDQRU]RRPRUSKLFVKDSHGGLVKIHHWDQGRQH VW\OL]HGKROORZ}JXUH:HOOSUHVHUYHG$'5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ]6DPPOXQJ+:%D\HUQHUZRUEHQLQGHQHU-DKUHQH[ Sammlung M. B., Hamburg. :RRGHQ SDLQWHG .HUX EHDNHU GHSLFWLQJ ~RZHU DQG JHRPHWULFDO PRWLYV WRJHWKHUZLWKDZHOOLOOXVWUDWHGKXQWLQJVFHQH,QWDFWFRORQLDOSHULRGDIWHU $' VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL SUDHNROXPELVFKH *HI”gH *XDQDFDVWH VS”WH SRO\FKURPH 3KDVHFDQ&KUD +FPkFP7RQPLWU¤W OLFKHPEHU]XJ6FKDOHPLWUHLFKHU%HPDOXQJLQ6FKZDU]XQG 5RWEUDXQ,QQHQ6WUHLIHQXQG*LWWHUPXVWHUDXgHQHLQ)ULHVYRQ 0LVFKZHVHQPLWPHQVFKOLFKHQ2EHUN¤USHUQXQG6FKODQJHQI© gHQ*HNOHEWHU%UXFK)DUEHHWZDVYHUULHEHQVRQVWLQWDNWE + FP7RQPLWU¤WOLFKHPEHU]XJ+RKH9DVHDXINRQLVFKHP )XgDPXQWHUHQ7HLOXQGDPREHUHQ5DQGPLW6WUHLIHQPXVWHU XQG +DNHQPRWLYHQ LQ 6FKZDU] XQG 5RW EHPDOW LQ GHU 0LWWH ]ZHL KRKH %LOGIHOGHU LQ GHQHQ MH HLQ 0DQQ PLW DXVODGHQGHP )HGHUVFKPXFN VLW]W )DUEH HWZDV YHUULHEHQ PHKUHUH JHNOHEWH %U©FKH2 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV 7ZR*XDQDFDVWHYHVVHOVIURPWKH/DWH3RO\FKURPH3HULRGFD A.D.: a) Bowl, painted in red and black, the outside wall is decorated with a frieze of snake people. Glued break, faded colours. b) Polychrome cylindrical YDVH ZLWK ~DUHG EDVH GHFRUDWHG ZLWK WZR VLWWLQJ PHQ ZHDULQJ ULFK IHDWKHU trims. Restored from several pieces. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

369


 6DPPOXQJYRQI©QISUDHNROXPELVFKHQ*HI”gHQD +FDFP *UDXHU 7RQ PLW EHLJHU (QJREH XQG URWEUDXQHU %HPDOXQJ 5XQGOLFKHV 6WHLJE©JHOJHI”g PLW ~DFKHP %RGHQ XQG GHU 'DU VWHOOXQJ HLQHV (FKVHQZHVHQV DXI EHLGHQ 6HLWHQ +RUL]RQWDOHU 6SUXQJLP.¤USHUVRQVWLQWDNW0RFKH,,FDQ&KU E +FP5¤WOLFKHU7RQPLW%HPDOXQJLQ6FKZDU]5RWXQG &UHPH%HFKHULQDXVJHVWHOOWHU)RUPPLWGUHLLQ3DQHHOHQVWH KHQGHQ.ULHJHU}JXUHQDPREHUHQ5DQG0”DQGHUPXVWHU)DUEH DQ PDQFKHQ 6WHOOHQ HWZDV DEJHULHEHQ DP 5DQG ZLQ]LJH $XV EU©FKH 7LDKXDQDFR FD  Q &KU F  + FP 5¤WOL FKHU 7RQ PLW %HPDOXQJ LQ 6FKZDU] 5RW XQG &UHPH %HFKHU LQ DXVJHVWHOOWHU )RUP PLW EHLGVHLWLJHU VFKHPDWLVFKHU 'DUVWHO OXQJHLQHU5DXENDW]H0HKUIDFKJHNOHEW7LDKXDQDFRFD  Q &KU G  + FP 5¤WOLFKHU 7RQ PLW 0RGHOGUXFN XQG %HPDOXQJLQ5RW%HLJHXQG6FKZDU]$XVJHVWHOOWHU%HFKHUDQ GHU$XgHQZDQGPLW]ZHL5HOLHIE”QGHUQLQJHRPHWULVFKHQ0X VWHUQYHU]LHUWGHU5DQGDXgHQPLWEHLJHQXQGURWHQ3XQNWHQDXI VFKZDU]HP*UXQGEHPDOW$XVPHKUHUHQ)UDJPHQWHQ]XVDP PHQJHVHW]W0LWWHODPHULNDFDYQ&KUH +FP 'RSSHOEDXFKLJH )ODVFKH PLW EHLJHP EHU]XJ XQG URWEUDXQHU %HPDOXQJLQ)RUPYRQJHRPHWULVFKHQ0RWLYHQ+XDULFD  Q &KU .OHLQH $EVSOLWWHUXQJ DP 5DQG XQWHQ HLQ NOHLQHV /RFK5 Stück! u 3URYHQLHQ]$XVGHUZHVWGHXWVFKHQ3ULYDWVDPPOXQJ3.HUZRUEHQ  Five precolumbian clay vessels: a) Stirrup vessel, cream coat and reddish EURZQGUDZLQJRIWZROL]DUGV&UDFNRWKHUZLVHLQWDFW0RFKH,, $'E )ODULQJ7LDKXDQDFRNHURSDLQWHGLQFUHDPUHGDQGEODFNZLWK}JXUHV RIZDUULRUV*OXHG$'F $VHFRQG7LDKXDQDFRNHURGHSLFWLQJ an abstract illustrated jaguar. Restored. d) Beaker with two circulating relief EDQGV&ROOHFWHGIURPVHYHUDOIUDJPHQWV&HQWUDO$PHULFDFD%& $'H 7ZREHOOLHGERWWOHZLWKEHLJHVOLSDQGUHGEURZQSDLQWLQJLQIRUPRI JHRPHWULF GHFRU +XDUL DERXW  $' 6PDOO IUDJPHQW RI WKH ULP LV missing, little hole above the bottom. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHLSU”NROXPELVFKH*HI”gHD +FP*UDXHU7RQPLWU¤W OLFKEUDXQHU (QJREH 4XDGHUI¤UPLJHU 7RSI PLW DEJHUXQGHWHQ (FNHQ XQG OHLFKW DEJHVHW]WHP $XVJXVV GHU DOV PHQVFKOLFKHV *HVLFKW JHIRUPW LVW .OHLQHU $XVEUXFK DP 5DQG VRQVW LQWDNW &KRUUHUDFDYQ&KU ([+LUVFK$XNWLRQ 6HSWHPEHU1U E +FP7RQPLWGXQNHOJUDX HU(QJREH%LNRQLVFKH9DVHPLWUXQGHP%RGHQXQGZHLWDXV ODGHQGHU /LSSH $Q GHU /LSSH OHLFKW UHVWDXULHUW VRQVW LQWDNW 0DQWHQR FD  Q &KU ([ +LUVFK $XNWLRQ   6HSWHPEHU1U 2 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH 7ZR SUHFROXPELDQ YHVVHOV D  &KRUUHUD FXEHVKDSHG YHVVHO ZLWK EURDG UH cessed spout formed as a human face. Reddish brown slip, minor damage at ULPRWKHUZLVHZHOOSUHVHUYHG%&$'E 0DQWHQREODFNZDUH YDVHZLWKDZLGHVSRXW5HVWRUHGDWOLSRWKHUZLVHLQWDFWFD$' 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Drei präkolumbische Fußschalen. &DUFKLQ&KUD + FPkFP6FKDOHDXIQLHGULJHP6WDQGIXgPLWVFKZDU]HU XQG EHLJHU %HPDOXQJ LQQHQ XQG DXgHQ LQ JHRPHWULVFKHQ 0XVWHUQ GXUFK]RJHQ YRQ EUHLWHQ URWHQ /LQLHQ )DUEH DXgHQ HWZDVDEJHULHEHQOHLFKWUHVWDXULHUWE +FPkFP6FKDOH DXI QLHGULJHP 6WDQGIXg PLW VWHUQI¤UPLJHU 1HJDWLYEHPDOXQJ LQQHQ'HNRUDXgHQDEJHULHEHQVRQVWLQWDNWF +FPk 6WHLOZDQGLJH 6FKDOH DXI QLHGULJHP 6WDQGIXg DXgHQ GHNRULHUW PLW VFKZDU]HQ 5DXWHQOLQLHQ ]ZLVFKHQ GXQNOHQ )HOGHUQ LQQHQ ]ZHLVLFKLP6FKDOHQJUXQGNUHX]HQGHURWH%”QGHUGD]ZLVFKHQ YLHUJHRPHWULVFKEHPDOWH)HOGHU)DUEHHWZDVDEJHULHEHQVRQVW LQWDNW3 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH 7KUHHSUHFROXPELDQSHGHVWDOOHGERZOV&DUFKL$'GHFRUDWHG ZLWK SDQHOV }OOHG ZLWK D EODFN JHRPHWULF GHVLJQ VHSDUDWHG E\ YHUWLFDO OLQHV Some restorations, but altogether well preserved pieces. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung von drei Fußschalen. &DUFKL 7XQFDKXDQ.XOWXU FD YQ&KUD +FPkFP*UDXHU7RQEHPDOW 6FKDOHDXIUXQGHP6WDQGIXg$XgHQPRQRFKURPEUDXQLQQHQ PLW JHRPHWULVFKHQ 0XVWHUQ LQ EUDXQ FUHPH XQG URW EHPDOW 5HVWDXULHUWE +FPkFP*UDXHU7RQEHPDOW6FKDOH DXI UXQGHP 6WDQGIXg LQQHQ PLW YLHU 7LHUHQ JHWUHQQW GXUFK 3XQNWNUHLVHLQ1HJDWLYEHPDOXQJLQGXQNHOJUDXFUHPHXQGURW YHU]LHUW5HVWDXULHUWF +FPkFP5¤WOLFKJUDXHU7RQ ,QQHQYLHULQ5DXWHQJHVHW]WH~RUDOH0RWLYHLQ1HJDWLYEHPDOXQJ LQGXQNHOURWVFKZDU]XQGFUHPH5HVWDXULHUW6W©FNE 7/ $QDO\VHYRP2NWREHU u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[+LUVFK 1DFKIROJHU $XNWLRQ   /RV   XQG  H[ 6DPPOXQJ :HVWHUPDQQ'HXWVFKODQG 7KUHH ERZOV RQ ORZ FRQLFDO SHGHVWDOV &DUFKL 7XQFDKXDQ&XOWXUH 7KH LQ WHULRU RI WKHVH VHPLVSKHULFDO YHVVHOV LV GHFRUDWHG ZLWK JHRPHWULF GHVLJQV RU DQLPDO}JXUHVLQQHJDWLYHUHVLVWSDLQWLQJ$OOSURIHVVLRQDOO\UHVWRUHGFD %&$'SLHFHV:LWK7/DQDO\VLVIURPVW2FWREHUIRU E  VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 'UHL SU”NROXPELVFKH *HI”gH $WODQWLVFKH $EGDFKXQJ FD    Y &KU D  + FP .OHLQHV NXJHOLJHV *HI”g DXI GUHL VFKPDOHQ6WDQGEHLQHQ*UDXHU7RQPLWU¤WOLFKEUDXQHU%HPD OXQJLQJHRPHWULVFKHP0XVWHUDP$QVDW]GHU%HLQH$SSOLND WLRQHQ/HLFKWUHVWDXULHUWE +FP*UDXHU7RQPLWU¤WOLFKHP EHU]XJ .XJHOLJH 9DVH PLW GUHL PDPPRIRUPHQ $XVVW©OSXQ JHQ XQG VWHUQHQI¤UPLJHP 5LW]GHNRU $P 5DQG PLQLPDO EH VWRgHQVRQVWLQWDNWF +FP*UDXHU7RQPLWGXQNHOURWHU (QJREH.XJHOLJH6FKDOHDXINOHLQHP6WDQGIXgPLWDEJHVHW]WHU /LSSH /HLFKW UHVWDXULHUW PLW ZLQ]LJHQ $EVSOLWWHUXQJHQ DQ GHU /LSSHVRQVWLQWDNW6W©FNE PLW7/$QDO\VHYRP)HEUXDU 1990! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUHH[+LUVFK1DFKIROJHU$XNWLRQ /RVXQG DXQGF  7KUHHVPDOOYHVVHOV$WODQWLF:DWHUVKHGFD$'D 5RXQGHG pedestalled vessel with geometric decoration, reddish clay, slightly restored, otherwise intact. b) Spherical vessel with three nipples and stellar incisions.

370


Clay with reddish slip. Tiny bruises at rim, otherwise intact. :LWK7/DQDO\VLV IURPWK)HEUXDU\IRUE  c) Rounded vessel with conical lower part on recessed pedestal. Barely restored. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ QHXQ SUDHNROXPELVFKHQ *HI”gHQ 1LFR\D *XD QDFDVWHFDYQ&KUD +FP5¤WOLFKHU7RQPLW KHOOEUDXQHP EHU]XJ *URgHV NXJHOLJHV *HI”g PLW EUHLWHP $XVJXVVXQGUXQGHP%RGHQGHNRULHUWPLWEUHLWHQ'HOOHQXQG 5LW]GHNRUEDQGXQWHUGHP5DQG =RQHG%LFKURPH3HULRG ,Q WDNWE +FP5¤WOLFKHU7RQPLWKHOOEUDXQHPEHU]XJ.OHL QH NXJHOLJH 9DVH PLW UXQGHP %RGHQ 'HNRU YRQ DXIJHOHJWHQ 3XQNWHQXQG]ZHLNOHLQHQ(FKVHQZHVHQXQWHUGHP5DQG:LQ ]LJHU $XVEUXFK DP 5DQG VRQVW LQWDNW F  + FP U¤WOLFKHU 7RQPLWEUDXQHPEHU]XJ'UHLNOHLQHNXJHOLJH6FKDOHQNOHLQH %HVFK”GLJXQJHQDQGHQ5DQG]RQHQVRQVWLQWDNWG +FPk FP*UDXHU7RQPLWGXQNHOEUDXQHPEHU]XJ)ODFKHNX JHOLJH6FKDOHPLWJHRPHWULVFKHP5LW]GHNRUXQWHUGHP5DQG,Q WDNWH +FP5¤WOLFKHU7RQPLWEUDXQHPEHU]XJ.XJHOLJH 9DVHPLWUXQGHP%RGHQXQG%HPDOXQJLQVFKZDU]HQ6WULFKHQ ,QWDNW I  + FP 7RQ GXQNHOEUDXQ JODVLHUW .XJHOLJH .DQQH PLWHQJHP$XVJXVVGDUDQ]DSIHQI¤UPLJHU*ULIINOHLQHV/RFK DP 5DQG PLQLPDOH %HVFK”GLJXQJ VRQVW LQWDNW J  + FD FP 7RQPLWVFKZDU]HUXQGU¤WOLFKHU%HPDOXQJDXIEHLJHP*UXQG .OHLQHNXJHOLJH9DVHGLHXQWHUH+”OIWHPLWJHRPHWULVFKHP=DN NHQPXVWHUEHPDOW9 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV 1LFH&ROOHFWLRQRIVPDOOYHVVHOVIURPWKH1LFR\DFXOWXUHFRPSULVLQJVL[EHOO\ VKDSHGERZOVDQGWKUHHODUJHUURXQGHGYDVHVLQYHU\JRRGFRQGLWLRQFD %&$'9 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHLSUDHNROXPELVFKH*HI”gH0DQWHQRQ&KUD k FDFP+FP'XQNHOJHVFKPDXFKWHU7RQ*URgHRYDOH 6FKDOH DXI GUHL NXU]HQ NRQLVFKHQ )©gHQ DQ GHQ /”QJVVHLWHQ 1RSSHQKHQNHO +HQNHO]RQH DQ HLQHU 6HLWH EHVFK”GLJW VRQVW LQWDNW E  + FD FP k FP 'XQNHO JHVFKPDXFKWHU 7RQ .XJHOLJH6FKDOHGLH5DQG]RQHPLWHLQJHULW]WHPJHRPHWULVFKHQ 'HNRUYHU]LHUW$XVPHKUHUHQ)UDJPHQWHQUHVWDXULHUW2 Stück! u 3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$%HUOLQ 'HXWVFKODQGHU-DKUHELV 7ZR3UDHFROXPELDQYHVVHOVD /DUJHRYDOVKDSHGERZOZLWKWKUHHIHHW DURXQG RQH RI WKH QXE KDQGOHV ZLWK GDPDJHV RWKHUZLVH LQWDFW  E  6HPLVSKHULFDO bowl with engraved geometric decor. Reassembled from fragments. Manteno, $'2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 =ZHL NRORQLDOH *HI”gH $WODQWLVFKH $EGDFKXQJ QDFK  Q &KU D  + FP k FP 7RQ PLW GXQNHOURWHU XQG FUHPH IDUEHQHU %HPDOXQJ .XJHOLJHV 5DVVHO*HI”g PLW 6WDQGULQJ LQ GHU0LWWHYRQHLQHPEUHLWHQ%DQGPLWSODVWLVFKDXVJHIRUPWHQ DEZHFKVHOQGJURgHQXQGNOHLQHQ(FKVHQPLW0HQVFKHQN¤SIHQ JHVFKP©FNWGLHDXIHLQHPJHSXQNWHWHQ)HOGNULHFKHQ0LQLPD OH%HVFK”GLJXQJDQHLQHPGHUNOHLQHUHQ7LHUHIHLQH5LVVHVRQVW LQWDNW E  FP k FP 7RQ PLW GXQNHOURWHU %HPDOXQJ .XJHOLJHV*HI”gPLWHLQHUFUHPHIDUEHQHQ5HOLHI]RQHGLHKDOE SODVWLVFKPRGHOOLHUWH$IIHQ}JXUHQ©EHUHLQHP%DQGPLW3XQN

WHQ]HLJW$XVEUXFKDP5DQGXQGDQGHU8QWHUVHLWHUHVWDXULHUW VRQVWQXUIHLQH5LVVH6W©FN)©UE 7/$QDO\VHYRP)HEUXDU 1990! u Provenienz: Bei Gorny & Mosch Auktion 256, 2018, Los 562; ex Sammlung :HVWHUPDQQ'HXWVFKODQGHU-DKUH 7ZRERZOVIURPWKH$WODQWLF:DWHUVKHGGDWLQJWRWKH&RORQLDO(UDPDGH IURP UHG SDLQWHG FOD\ D  6SKHULFDO ERZO GHFRUDWHG ZLWK PRGHOOHG KXPDQ headed lizards creeping along a dotted area. Minor damage at one of the ani mals, otherwise intact. b) Spherical bowl decorated with a relief of halfplastic worked monkeys. Minor outbreak at edge and bottom restored, otherwise well preserved. SLHFHV)RUE ZLWK7/DQDO\VLVIURPWK)HEUXDU\ VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6HFKVSUDHNROXPELVFKH*HI”gH*XDQDFDVWH%LFKURPH3HULRGH FDYQ&KUD +FP7RQPLWURWEUDXQHPEHU ]XJ.XJHOLJHV*HI”gPLWKDOEUXQGHP%RGHQXQGEUHLWHP$XV JXVV LQ GHU REHUHQ =RQH PLW )OHFKWEDQGPXVWHU EHPDOW GHU XQWHUH7HLOPRQRFKURP)DUEHHWZDVDEJHULHEHQVRQVWLQWDNW E +FPkFP7RQPLWURWEUDXQHPEHU]XJ+DOEUXQGH 6FKDOHDXIQLHGULJHP6WDQGULQJPLW)OHFKWEDQGPXVWHUEHPDOW F +FPkFP7RQPLWEUDXQHPEHU]XJ6DPPOXQJ YRQYLHUPRQRFKURPHQVHKUJXWHUKDOWHQHQNOHLQHQ6FKDOHQ6 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Six well preserved vessels from the Guanacaste culture, Bichrome Zone 3HULRGFD%&$'6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ GUHL SUDHNROXPELVFKHQ *HI”gHQ D  + FP k FP 7RQ PLW KHOOEUDXQHP EHU]XJ 6WHLOZDQGLJHU KRKHU 7RSI DQ GHU $XgHQZDQG PLW LQ PHKUHUHQ GXUFK 6WUHLIHQ JH WUHQQWHQ3DQHHOHQEHPDOW0HKUHUH6SU©QJHXQG$XVEU©FKHDP 5DQG )DUEH HWZDV DEJHULHEHQ *XDQDFDVWH  Q &KU E +FPkFP7RQPLWKHOOEUDXQHPEHU]XJ%DXFKL JH 6FKDOH PLW %HPDOXQJ LQ 6WUHLIHQ XQG JHRPHWULVFKHQ 0X VWHUQ,QWDNW*XDQDFDVWHQ&KUF +FPkFP 7RQPLWFUHPHIDUEHQHPEHU]XJ.UXJPLWKRKHP+DOVURWH )DUE~”FKHQGXUFK'HOOHQDEJHWHLOW0LQLPDOH%HVWRgXQJHQDP 5DQG2EHU~”FKHYHUULHEHQ*XDQDFDVWHYQ&KU3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Three Guanacaste vessels, painted in black and red: a) Large cylindrical pot. 'DPDJHDWULPFD$'E +HPLVSKHULFERZO,QWDFWFD $'F *URRYHGVSKHULFDOYDVHZLWKKLJKURXQGHGVSRXWFD%& $'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

371


 'UHLSU”NROXPELVFKH*HI”gHD +FDFP7RQPLWEHLJHU(Q JREH+RKHHLI¤UPLJH8UQHPLWDEJHVHW]WHP+DOVXQGEUHLWHP $XVJXVV%HPDOXQJPLW'UHLHFNHQ/LQLHQXQG3XQNWHQLQ5RW XQG6FKZDU]2EHU~”FKHDEJHULHEHQNOHLQH%HVWRgXQJHQVRQVW LQWDNW7XQFDKXDQ&DUFKLFDQ&KUE +FP 7RQPLWRUDQJHEUDXQHU(QJREH.XJHOI¤UPLJH.DQQHPLWKR KHP $XVJXVV XQG %DQGKHQNHO GDUDXI NULHFKW HLQ YLHUI©gLJHV )DEHOZHVHQ PLW $IIHQNRSI HQWODQJ $P $XVJXVV UHVWDXULHUW VRQVWLQWDNW&KRUUHUDY&KUF +FPkFP 5¤WOLFKHU7RQ+HQNHOWRSIPLWUXQGHP%RGHQXQGDXVODGHQGHU /LSSH,QWDNW0LWWHODPHULNDXQEHVWLPPW3 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ :HVWHUPDQQ'HXWVFKODQGHU-DKUH Three precolumbian clay vessels: a) Jug with pointed base, ovoid form with wide spout, covered with beige slip and geometrical red and black paintings. 6XUIDFHZRUQRIIRWKHUZLVHLQWDFW7XQFDKXDQ&DUFKLFD$' b) Globular vessel with spout and bridge decorated with a creaping creature. 0LQRUUHVWRUDWLRQVDWVSRXWRWKHUZLVHLQWDFW&KRUUHUD%&F 3RW ZLWKWZRKDQGOHVDQGDZLGHOLS5HGGLVKFOD\,QWDFW&HQWUDO$PHULFD "  LQGH}QLWHSHULRG3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Zwei große praekolumbische Schalen. D +FPkFP+HO OHUU¤WOLFKHU7RQ6WHLOZDQGLJHKRKH'UHLIXgVFKDOHGLH)©gHDOV PHQVFKOLFKH*HVLFKWHUJHVWDOWHW2EHU~”FKHHWZDVSRU¤V6SX UHQYRQ%HPDOXQJVRQVWLQWDNW0D\DIU©KNODVVLVFKH3HULRGH YQ&KUE +FPkFP5¤WOLFKHU7RQPLW6SX UHQYRQ%HPDOXQJ)ODFKHEUHLWH6FKDOHDXINXU]HQ)©gHQPLW 1RSSHQGHNRUXQGJH]DFNWHP5DQG6SUXQJLQGHU$XgHQZDQG PLQLPDOH $EEU©FKH DQ GHQ =DFNHQ SRU¤VH 2EHU~”FKH VRQVW LQWDNW2 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV Two early Mayan tripod bowls, aside from some minor damages well preser ved. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJYRQVHFKVSUDHNROXPELVFKHQ*HI”gHQ+XDULXQG,FD .XOWXU]ZLVFKHQQ&KUD +FP+XDUL(LQKHQ NHOLJHU .UXJ DXV KHOOHP 7RQ PLW U¤WOLFKHU (QJREH %HPDOXQJ LQ)HOGHUQPLW5RVHWWHQXQG.UHLVSXQNWHQLQ%HLJHXQG'XQ NHOEUDXQDXIEHLGHQ6HLWHQLQGHU0LWWHHLQH9RJHOGDUVWHOOXQJ LP .UHLV DQ GHU 6FKXOWHU NOHLQH $SSOLNDWLRQ LQ )RUP HLQHU (UGQXVV$XVEU©FKHDP5DQGVRQVWLQWDNWE +FP+XDUL *UDXHU7RQPLWU¤WOLFKHU(QJREH3LOJHU~DVFKHwPLW%HPDOXQJ LQ5RVWURWXQG'XQNHOEUDXQDXIEHLGHQ6HLWHQKDOEUXQGHV)HOG PLWVWLOLVLHUWHU'DUVWHOOXQJHLQHV5DXEWLHUHVXPJHEHQYRQKXQ GHDUWLJHQ5DXEWLHUHQ9HUVLQWHUXQJVVSXUHQ$XVJXVVEHVFK”GLJW )HKOVWHOOHDP%RGHQJHNLWWHWF +FP+XDUL*UDXHU7RQPLW U¤WOLFKHU (QJREH .OHLQHU HLQKHQNHOLJHU .UXJ PLW .QLFNZDQG %HPDOXQJPLWJHRPHWULVFKHQ0XVWHUQXQWHUHU7HLOSODVWLVFKHU 3XQNWGHNRU$XVJXVVREHQHWZDVEHVFK”GLJWVRQVWLQWDNWG + FP k FP ,FD *UDXHU 7RQ PLW U¤WOLFKHU (QJREH .OHL QHU VWHLOZDQGLJHU %HFKHU EHPDOW PLW JHRPHWULVFKHQ 0XVWHUQ LQ 6FKZDU] :HLg XQG 'XQNHOEUDXQ :LQ]LJH $XVEU©FKH DP 5DQG VRQVW LQWDNW H  + FP k FP +XDUL *UDXHU 7RQ PLWU¤WOLFKHU(QJREH.OHLQH6FKDOHLQQHQEHPDOWPLWJHRPHWUL VFKHQ0XVWHUQLQ6FKZDU]%HLJHXQG'XQNHOEUDXQ,QWDNWI + FPkFP,FD*UDXHU7RQPLWU¤WOLFKHU(QJREH*URgH

372

VWHLOZDQGLJH 6FKDOH DXgHQ PLW 5DXWHQPXVWHU DXI VFKZDU]HP *UXQGEHPDOW'UHLJHNOHEWH6SU©QJHVRQVWLQWDNW6 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ Helene Ferro, Bayern, vor 1968. Collection of polychrome, well preserved jugs and bowls from the Huari and ,FDFXOWXUH%HWZHHQ$'6 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 9LHU SUDHNROXPELVFKH 2EMHNWH D  + FP $ODEDVWHU ,Q GHU )RUP~DFKHUGUHLHFNLJHU6FKHLQNRSIwGLH1DVHYRUVSULQJHQG GLH $XJHQ DOV /¤FKHU JHERKUW GHU 0XQG VWULFKI¤UPLJ HLQJH ULW]W1DVHEHVWRgHQ2EHU~”FKHYHUVLQWHUW&KDQFD\ Q&KUE +FPkFP7RQPLWURWEUDXQHU(QJREH.OHL QH6FKDOHPLWUXQGHP%RGHQ.OHLQH%HVWRgXQJDP5DQGVRQVW LQWDNW&KRUUHUDQ&KUF +FP7RQPLWURWEUDXQHU(Q JREH6FK”OFKHQPLWUXQGHQ%RGHQG /FDFP7RQPLWURW EUDXQHU(QJREH*HI”gLQ)RUPHLQHUJURgHQ6FKRWHDQHLQHP (QGHRIIHQ,QWDNW0RFKHXPQ&KU4 Stück! u 3URYHQLHQ]([6DPPOXQJ(YHUHWW%XUWRQ+HOP0LQQHDSROLV86$%HUOLQ 'HXWVFKODQGHU-DKUHELV Four precolumbian objects including a stone face representing a „Replacement KHDGw&KDQFD\FD$'7ZRVPDOO&KRUUHUDERZOVDERXW A.D.; a vessel shaped like a large pod, Mochica, about 550 A.D. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ VLHEHQ *HI”gIUDJPHQWHQ XQG 6FKDOHQ &KDQFD\    Q &KU D  + FP 5¤WOLFKHU 7RQ PLW EHLJHP EHU]XJ XQG EUDXQHU %HPDOXQJ .RSIIUDJPHQW HLQHV JURgHQ &KLQRw*HI”gHVPLWDXIJHPDOWHU$XJHQPDVNHw(LQ2KUDE JHEURFKHQ E  + FP .RSIIUDJPHQW  %HVFKUHLEXQJ ZLH D F +FDFP5¤WOLFKHU7RQPLWEHLJHPEHU]XJXQGEUDX QHU%HPDOXQJ)UDJPHQWHLQHUNOHLQHQ6FKDOHPLW)URVFK$S SOLNDWLRQ G  + FP 5¤WOLFKHU 7RQ PLW EHLJHP EHU]XJ XQG VFKZDU]HU %HPDOXQJ $XVJXVVIUDJPHQW HLQHV EDXFKLJHQ *HI” gHV PLW PHQVFKOLFKHP *HVLFKW *HNOHEWHU %UXFK H  + MHZHLOV FDFP5¤WOLFKHU7RQPLWEHLJHPEHU]XJXQGGXQNHOEUDXQHU %HPDOXQJ'UHLVWHLOZDQGLJH6FKDOHQHLQHLQWDNW]ZHLJHNOHEW 7 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ Helene Ferro, Bayern, vor 1968. ,QWHUHVWLQJFROOHFWLRQRIIRXUYHVVHOIUDJPHQWVDQGWKUHHZHOOSUHVHUYHGERZOV RIWKH&KDQFD\FXOWXUH$'7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ GUHL SUDHNROXPELVFKHQ *HI”gHQ 0LWWHODPHULND FDQ&KUD +FP7RQPLWU¤WOLFKHPEHU]XJ XQG VFKZDU]HU %HPDOXQJ .OHLQH 'UHLIXgVFKDOH PLW 5DVVHO IXQNWLRQGLH)©gHDOVPHQVFKOLFKH*HVLFKWHUJHVWDOWHW*URgHU $XVEUXFK DP 5DQG VRQVW LQWDNW E  + FP 5¤WOLFKHU 7RQ .XJHOLJH6FKDOHPLW$SSOLNDWLRQ$P5DQGPHKUIDFKDXVJHEUR FKHQVRQVWLQWDNWF +FP5¤WOLFKHU7RQ.OHLQHNXJHOLJH 'UHLIXg6FKDOHLQ)RUPHLQHV9RJHOVPLWNXU]HQ)O©JHOQ*UR gHU$XVEUXFKHLQ)UDJPHQWZLHGHUJHNOHEW3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV


&ROOHFWLRQ RI WZR VPDOO 3UHFROXPELDQ WULSRGYHVVHOV DQG D VPDOO URXQGHG ERZOUDWKHUZHOOSUHVHUYHG&HQWUDO$PHULFDFD$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ SUDHNROXPELVFKHU *HI”gH D  + FD FP 'XQNHO JHVFKPDXFKWHU7RQ.XJHOLJHU7RSIPLWHLQHP'HNRUDXVJH ULW]WHQ/LQLHQXQGDXIJHOHJWHQ+DOENXJHOQDQGUHL6HLWHQ$SSOL NDWLRQHQGLHDXFKDOV+HQNHOGLHQHQ5DQGREHQDEJHEURFKHQ 0DQWHQRQ&KUE +FP'XQNHOJHVFKPDXFKWHU 7RQ.OHLQHKRFNHQGH)LJXUPLWJURgHPLQGHQ1DFNHQJHOHJ WHQ.RSIGLHODQJHQG©QQHQ$UPH©EHUGHP/HLEYHUVFKU”QNW KLQWHQLQ9RJHOVFKZDQ]DOV6W”QGHUDXVODXIHQG,P+DOVEHUHLFK JHEURFKHQ XQG ZLHGHU UHVWDXULHUW 0DQWHQR  Q &KU F +FP7RQPLWU¤WOLFKHPEHU]XJ+RFNHQGH)LJXUPLW XQWHUJHVFKODJHQHQ%HLQHQGLHEHLGH+”QGH]XP*HVLFKWI©KUW $P 2EHUNRSI NOHLQHV /RFK *XHUUHUR  Y &KU G  + FP*UDXHU7RQ*HI”gIXgPLW5DVVHOIXQNWLRQPLWGHP.RSI HLQHV&DQLGHQ0DQWHQRQ&KUH +FP7RQ PLWEU”XQOLFKHPEHU]XJ=ZHLVWX}JHUEDXFKLJHUNOHLQHU7RSI PLW%DQGKHQNHODXINRQLVFKHP)Xg,QWDNW&KRUUHUDY Q&KUI +FP7RQPLWGXQNHOEUDXQHPEHU]XJ%DX FKLJHU7RSIPLWJODWWHU:DQGXQJ,QWDNW0DQWHQRQ &KUJ )UDJPHQWHHLQHV*HI”gHVLQ)RUPHLQHU6FKLOGNU¤WH7 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV &ROOHFWLRQ RI VHYHQ SUHFROXPELDQ YHVVHOV DQG REMHFWV IURP WKH 0DQWHQR *XHUUHUR DQG &KRUUHUD&XOWXUH )DLUO\ ZHOO SUHVHUYHG RQH IUDJPHQWHG 7 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Ringförmiger Ständer mit Lastenträgern. $WODQWLVFKH$EGDFKXQJ FDQ&KU+FPkFP*UDXEUDXQHU9XO NDQVWHLQ5LQJI¤UPLJHU6W”QGHUPLWYLHUV”XOHQI¤UPLJHQ6WUHEHQ XQGYLHUGXUFKEURFKHQJHDUEHLWHWHQPHQVFKOLFKHQ)LJXUHQGLH DOV/DVWHQWU”JHU $WODQWHQw GHQREHUHQ6WHLQULQJVW©W]HQ5H VWDXULHUW u

VXSSRUWHGE\WZRSDUURWV$WODQWLF:DWHUVKHGFD$'3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ YRQ SUDHNROXPELVFKHQ 7H[WLOLHQ 6SLQGHOQ XQG Tonpfeifen. &KDQFD\FDQ&KUD /FP=ZHL 7RQSIHLIHQ VFKZDU] JHEUDQQWHU XQG EHLJHU 7RQ 3IHLIIXQNWLRQ QRFKLQWDNWE /MHZHLOVFDFP'UHL6SLQGHOQPLWYHU]LHUWHQ :LUWHOQ DXV 7RQ ,QWDNW F  .OHLQH 6DPPOXQJ YRQ JHZHEWHQ 7H[WLOIUDJPHQWHQ EHVWHKHQG DXV 7”VFKFKHQ %”QGHUQ XQG 6WRIIUHVWHQ 6W©FN 16 Stück! u 3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVH[6DPPOXQJ Helene Ferro, Bayern, vor 1968. Collection of precolumbian fragments of textiles, two functional whistles and WKUHH ZRRGHQ VSLQGOHV ZLWK RUQDPHQWHG FOD\ ZKRUOV &KDQF\    A.D. 16 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ 6HODGRQ.HUDPLN DXV HLQHP 6FKLIIVZUDFN &KLQD 6RQJ'\QDVWLHXP-KQ&KU$XVZHLgHP3RU]HOODQ PLWJU©QOLFKHU*ODVXU(LQHJURgH6FKDOHPLWHLQHU%O©WHLP%R GHQkFP+FPLQWDNW(LQH6FKDOHPLWHLQJUDYLHUWHP DEVWUDNWHP2UQDPHQWkFP+FPZLQ]LJH$EVSOLWWHUXQ JHQDP5DQG(LQ6FK”OFKHQkFP+FP$EVSOLWWHUXQJ DP 5DQG (LQ 6FK”OFKHQ PLW NOHLQHQ VHQKHQNHOQ k FP +FPLQWDNW%DXFKLJHV)O”VFKFKHQPLW]ZHLNOHLQHQVHQ KHQNHOQ XQG ~RUDOHP UHOLH}HUWHP 2UQDPHQW + FP LQWDNW (LQ XQJODVLHUWHU EDXFKLJHU $XIEHZDKUXQJVNUXJ PLW YLHU +HQ NHOQ+FP6 Stück!9LHU6W©FNPLW0HHUHV,QNUXVWDWLRQHQ u 3URYHQLHQ](UZRUEHQDXIGHP3DULVHU.XQVWPDUNWDXVIUDQ]¤VLVFKHU Privatsammlung C.B.

3URYHQLHQ]%HL*RUQ\ 0RVFK$XNWLRQ/RVEHL+LUVFK 1DFKIROJHU $XNWLRQ   /RV  H[ 6DPPOXQJ :HVWHUPDQQ Deutschland, 1960er Jahre.

&ROOHFWLRQRI&HODGRQ&HUDPLFV:KLWHSRUFHODLQZLWKOLJKWJUHHQJOD]H)RXU ERZOVRIGLIIHUHQWVL]HVRQHZLWKLQFLVHG~RZHURQHZLWKDEVWUDFWRUQDPHQW RQHZLWKWZRVPDOOKDQGOHVPRVWO\LQWDFW7ZRRYRLGERG\MDUVRQHZLWK~RUDO ornament and two small handles, one unglazed and with four lug handles, LQWDFW)RXUSLHFHVZLWKVHDLQFUXVWDWLRQV&KLQDWKWKFHQWXU\$'6 pieces!

A grey volcanic stone ring, the upper part supported by four columnar legs DQGIRXUWHODPRQ}JXUHV5HVWRUHG$WODQWLF:DWHUVKHGFD$'

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ 6HODGRQ.HUDPLN DXV HLQHP 6FKLIIVZUDFN &KLQD 6RQJ'\QDVWLHXP-KQ&KU$XVZHLgHP3RU]HOODQ PLWJU©QOLFKHU*ODVXU=ZHL6FKDOHQPLWHLQJUDYLHUWHPDEVWUDN WHP 2UQDPHQW k FP + FD FP NOHLQH $EVSOLWWHUXQJHQ DP5DQG%DXFKLJHV)O”VFKFKHQPLW]ZHLNOHLQHQVHQKHQNHOQ +FP=ZHLXQJODVLHUWH~DFKHEDXFKLJH$XIEHZDKUXQJVNU©JH PLWYLHU+HQNHOQ+FDFP5 Stück!0HLVWLQWDNWWHLOZHLVH VWDUNH0HHUHV,QNUXVWDWLRQHQ u

 6DPPOXQJYRQGUHLSUDHNROXPELVFKHQ6WHLQREMHNWHQD +FP k GHU IIQXQJ FP *UDXHU 7XIIVWHLQ .XJHOLJHU .HXOHQNRSI PLWHLQHUUXQGHQIIQXQJXQGHLQHP'HNRUDXVO”QJOLFKHQ5LH IHOQXQG0”DQGHUPXVWHU$P5DQGGHUIIQXQJHWZDVEHVWR gHQVRQVWLQWDNW0D\DVS”WNODVVLVFKH3HULRGHFDQ &KUE +FPkGHUIIQXQJFP*UDXHU7XIIVWHLQ.X JHOLJHU.HXOHQNRSIPLWHLQHUUXQGHQIIQXQJXQGHLQHP'HNRU DXV O”QJOLFKHQ 5LHIHOQ (WZDV SRU¤V VRQVW LQWDNW 0D\D VS”W NODVVLVFKH 3HULRGH FD    Q &KU F  + FP k FP *UDXHU7XIIVWHLQ5LQJI¤UPLJHU6W”QGHULQ)RUPYRQ]ZHL3D SDJHLHQPLWDXVJHEUHLWHWHQ)O©JHOQXQGJHERJHQHQ6FKQ”EHOQ ,QWDNW$WODQWLVFKH$EGDFKXQJFDQ&KU3 Stück! u 3URYHQLHQ]([6DPPOXQJ(:©UIHO%D\HUQVHLWPLQGHVWHQV

Lot of three objects made from grey tufa stone: a) and b) Two Mayan grooved SXPSNLQVw,QWDFW/DWH&ODVVLFDO3HULRGFD$'F 6WRQHULQJ

3URYHQLHQ](UZRUEHQDXIGHP3DULVHU.XQVWPDUNWDXVIUDQ]¤VLVFKHU Privatsammlung C.B. &ROOHFWLRQRI&HODGRQ&HUDPLFV:KLWHSRUFHODLQZLWKOLJKWJUHHQJOD]H7ZR bowls with abstract ornament, small ovoid body jar with two handles and two unglazed ovoid body storage jars with four lug handles. Mostly intact, partially VWURQJVHDLQFUXVWDWLRQV&KLQDWKWKFHQWXU\$'5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

373


 6DPPOXQJ6HODGRQ.HUDPLNDXVHLQHP6FKLIIVZUDFN&KLQD6RQJ '\QDVWLH XP    -K Q&KU $XV ZHLgHP 3RU]HOODQ PLW JU©QOLFKHU*ODVXU=ZHL6FKDOHQPLWHLQJUDYLHUWHPDEVWUDNWHP 2UQDPHQW k FP + FD FP NOHLQH $EVSOLWWHUXQJHQ XQG 5DQGOHLFKWYHUULHEHQ%DXFKLJHV6FK”OFKHQk+FPHLQ JURgHU6SUXQJ(LQXQJODVLHUWHUEDXFKLJHU$XIEHZDKUXQJVNUXJ PLW YLHU +HQNHOQ + FP LQWDNW 4 Stück! 7HLOZHLVH VWDUNH 0HHUHV,QNUXVWDWLRQHQ u 3URYHQLHQ](UZRUEHQDXIGHP3DULVHU.XQVWPDUNWDXVIUDQ]¤VLVFKHU Privatsammlung C.B. &ROOHFWLRQRI&HODGRQ&HUDPLFV:KLWHSRUFHODLQZLWKOLJKWJUHHQJOD]H7ZR bowls with abstract ornament, small ovoid body bowl and one unglazed ovoid ERG\VWRUDJHMDUZLWKIRXUOXJKDQGOHV2QHSLHFHZLWK}VVXUHSDUWLDOO\WLQ\ FKLSSLQJDQGVWURQJVHDLQFUXVWDWLRQV&KLQDWKWKFHQWXU\$'4 pie ces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ 6HODGRQ.HUDPLN DXV HLQHP 6FKLIIVZUDFN &KLQD 6RQJ'\QDVWLHXP-KQ&KU$XVZHLgHP3RU]HOODQ PLWJU©QOLFKHU*ODVXU)©QI6FKDOHQkELVFPHLQHJURgH LP ,QQHUHQ GHNRULHUWH 6FKDOH ]ZHL 6FKDOHQ PLW /RWXVEO©WHQ XQG OHLFKW NDQQHOLHUWHQ :”QGHQ ]ZHL NOHLQH 6FK”OFKHQ RKQH 'HNRU5 Stück!(LQ6W©FNPLW$EVSOLWWHUXQJWHLOZHLVH0HHUHV ,QNUXVWDWLRQHQVRQVWLQWDNW u 3URYHQLHQ](UZRUEHQDXIGHP3DULVHU.XQVWPDUNWDXVIUDQ]¤VLVFKHU Privatsammlung C.B. &ROOHFWLRQ RI &HODGRQ &HUDPLFV :KLWH SRUFHODLQ ZLWK OLJKWJUHHQ JOD]H 2QHELJLQVLGHGHFRUDWHGERZOWZRERZOVZLWKORWXV~RZHUDQG~XWHGZDOOV WZR VPDOO ERZOV ZLWKRXW GHFRUDWLRQ 2QH SLHFH ZLWK FKLSSLQJ SDUWLDOO\ VHD LQFUXVWDWLRQVRWKHUZLVHLQWDFW&KLQDWKWKFHQWXU\$'5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 )©QI6FKDOHQGHU6HODGRQ:DUH6RQJ'\QDVWLH-KQ&KU 6WHLQ]HXJPLWJUDXJU©QHU*ODVXU+FPkFP $OOH 6FKDOHQ PLW OHLFKW NRQNDYHU OHLFKW NRQYH[HU :DQGXQJ =ZHL6FKDOHQPLWHLQJHULW]WHPDEVWUDNWHP'HNRUGUHL6FKDOHQ RKQH'HNRU5 Stück!,QWDNWPLW5HVWHQYRQ0HHUHVEHZXFKV u Provenienz: Bei Gorny & Mosch Auktion 260, 2018, Los 811; aus der französischen Privatsammlung C.B., erworben 2006 auf dem Pariser .XQVWPDUNW Five bowls of the celadon ware. Song Dynasty, 12th century A.D. Two with }QHDEVWUDFWGHFRU$OOLQWDFWZLWKUHVWVRIVHDLQFUXVWDWLRQV5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ =KDQJ]KRX 3RU]HOODQ DXV %LQK7KXDQ 6FKLIIVZUDFN &KLQD VS”WH 0LQJ '\QDVWLH XP  $XV JUDXZHLgHP 3RU]HOODQ PLW EO”XOLFKHU *ODVXU XQG EODXHU 8QWHUJODVXUIDUEH (LQH~DFKH6FKDOHPLW]ZHLJHJHQ©EHUVWHKHQGHQ3K¤QL[HQXQG UHLFKHP ~RUDOHP 2UQDPHQW k FP + FP DP 5DQG ZLQ]LJH$EVSOLWWHUXQJDQGHU8QWHUVHLWH0HHUHV,QNUXVWDWLRQHQ =ZHL6FKDOHQPLWHLQHP5HLKHUDXIGHP%RGHQXQG/RWXVEO©WHQ XQG (QWHQ DQ GHQ $XgHQZ”QGHQ k FP + FP DQ GHU 8QWHUVHLWH ZLQ]LJH 0HHUHV,QNUXVWDWLRQHQ VRQVW LQWDNW 3 Stück! u Provenienz: Aus der französischen Privatsammlung C.B.; Ex Christie`s 0HOERXUQH$XFWLRQVW QG0DUFK 9JO &KULVWLHyV $XVWUDOLD 7KH %LQK 7KXDQ 6KLSZUHFN 0HOERXUQH 0DUFK /RV &ROOHFWLRQRI=KDQJ]KRXSRUFHODLQIURP%LQK7KXDQVKLSZUHFN:KLWHSRUFH ODLQZLWKOLJKWEOXHJOD]HDQGEOXHXQGHUJOD]HSDLQW$SODWHZLWKWZRFRQIURQ WLQJVWDQGLQJSKRHQL[HVVXUURXQGHGZLWKULFK~RUDOGHFRUDWLRQWLQ\FKLSSLQJ RQULPVHDLQFUXVWDWLRQVRQERWWRP7ZRERZOVZLWKFUDQHVWDQ}QJLQDSRQG DQGORWXV~RZHUVDQGGXFNVRQWKHRXWHUVLGHWLQ\VHDLQFUXVWDWLRQVRQERW tom, intact. China, around 1600 A.D. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ =KDQJ]KRX 3RU]HOODQ DXV %LQK7KXDQ 6FKLIIVZUDFN &KLQD 0LQJ '\QDVWLH XP  $XV JUDXZHLgHP 3RU]HOODQ PLWEO”XOLFKHU*ODVXUXQGEODXHU8QWHUJODVXUIDUEH(LQHJURgH kFP+FP XQG]ZHLNOHLQH kFP+FP 7HOOHU MHZHLOVPLWHLQHP3K¤QL[XPJHEHQYRQ%OXPHQ3~DQ]HQXQG %”XPHQ5”QGHUPLW)LVFKVFKXSSHQXQG.DUWRXVFKHQPLW%O© WHQGHNRULHUW3 Stück!(LQ6W©FNLQ]ZHL7HLOHQJHEURFKHQXQG ZLHGHU JHNOHEW DQ GHQ 8QWHUVHLWHQ NOHLQH 0HHUHV,QNUXVWDWLR QHQ u Provenienz: Aus der französischen Privatsammlung C.B.; Ex Christie`s 0HOERXUQH$XFWLRQVW QG0DUFK &ROOHFWLRQRI=KDQJ]KRXSRUFHODLQIURP%LQK7KXDQVKLSZUHFN:KLWHSRU FHODLQZLWKOLJKWEOXHJOD]HDQGEOXHXQGHUJOD]HSDLQW2QHELJDQGWZRVPDOO SODWHVHDFKZLWKDSKRHQL[DPRQJVW~RZHULQJSODQWVDQGWUHHVERUGHUVGHFR UDWHGZLWK}VKVFDOHDQGFDUWRXFKHVRI~RUDOVSUD\V&KLQDDURXQG$' 2QHSLHFHUHDVVHPEOHGIURPWZRIUDJPHQWVWLQ\VHDLQFUXVWDWLRQVRQERWWRP 3 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ =KDQJ]KRX 3RU]HOODQ DXV %LQK7KXDQ 6FKLIIVZUDFN &KLQDVS”WH0LQJ'\QDVWLHXP$XVJUDXZHLgHP3RU ]HOODQPLWEO”XOLFKHU*ODVXUXQGEODXHU8QWHUJODVXUIDUEH(LQH JURgH6FKDOHPLWHLQHP3K¤QL[DXIGHP%RGHQXQG(QWHQ]ZL VFKHQ /RWXVEOXWHQ DQ GHQ $XgHQZ”QGHQ k FP + FP DP5DQGHLQ6SUXQJDQGHU8QWHUVHLWHZLQ]LJH0HHUHV,QNUX VWDWLRQHQ=ZHLNOHLQH6FKDOHQPLW+DOENUHLVHQLP%RGHQXQG PLW %OXPHQNRSI2UQDPHQW DQ GHQ $XgHUZ”QGHQ k FP +FPDP5DQGZLQ]LJH$EVSOLWWHUXQJHQXQGHLQ6SUXQJDQ GHQ8QWHUVHLWHQ0HHUHV,QNUXVWDWLRQHQ3 Stück!(LQ6W©FNPLW (WLNHWW$UWFXULDOwXQG,QYHQWDUQXPPHUDXIGHU8QWHUVHLWH u Provenienz: Aus der französischen Privatsammlung C.B.; Ex Christie`s 0HOERXUQH$XFWLRQVW QG0DUFK 9JO &KULVWLHyV $XVWUDOLD 7KH %LQK 7KXDQ 6KLSZUHFN 0HOERXUQH 0DUFK /RV &ROOHFWLRQRI=KDQJ]KRXSRUFHODLQIURP%LQK7KXDQVKLSZUHFN:KLWHSRUFH ODLQZLWKOLJKWEOXHJOD]HDQGEOXHXQGHUJOD]HSDLQW$ELJERZOZLWKSKRHQL[

374


DQGGXFNVEHWZHHQORWXV~RZHUVRQWKHRXWHUVLGHD}VVXUHLQWKHULPWLQ\ VHDLQFUXVWDWLRQVRQERWWRP7ZRVPDOOERZOVZLWKURXQGHOVDQG~RZHUKHDGV RUQDPHQWRQWKHRXWHUVLGHVPDOOFKLSSLQJDQGD}VVXUHLQDULPWLQ\VHD LQFUXVWDWLRQVRQERWWRP&KLQDDURXQG$'2QHSLHFHZLWKÂ $UWFXULDOw sticker and the inventory number on the bottom. 3 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ =KDQJ]KRX 3RU]HOODQ DXV %LQK7KXDQ 6FKLIIVZUDFN &KLQDVSÂ&#x201D;WH0LQJ'\QDVWLHXPQ&KU$XVJUDXZHLgHP 3RU]HOODQ PLW EOÂ&#x201D;XOLFKHU *ODVXU XQG EODXHU 8QWHUJODVXUIDUEH 'UHL6FKDOHQPLWEOŠKHQGHP6WUDXFKYRUHLQHP=DXQLP%RGHQ XQG%OXPHQUDQNHDQGHQ$XgHUZÂ&#x201D;QGHQkFP+FP SDUWLHOOZLQ]LJH6SUŠQJHXQG$EVSOLWWHUXQJHQDP5DQGDXIGHP 6WDQGULQJNOHLQH0HHUHV,QNUXVWDWLRQHQ(LQHNOHLQH6FKDOHPLW %OXPHQDP%RGHQXQGPLW%OXPHQUDQNHDQGHQ$XgHUZÂ&#x201D;QGHQ kFP+FP0HHUHV,QNUXVWDWLRQHQVRQVWLQWDNW=ZHL TXDGUDWLVFKH6FKÂ&#x201D;OFKHQPLWHLQJHGUŠFNWHQ(FNHQXQGPLWHLQHP .DUSIHQGHUDXVGHP:DVVHUVSULQJWkFDFP+FDFP 0HHUHV,QNUXVWDWLRQHQ VRQVW LQWDNW 6 StĂźck! (LQ 6WŠFN PLW (WLNHWW $UWFXULDOwXQG,QYHQWDUQXPPHUDXIGHU8QWHUVHLWH u

 Sieben DĂśschen und Fläschchen. 6SÂ&#x201D;WH0LQJ'\QDVWLHXQG+RL $Q+RDUG-KQ&KU$XVGHP%LQK7KXDQ6FKLIIVIXQG =ZHL '¤VFKHQ PLW 'HFNHO PLW GXQNHOJUDXHU *ODVXU 'RVH LQ .ŠUELVIRUPDXIGHP'HFNHO.UDEEHQ+FPkFP =ZHL)OÂ&#x201D;VFKFKHQLQ.ŠUELVIRUPPLWGXQNHOJUDXHU*ODVXU+ FP=ZHL)OÂ&#x201D;VFKFKHQPLW+LUVFKHQ+FPXQGHLQH /¤IIHO/FPDXVJUDXZHLgHP3RU]HOODQPLWEODXHU8QWHU JODVXUPDOHUHL7 StĂźck!*ODVXUWHLOZHLVHHWZDVEHULHEHQZLQ]LJH $EVSOLWWHUXQJHQ u Provenienz: Aus der franzĂśsischen Privatsammlung C.B.; Ex Christie`s 0HOERXUQH$XFWLRQVW QG0DUFK Seven chinese and vietnamese boxes and jarlets. Two gray glazed boxes with covers and corpus in form of pumpkins, on the lid crabs, two dark grey glazed jarlets with corpus in form of pumpkin, two deer jarlets and a spoon of white porcelain with blue underglazed painting. From the Binh Thuan Shipwreck. /DWH0LQJ'\QDVW\DQG+RL$Q+RDUGWKWKFHQWXU\$'7KHJOD]HLV partially slightly rubbed off, few small splinters. 7 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

&ROOHFWLRQRI=KDQJ]KRXSRUFHODLQIURP%LQK7KXDQVKLSZUHFN:KLWHSRU FHODLQ ZLWK OLJKWEOXH JOD]H DQG EOXH XQGHUJOD]H SDLQW 7KUHH SODWHV ZLWK D EORRPLQJEXVKDQG~RUDOVZLUOVRQWKHRXWHUVLGHVPDOO}VVXUHVDQGFKLSSLQJ LQWKHULPWLQ\VHDLQFUXVWDWLRQVRQERWWRP$VPDOOERZOZLWK~RZHUVDQGVF UROOLQJ~RUDOGHFRUDWLRQRQWKHRXWHUVLGHVHDLQFUXVWDWLRQVLQWDFW7ZRVPDOO square dishes with indented corners and painted with carp leaping from the ZDYHV&KLQDDURXQG$'2QHSLHFHZLWKÂ $UWFXULDOwVWLFNHUDQGWKH inventory number on the bottom. 6 pieces!

 6DPPOXQJ*HIÂ&#x201D;gHDXVGHP+RL$Q+RDUG9LHWQDP-K (LQ'HFNHOJHIÂ&#x201D;gPLWHLQHP8QWHUWHLOLQ)RUPHLQHU.UDEEHXQG 'HNRULQ)RUPHLQHV9RJHOVDXIGHP'HFNHO /FP%FP 0HHUHV,QNUXVWDWLRQHQ HLQ:DVVHUJHIÂ&#x201D;gLQ)RUPHLQHV.XJHO }VFKHVPLWDXIJHVWHOOWHP6FKZDQ] /FP0HHUHV,QNUXVWDWLR QHQ GUHL'HFNHOJHIÂ&#x201D;gHPLW~RUDOHP'HNRU kFP+ FPHLQ6WŠFNPLWNOHLQHQ$EVSOLWWHUXQJHQ GUHLEDXFKL JH*HIÂ&#x201D;gH +FPZLQ]LJH$ESODW]XQJHQGHU*ODVXU  $OOH*HIÂ&#x201D;gHDXVJUDXZHLgHP3RU]HOODQPLWEODXHU8QWHUJODVXU IDUEH8 StĂźck!'UHL6WŠFNHPLW 6DJD+RL$Q+RDUG9LVDOw XQG HLQH PLW  $UWFXULDOw (WLNHWW XQG ,QYHQWDUQXPPHU DXI GHU 8QWHUVHLWH u

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0Â&#x201D;U]  DXV franzĂśsischer Privatsammlung C.B.

 FĂźnf DĂśschen und Fläschchen. 6SÂ&#x201D;WH 0LQJ '\QDVWLH XQG +RL $Q+RDUG-KQ&KU$XVGHP%LQK7KXDQ6FKLIIVIXQG =ZHL '¤VFKHQ PLW 'HFNHO PLW GXQNHOJUDXHU *ODVXU 'RVH LQ .ŠUELVIRUPDXIGHP'HFNHO.UDEEHXQG5RVH+FP kFP(LQ'¤VFKHQPLW'HFNHOLQ.ŠUELVIRUPPLWGXQ NHOJUDXHU *ODVXU + FP k FP .OHLQH )OÂ&#x201D;VFKFKHQ PLW +LUVFKHQDXVJUDXZHLgHP3RU]HOODQPLWEODXHU8QWHUJODVXUPD OHUHL+FP5 StĂźck!*ODVXUWHLOZHLVHHWZDVEHULHEHQVRQVW LQWDNW u

Collection of vessels from the Hoi An Hoard including four boxes, one of them LQFUDEIRUPWKHRWKHUWKUHHURXQGER[HVZLWKDFRYHUZLWK~RUDOGHFRUDWLRQ DZDWHUGURSSHULQVKDSHRIDSXIIHU}VKDQGWKUHHYHVVHOVRIGLIIHUHQWVL]HDOO RIWKHPPDGHRIJOD]HGSRUFHODLQZLWKEOXHXQGHUJOD]HGSDLQWLQJ9LHWQDP WKWKFHQWXU\$'0RVWO\LQWDFWWLQ\IUDJPHQWVPLVVLQJ7KUHHSLHFHV ZLWKÂ 6DJD+RL$Q+RDUG9LVDOwDQGRQHZLWKÂ $UWFXULDOwVWLFNHUVDQGWKH inventory number on the bottom. 8 pieces!

Provenienz: Aus der franzĂśsischen Privatsammlung C.B.; Ex Christie`s 0HOERXUQH$XFWLRQVW QG0DUFK 9JO &KULVWLHyV $XVWUDOLD 7KH %LQK 7KXDQ 6KLSZUHFN 0HOERXUQH 0DUFK /RV

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

Provenienz: Aus der franzĂśsischen Privatsammlung C.B.; Ex Christie`s 0HOERXUQH$XFWLRQVW QG0DUFK Five chinese and vietnamese boxes and jarlets. Two gray glazed boxes with covers and corpus in form of pumpkins, on the lid crab and rose, a dark grey glazed box with cover in form of pumpkin, a dark grey glazed jarlet in form of pumpkin, a deer jarlet of white porcelain with blue underglazed painting. From the Binh Thuan Shipwreck. Late Ming Dynasty and Hoi An Hoard, WKWKFHQWXU\$'7KHJOD]HLVSDUWLDOO\VOLJKWO\UXEEHGRIIRWKHUZLVH intact. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

375


 6DPPOXQJ*HIÂ&#x201D;gHDXVGHP+RL$Q+RDUG9LHWQDP-K =ZHL:DVVHUJHIÂ&#x201D;gHIŠU.DOOLJUD}HLQ)RUPHLQHV(OHIDQWHQXQG HLQHV NQLHQGHQ %ŠIIHONDOEHV /  X FP +  X FP LQWDNW PLW 0HHUHV,QNUXVWDWLRQHQ  HLQH ELUQHQI¤UPLJH )ODVFKH YRP 7\S <XKXFKXQ + FP $EVSOLWWHUXQJ DP 5DQG  HLQ ]\OLQGULVFKHV + FP LQWDNW  XQG ]ZHL EDXFKLJH *HIÂ&#x201D;gH + FPLQWDNW PLW~RUDOHPX}JŠUOLFKHP'HNRU$OOH*H IÂ&#x201D;gHDXVJUDXZHLgHP3RU]HOODQPLWEODXHU8QWHUJODVXUIDUEH6 StĂźck!6WŠFNPLW(WLNHWW 6DJDu+RL$Q+RDUGu9LVDOwXQG ,QYHQWDUQXPPHUDXIGHU8QWHUVHLWH u 3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0Â&#x201D;U]  DXV franzĂśsischer Privatsammlung C.B. Collection of vessels from the Hoi An Hoard including two water droppers in VKDSHRIDQHOHIDQWDQGDVPDOOZDWHUEXIIDORDQ<XKXFKXQERWWOHWKUHHMXJV RIGLIIHUHQWVL]HVZLWK~RUDOGHFRUDWLRQDOORIWKHPPDGHRIJOD]HGSRUFHODLQ ZLWKEOXHXQGHUJOD]HGSDLQWLQJ9LHWQDPWKWKFHQWXU\$'0RVWO\LQ tact, tiny fragments missing, traces of sinter. Three pieces with a sticker â&#x20AC;&#x17E;Saga +RL$Q+RDUG9LVDOwDQGWKHLQYHQWRU\QXPEHURQWKHERWWRP6 pieces!

with green, gold and red enamel. Both pieces of glazed porcelain with blue XQGHUJOD]HGSDLQWLQJ9LHWQDPWKWKFHQWXU\$'7UDFHVRIVLQWHUDQG VHDLQFUXVWDWLRQV2QHSLHFHZLWKDVWLFNHUÂ 6DJD+RL$Q+RDUG9LVDOwDQG the inventory number on the bottom. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ *HIÂ&#x201D;gH DXV GHP +RL $Q +RDUG 9LHWQDP    -K=ZHL:DVVHUJHIÂ&#x201D;gHIŠU.DOOLJUD}HLQ)RUPHLQHV)URVFKHV XQGHLQHVNQLHQGHQ%ŠIIHONDOEHV /XFP+XFP LQWDNWPLW0HHUHV,QNUXVWDWLRQHQ HLQNOHLQHVEDXFKLJHV*HIÂ&#x201D;g PLW 9¤JHO'DUVWHOOXQJ + FP LQWDNW  IŠQI 'HFNHOJHIÂ&#x201D;gH GDUXQWHUHLQHLQIDUELJHV*HIÂ&#x201D;gPLW'HFNHOLQ)RUPHLQHU%OŠWH HLQ*HIÂ&#x201D;gPLW/DQGVFKDIWDXIGHP'HFNHOHLQRNWDJRQDOHVXQG ]ZHL EDXFKLJH *HIÂ&#x201D;gH PLW ~RUDOHP X }JŠUOLFKHP 'HNRU k   FP +   FP 5HVWH YRQ 6LQWHU HLQ 6WŠFN PLW 6SUXQJ NOHLQH %HVWRgXQJHQ  $OOH *HIÂ&#x201D;gH DXV JUDXZHLgHP 3RU]HOODQPLWEODXHU8QWHUJODVXUIDUEHELVDXIHLQ'HFNHOJHIÂ&#x201D;g8 StĂźck!6WŠFNPLW(WLNHWW 6DJD+RL$Q+RDUG9LVDOwXQG ,QYHQWDUQXPPHUDXIGHU8QWHUVHLWH u

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0Â&#x201D;U]  DXV franzĂśsischer Privatsammlung C.B.

 6DPPOXQJ *HIÂ&#x201D;gH DXV GHP +RL $Q +RDUG 9LHWQDP    -K (LQH ELUQHQI¤UPLJH )ODVFKH YRP 7\S <XKXFKXQ + FP +DOV XQG 5DQG HUVHW]W  HLQH ~DFKH 6FKDOH k FP $ESODW]XQJ GHU *ODVXU  HLQ EDXFKLJHV *HIÂ&#x201D;g PLW ~RUDOHP 'HNRU +FPDP5DQG$EVSOLWWHUXQJHQ GUHL'HFNHOJHIÂ&#x201D;gH HLQHLQIDUELJHVHLQEDXFKLJHVPLWHLQHU1RSSHDXIGHP'HFNHO XQGHLQ]\OLQGULVFKHV kFP+FPLQWDNW $OOH *HIÂ&#x201D;gHDXVJUDXZHLgHP3RU]HOODQPLWEODXHU8QWHUJODVXUIDUEH ELVDXIHLQ'HFNHOJHIÂ&#x201D;g6 StĂźck!6WŠFNPLW(WLNHWW 6DJD+RL $Q+RDUG9LVDOwXQG,QYHQWDUQXPPHUDXIGHU8QWHUVHLWH u

Collection of vessels from the Hoi An Hoard including two water droppers in shape of a frog and a small water buffalo, a jarlet with birds, four persimmon shaped boxes, one of them with a blossom shaped cover, one with landscape, DQG RQH RFWDJRQDO ER[ ZLWK ~RUDO DQG JHRPHWULFDO GHFRUDWLRQ DOO RI WKHP made of glazed porcelain with blue underglazed painting except of one box. 9LHWQDPWKWKFHQWXU\$'0RVWO\LQWDFWWLQ\IUDJPHQWVPLVVLQJWUD FHVRIVLQWHUDQGVHDLQFUXVWDWLRQV7ZRSLHFHVZLWKDVWLFNHUÂ 6DJD+RL$Q +RDUG9LVDOwDQGWKHLQYHQWRU\QXPEHURQWKHERWWRP8 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

&ROOHFWLRQRIYHVVHOVIURPWKH+RL$Q+RDUGLQFOXGLQJDQ<XKXFKXQERWWOH D VKDOORZ ERZO D MDUOHW ZLWK ~RUDO GHFRUDWLRQ WZR SHUVLPPRQ VKDSHG DQG one cylindrical covered boxes, all of them made of glazed porcelain with blue XQGHUJOD]HGSDLQWLQJH[FHSWRIRQHER[9LHWQDPWKWKFHQWXU\$' Small fragments missing, bottle with restored upper part. Three pieces with DVWLFNHUÂ 6DJD+RL$Q+RDUG9LVDOwDQGWKHLQYHQWRU\QXPEHURQWKH bottom. 6 pieces!

 6DPPOXQJ *HIÂ&#x201D;gH DXV GHP +RL $Q +RDUG 9LHWQDP    -K=ZHLEDXFKLJH*HIÂ&#x201D;gHPLW~RUDOHPXRUQDPHQWDOHP'HNRU +XFP5HVWHYRQ6LQWHU VHFKV'HFNHOJHIÂ&#x201D;gHGDUXQ WHUYLHUEDXFKLJHXQGHLQ]\OLQGULVFKHV*HIÂ&#x201D;gDXIGHQ'HFNHOQ GUHLPDO/DQGVFKDIWHQ]ZHLPDO/RWXVEOŠWHQXQGHLQH5DXWH]ZL VFKHQ2UQDPHQWEÂ&#x201D;QGHUQ kFP+FP5HVWHYRQ 6LQWHUNOHLQH%HVWRgXQJHQ $OOH*HIÂ&#x201D;gHDXVJUDXZHLgHP3RU ]HOODQPLWEODXHU8QWHUJODVXUIDUEH8 StĂźck!6WŠFNPLW(WLNHWW  6DJDu+RL$Q+RDUGu9LVDOwXQG,QYHQWDUQXPPHUDXIGHU 8QWHUVHLWH u

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0Â&#x201D;U]  DXV franzĂśsischer Privatsammlung C.B.

 =ZHL*HIÂ&#x201D;gHDXVGHP+RL$Q+RDUG9LHWQDP-K(LQH 3DSDJHL XQG 3}UVLFK6FKDOH GHU 3DSDJDL PLW QDFK DXgHQ JH ERJHQHP6FKZDQ]GLHS}UVLFKI¤UPLJH6FKDOHDXgHQPLWHLQHP %ODWWXQGLQQHQPLWHLQHU%OXPHGHNRULHUW +FP/FP %FPPLW0HHUHV,QNUXVWDWLRQHQ XQGHLQ'HFNHOJHIÂ&#x201D;gPLW ]XVÂ&#x201D;W]OLFKHP JUŠQHP JROGHQHP XQG URWHP (PDLO'HNRU k FP+FP5HVWHYRQ6LQWHU %HLGH*HIÂ&#x201D;gHDXVJUDXZHL gHP3RU]HOODQPLWEODXHU8QWHUJODVXUIDUEH2 StĂźck!(LQ6WŠFN PLW(WLNHWW 6DJD+RL$Q+RDUG9LVDOwXQG,QYHQWDUQXPPHU DXIGHU8QWHUVHLWH u

&ROOHFWLRQRIYHVVHOVIURPWKH+RL$Q+RDUGLQFOXGLQJWZRMDUOHWVZLWK~RUDO DQGRUQDPHQWDOGHFRUDWLRQVL[ER[HV}YHRIWKHPSHUVLPPRQVKDSHGRQH cylindrical, on covers landscapes, lotus blossoms and a rhombus with orna mented circles, all of them made of glazed porcelain with blue underglazed SDLQWLQJ9LHWQDPWKWKFHQWXU\$'6PDOOIUDJPHQWVPLVVLQJWUDFHV RIVLQWHU)RXUSLHFHVZLWKDVWLFNHUÂ 6DJD+RL$Q+RDUG9LVDOwDQGWKH inventory number on the bottom. 8 pieces!

3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0Â&#x201D;U]  DXV franzĂśsischer Privatsammlung C.B.

3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0Â&#x201D;U]  DXV franzĂśsischer Privatsammlung C.B. 7ZRYHVVHOVIURPWKH+RL$Q+RDUGLQFOXGLQJDSDUURWDQGSHDFKERZOSDUURW LV FXUOHG DURXQG ZLWK DQ RXWVWDQGLQJ WDLO SHDFKIRUPHG ERZO LV GHFRUDWHG ZLWKDOHDIDQGD~RZHUDQGDSHUVLPPRQVKDSHGFRYHUHGER[DGGLWLRQDOO\

376

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!


 6DPPOXQJ*HI”gHDXVGHP+RL$Q+RDUG9LHWQDP-K )©QI'HFNHOJHI”gHkFP+FPZLQ]LJH%H VWRgXQJHQGDUXQWHUYLHUEDXFKLJHXQGHLQ]\OLQGULVFKHV*HI”g DXIGHQ'HFNHOQYLHUPDO/DQGVFKDIWHQXQGHLQPDO%OXPHQ$OOH *HI”gHDXVJUDXZHLgHP3RU]HOODQPLWEODXHU8QWHUJODVXUIDUEH 5 Stück!(LQ6W©FNPLW(WLNHWW6DJD+RL$Q+RDUG9LVDOw XQG,QYHQWDUQXPPHUDXIGHU8QWHUVHLWH u 3URYHQLHQ] ([ %XWWHU}HOG 6DQ )UDQFLVFR $XNWLRQ 0”U]  DXV französischer Privatsammlung C.B. Collection of boxes from the Hoi An Hoard, four of them persimmon shaped, RQHF\OLQGULFDORQFRYHUVODQGVFDSHVDQG~RZHUVDOORIWKHPPDGHRIJOD]HG SRUFHODLQZLWKEOXHXQGHUJOD]HGSDLQWLQJ9LHWQDPWKWKFHQWXU\$' 6PDOOIUDJPHQWVPLVVLQJ2QHSLHFHZLWKDVWLFNHU6DJD+RL$Q+RDUG 9LVDOwDQGWKHLQYHQWRU\QXPEHURQWKHERWWRP5 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung buddhistische und hinduistische Kunst. D %URQ]HVWD WXHWWH HLQHV VLW]HQGHQ %XGGKDV + FP  PLW %KXPLVSDUVKD 0XGUD*HVWH 7KDLODQG    -K 'XQNOH 3DWLQD LQWDNW E  %URQ]HVWDWXHWWHHLQHVVWHKHQGHQ%XGGKDV +FP DXIHLQHU %DVLVDXVHLQHUVHFKVHFNLJHQ3ODWWHPLWHLQHUJHVFKORVVHQHQ/R WXVEO©WHGDUDXIGLH%DVLVLVWLQQHQKRKO'LH)LJXUEHVWHKWDXV ]ZHL7HLOHQGLH%DVLVPLWGHQ)©gHQXQGHLQHP=DSIHQDXIGHQ GHU©EULJH7HLOGHU6WDWXHWWHJHVWHFNWLVW'LH+”QGHVLQGVRYRU GHP.¤USHUDQJHZLQNHOWDOVREVLHHLQH$OPRVHQVFKDOHKDOWHQ 7KDLODQG-KLQWDNWF 6LW]HQGH+RO]VWDWXHWWHHLQHV%XGGKDV DXIHLQHP7KURQPLWGHU0XGUDGHU(UGEHU©KUXQJVJHVWH'LH )LJXU LVW YHUJROGHW GHU 7KRUQ LVW WHLOZHLVH YHUJROGHW XQG PLW URWHU)DUEHEHPDOW$XIGHP*HZDQGVDXPGHP'LDGHPXQG 6FKPXFNHOHPHQWHQ GHV 7KURQV *ODVHLQODJHQ LQ URW JU©Q XQG ZHLg +FP %XUPD-KRGHUVS”WHUPRQWLHUWDXIHLQHU /I¤UPLJHQ%DVLV2EHU~”FKHHWZDVEHULHEHQG 7HLOYRQHLQHP UHFKWHFNLJHQ+RO]UHOLHI /FDFP+FP PLW$XIK”QJXQJ GDUDXI GLH VLW]HQGH *¤WWLQ .DOL PLW HUKREHQHU UHFKWHU +DQG ,QGLHQ-K)UDJPHQWDULVFK4 Stück! u 3URYHQLHQ]$XVGHUGHXWVFKHQ6DPPOXQJ$:E G H[*RUQ\ 0RVFK /RV H[6DPPOXQJ-%0©QFKHQVHLWGHQHU-DKUHQw  Small collection of Buddhist and Hindo Art. a) Bronze statuette of enthroned %XGGKDZLWK%KXPLVSDUVKD0XGUD7KDLODQGWKWKFHQWXU\$''DUN patina, intact. b) Bronze standing Buddha statuette of two parts. Thailand, WK FHQWXU\ $' ,QWDFW F  (QWKURQHG JLOGHG ZRRGHQ %XGGKD ZLWK PXOWL FRORUHG JODVV LQOD\V %XUPD WK FHQWXU\ $' 6XUIDFH ZRUQ G  :RRGHQ UHOLHI GHSLFWLQJ WKH +LQGX JRGGHVV .DOL ,QGLD WK FHQWXU\ $' RU ODWHU Fragmentary. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

e Elefantensiegel aus Bronze. $VLHQ+FP2EHQVHDXIGHU 8QWHUVHLWHGHUUXQGHQ6WDQG~”FKH6LHJHOPLWHLQHPYLHUI©gLJHQ 7LHUPLWODQJHP6FKZDQ]ZDKUVFKHLQOLFKHLQVWLOLVLHUWHU/¤ZH 6FKZDU]H3DWLQDLQWDNW u 3URYHQLHQ]([6KORPR0RXVVDLHII&ROOHFWLRQ([SRUWLHUWPLW der Ausfuhrgenehmigung der israelischen Antikenbehörde. Bei Gorny & 0RVFK$XNWLRQ/RV

 Sammlung Asiatica. :RKOKDXSWV”FKOLFK+”OIWH-K(OIHQ EHLQXQG%HLQ'DUXQWHUGUHLMDSDQLVFKHVLJQLHUWH1HWVXNH + FPFPFP $XgHUGHPGUHL3IHUGH}JXUHQDXI6RFNHOQ /FP HLQ*HVSDQQ /FP YLHUNOHLQHUH7LHU}JXUHQXQG HLQH0LQLDWXUVNXOSWXUHLQHV+”QGOHUV6W©FN$FKWXQJ9HU VDQGLQ1LFKW(86WDDWHQXQWHUOLHJW&,7(65HJXODULHQ u 3URYHQLHQ]([6DPPOXQJ$.0©QFKHQYRU 6PDOOFROOHFWLRQRIDVLDWLFDFRPSULVLQJQHWVXNHDQGYDULRXVKRUVHVFXOSWXUHV Mainly 1st half 20th century.  SLHFHV $WWHQWLRQ  VKLSSLQJ WR QRQ(8 FRXQWULHVVXEMHFWWR&,7(6UHJXODWLRQV VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung Scrimshaws mit maritimen Motiven.  -K Q &KU $OOH DXV :DO]”KQHQ D  $QVLFKW HLQHV 0DQRI:DU GHV   -KV GDUXQWHU %DQGHUROH PLW GHU $XIVFKULIW /D 9HQXVw / FP 0LW 6W”QGHU E  3RUWU”W GHU 'XWFKHVV RI %HDXIRUG (OLVDEHWK %RVFDZHQ 6RPHUVHW  QDFKGHP*HP”O GH :RPDQ LQ %OXHw YRQ 7KRPDV *DLQVERURXJK  $QVLFKW HLQHV 'UHLPDVWHUV PLW 1DPHQ 3RO\SKHPXV YLHOOHLFKW GDV EH U©KPWHHQJOLVFKH/LQLHQVFKLII5DQJHV  GDVLQGHQ 6FKODFKWHQYRQ.RSHQKDJHQXQG7UDIDOJDUN”PSIWH 6LJQDWXU%w/FP0LW6W”QGHUF 3RUWU”WGHV5HDU$GPL UDO 6LU +RUDWLR 1HOVRQ IUHL QDFK HLQHP *HP”OGH YRQ /HPX HO )UDQFLV $EERWW  5©FNDQVLFKW GHV /LQLHQVFKLIIHV  5DQJHV +069LFWRU\1HOVRQV)ODJJVFKLIILQGHU6FKODFKWYRQ7UDIDOJDU 6LJQDWXU%DFULw/FPG 6HLWHQDQVLFKWGHVDPHULND QLVFKHQ.OLSSHUV6RYHUHLJQRIWKH6HDV  HUEDXWYRQ 'RQDOG0F.D\LQ%RVWRQJLOWGDV6FKLIIDOVHLQHUGHUVFK¤QVWHQ XQGPLW.QRWHQDOVHLQHUGHUVFKQHOOVWHQ.OLSSHU,QGUHL =HLOHQ8QLWHG6WDWHV&OLSSHU6RYHUHLJQRIWKH6HDVw /FP9RPJOHLFKHQ.©QVWOHUH )URQWDODQVLFKWHLQHV.OLS SHUVVHLWOLFKGLH,QVFKULIW(0/,<w/FPI 6HLWHQDQ VLFKWHLQHV5DGGDPSIHUVPLWVWLOLVLHUWHUDPHULNDQLVFKHU)ODJJH GDYRU /,1&2/1w / FP  6W©FN $FKWXQJ  9HUVDQG LQ 1LFKW(86WDDWHQXQWHUOLHJW&,7(65HJXODULHQ$OOHLQWDNW u 3URYHQLHQ]([6DPPOXQJ$.0©QFKHQYRUHUZRUEHQ Collection of Scrimshaws with maritime subjects. 20th century A.D. Made RIZKDOHWHHWKD 0DQRI:DURIWKHWKFHQWXU\EHORZEDQGHUROHZLWK /D9HQXVw:LWKVWDQGE 3RUWUDLWRIWKH'XWFKHVVRI%HDXIRUG(OLVDEHWK %RVFDZHQ 6RPHUVHW  DIWHUWKHSDLQWLQJ:RPDQLQ%OXHwE\ 7KRPDV *DLQVERURXJK  6DLOLQJ VKLS ZLWK WKH QDPH 3RO\SKHPXV SHUKDSV WKHIDPRXV(QJOLVKVKLSRIWKHOLQHUGUDWH  ZKLFKZDVLQYROYHG LQWKH%DWWOHRI&RSHQKDJHQDQG7UDJIDOJDU6LJQDWXUH%w:LWK VWDQGF 3RUWUDLWRI5HDU$GPLUDO6LU+RUDWLR1HOVRQIUHHO\DGDSWHGIURPWKH SDLQWLQJE\/HPXHO)UDQFLV$EERWW%DFNYLHZRIWKH+069LFWRU\~DJJVKLS RI/RUG1HOVRQLQWKH%DWWOHRI7UDIDOJDU6LJQDWXUH%DFULwG 6LGHYLHZ RIWKH86FOLSSHUV6RYHUHLJQRIWKH6HDV  FRQVWUXFWHGE\'RQDOG 0F.D\LQ%RVWRQWKHVKLSDUHFRQVLGHUHGWREHRQHRIWKHPRVWEHDXWLIXODQG IDWHVWFOLSSHUVRIDOOWLPH,QWKUHHOLQHV8QLWHG6WDWHV&OLSSHU6RYHUHLJQ RIWKH6HDVw)URPWKHVDPHDUWLVWH )URQWYLHZRIDFOLSSHUOHIWWKH LQVFULSWLRQ(0/,<wI 6LGHYLHZRIDSDGGOHVWHDPHUZLWKVW\OL]HG~DJ RIWKH86$EHIRUH/,1&2/1w$OOLQWDFWSLHFHV$WWHQWLRQVKLSSLQJWR QRQ(8FRXQWULHVVXEMHFWWR&,7(6UHJXODWLRQV VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

Bronze elephant seal depicting a quadruped animal with long tail, probably a stylized lion. Asia. Black patina, intact. VERKAUFT WIE BESEHEN, KEINE RÜCKGABE! / SOLD AS VIEWED, NO RETURN!

377


 Sammlung Scrimshaws mit Walfangdarstellungen. -KQ&KU $OOHDXV:DO]Â&#x201D;KQHQD (LQDXIGHP5ŠFNHQOLHJHQGHU3RWWZDO ZLUG YRQ HLQHP %HLERRW DXV KDUSXQLHUW OLQNV HLQ /HXFKWWXUP DXIHLQHU/DQG]XQJHLP+LQWHUJUXQGXQWHUJHKHQGH6RQQH=X VÂ&#x201D;W]OLFKPLW5RW*HOEXQG%ODXNRORULHUW5HFKWV *LYHQ&DWE\ -XYHQDO&DVWURw%HL-XYHQDO&DVWURKDQGHOWHVVLFKXPHLQHQ DQJHVHKHQHQ.ŠQVWOHUGHPPDQ]%HLQH$XVVWHOOXQJLP0X VHXGH$QJUDGR+HURÂ&#x153;GPR7HUFHLUDJHZLGPHWKDW/FP 0RQWLHUWDXIHLQHQ6WÂ&#x201D;QGHUE 8PODXIHQGH'DUVWHOOXQJEHLGHU 6HHOHXWHLP%HLERRWDXIGDVVLQNHQGH0XWWHUVFKLIIEOLFNHQOLQNV UDJWGHU.RSIHLQHV3RWWZDOHVDXVGHP:DVVHU6LJQDWXU %DFULw 0LW6WÂ&#x201D;QGHU/FPF 9RQHLQHP%HLERRWDXVKDUSRQLHUWHLQ :DOIÂ&#x201D;QJHUGHQ:DOYRQGHPQXUGHU5ŠFNHQDXVGHP:DVVHU VFKDXW/FPG ,QDUNWLVFKHU/DQGVFKDIWWUHQQHQ:DOIÂ&#x201D;Q JHU GLH 6SHFNVFKLFKW YRP :DO DE 6LJQDWXU  *w / FP 4 6WŠFN$FKWXQJ9HUVDQGLQ1LFKW(86WDDWHQXQWHUOLHJW&,7(6 Regularien!$OOHLQWDNW u 3URYHQLHQ]([6DPPOXQJ$.0ŠQFKHQYRUHUZRUEHQ Collection of Scrimshaws with depictions of whaling. 20th century A.D. Made of whale teeth. a) A sperm whale get harpooned by whalers in a longboat, left a lighthouse standing on cliff, at the horizon a sunset. Colorized with UHG\HOORZDQGEOXH5LJKWWKHLQVFULSWLRQ *LYHQ&DWE\-XYHQDO&DVWURw Juvenal Castro is a notable Scrimshaw artist who exibited e.g. in the Museu de Angra do HeroĂ­dmo, Terceira. Mounted on a stand. b) Circulating image RIDGUDPWLFVFHQH:KDOHUVLQDORQJERDWORRNLQJWRWKHLUVLQNLQJEDVLVVKLS OHIWDULVHGWKHKHDGRIDVSHUPZKDOHRXWRIWKHZDWHU6LJQDWXUH %DFULw:LWK VWDQGF :KDOHUVLQDORQJERDWKDUSRRQLQJDZKDOHZKLFKEDFNLVORRNLQJ RXWRIWKHZDWHUG ,QDQDUFWLFODQGVFDSHZKDOHUVFXWWLQJRIIOD\HUVRIIDWRID ZKDOH6LJQDWXUH *w$OOLQWDFWSLHFHV$WWHQWLRQVKLSSLQJWRQRQ(8 FRXQWULHVVXEMHFWWR&,7(6UHJXODWLRQV VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung Scrimshaws von Yuet Shaw. -KQ&KU$OOHDXV :DOURVV]Â&#x201D;KQHQ XQG VLJQLHUW PLW  <XHW 6KDZw RGHU  $X <XHW 6KDZw D  :DOIÂ&#x201D;QJHU LQ HLQHP %HLERRW KDUSXQLHUHQ HLQHQ 3RWWZDOLP+LQWHUJUXQGHLQH%ULJJ 0XWWHUVFKLII XQGHLQ.XWWHU 9ROOVFKLIIXQG.XWWHULQXQUXKLJHU6HH/FP0LW6WÂ&#x201D;QGHU 6SLW]HJHEURFKHQXQGZLHGHUDQJHVHW]WE =ZHLEULJJJHWDNHOWH :DOIÂ&#x201D;QJHU]ZHL6HJOHUPLWHLQHP5DKVHJHOXQGHLQ.XWWHUXQWHU 6HJHOQ LP 9RUGHUJUXQG .RSI XQG 6FKZDQ] ]ZHLHU 3RWWZDOH / FP ,QWDNW F  =ZHL EULJJJHWDNHOWH :DOIÂ&#x201D;QJHU OLQNV HLQ .XWWHU XQG UHFKWV HLQ 6HJOHU PLW 5DKVHJHO LP 9RUGHUJUXQG KDUSXQLHUHQ :DOIÂ&#x201D;QJHU LQ ]ZHL %HLERRWHQ HLQHQ 3RWWZDO OLQNV GLH 6FKZDQ]~RVVH HLQHV ZHLWHUHQ :DOHV / FP ,QWDNW G  (LQH)UHJDWWHXQGHLQH%ULJJLP*HIHFKWPLWHLQDQGHU/FP (LQ)UDJPHQWJHEURFKHQXQGZLHGHUDQJHVHW]W4 StĂźck! Achtung 9HUVDQGLQ1LFKW(86WDDWHQXQWHUOLHJW&,7(65HJXODULHQ u 3URYHQLHQ]([6DPPOXQJ$.0ŠQFKHQYRUHUZRUEHQ

Collection of Scrimshaws with depictions of whaling and war at sea. All with WKHVLJQDWXUHÂ <XHW6KDZwRUÂ $X<XHW6KDZwWKFHQWXU\$'0DGHRI ZDOUXV WHHWK D  :KDOHUV LQ D ORQJERDW KDUSRRQLQJ D VSHUP ZKDOH LQ WKH EDFNJURXQGDEULJDQGFXWWHU)XOOULJJHGVKLSDQGFXWWHULQURXJKVHD:LWK stand. Top is broken and reattached. b) Two brigs, two sailers with square rig DQGDFXWWHULQWKHIRUHJURXQGKHDGDQGWDLORIWZRVSHUPZKDOHV,QWDFWF  Two brigs, left a cutter, right a sailer with square rig, in the foreground whalers in two longboats harpooning a sperm whale, on the left the tail of another ZKDOH,QWDFWG $FWLRQEHWZHHQDIULJDWWHDQGEULJ2QHIUDJPHQWLVEURNHQ and reattached. SLHFHV$WWHQWLRQVKLSSLQJWRQRQ(8FRXQWULHVVXEMHFW to CITES regulations! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

378

 Dose aus graviertem Pferdeknochen. :DKUVFKHLQOLFK'HXWVFKODQG  -K Q &KU + FP ,Q 6FULPVKDZ7HFKQLN YHU]LHUWHU .QRFKHQ PLW 'HFNHO XQG %RGHQ =ZLVFKHQ YHJHWDELOHQ XQG RUQDPHQWDOHQ6FKPXFNEÂ&#x201D;QGHUQDXIHLQHU6HLWHGLH'DUVWHOOXQJ HLQHU QDFNWHQ )UDX PLW )XFKV DXI GHU DQGHUHQ HLQH 'DPH LQ PLWWHODOWHUOLFKHU .OHLGXQJ PLW .UDQ] XQG %OXPH 'HFNHO XQG %RGHQUH]HQWJHNOHEWVRQVWLQWDNW u 3URYHQLHQ]([6DPPOXQJ$.0ŠQFKHQYRUHUZRUEHQ Tall box with lid and separate bottom made of a horse bone and decorated LQ6FULPVKDZWHFKQLTXH3UREDEO\*HUPDQWKFHQWXU\$'2QRQHVLGH a nude woman with fox, on the another side a woman in medieval dress with ZUHDWKDQG~RZHU/LGDQGERWWRPDUHUHFHQWO\}[HGRWKHUZLVHLQWDFW VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ DQWLNHU 2EMHNWH D  / FP 6SÂ&#x201D;WDQWLNH 7HUUDFRW WD/DPSH PLW .DQWKDURV DXI GHP 6SLHJHO GHNRULHUWHU %RGHQ PLW,QVFKULIW.OHLQH$EVSOLWWHUXQJXQG6SUXQJSDUWLHOOYHUVLQ WHUW E  / FP 6SÂ&#x201D;WDQWLNH 7HUUDFRWWD/DPSH PLW JHRPHWUL VFKHP'HNRU%UDQGVSXUHQXQGYHUVLQWHUWNOHLQH$EVSOLWWHUXQJ F +FP8QWHULWDOLVFKHV/HEHV*HIÂ&#x201D;gPLW$XVJXVVDXIGHU 6FKXOWHUFD-KY&KURKQH'HFNHO5HVWHYRQ3RO\ FKURPLH G  + FP %FP .HUDPLVFKHV )UDJPHQW LQ )RUP HLQHV/RWXVEOŠWHQEODWWHVLQJUŠQOLFKHU*ODVXU6ŠGRVWDVLHQ5HOL HIPLWVLW]HQGHU/DNVKPLSDUWLHOODEJHULHEHQ4 StĂźck! u 3URYHQLHQ] $XV GHQ HKHPDOLJHQ 5HVWEHVWÂ&#x201D;QGHQ GHU 0ŠQ]KDQGOXQJ .DUO .UHVV0ŠQFKHQYRU Collection of antique objects: two late roman terracotta lamps with cantharoi and with ornaments, a canosian lebes with rests of coloring and a ceramic part in form of lotus petal with Lakshmi. Partially chipping and rubbed off surface. 4 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 Sammlung Ă&#x201E;gyptiaka und anderes. 'DUXQWHU ]ZHL 5HOLHIEUXFK VWŠFNH PLW +LHURJO\SKHQ HLQ )UDJPHQW HLQHV 0XPLHQWXFKHV PLW %HPDOXQJVUHVWHQ  NOHLQH VSÂ&#x201D;W]HLWLJH 8VKHEWLV .RSI GHV +DUSRNUDWHV DOH[DQGULQLVFKH 7HUUDNRWWD}JXU  7RQODP SHQ  LVODPLVFKH *OÂ&#x201D;VHU EURQ]HQH 3IHLOHU IUŠKJHVFKLFKWOLFKH 'ROFKIUDJPHQWH NHUDPLVFKH *HIÂ&#x201D;gH XQG ]DKOUHLFKH .HUDPLN IUDJPHQWHMehr als 100 StĂźck! u 3URYHQLHQ]([6DPPOXQJ5:+HVVHQ)DPLOLHQEHVLW]VHLWYRU Collection of diverse objects, mostly Egyptiaca: fragments of reliefs, mummy FORWKODWH8VKHEWLVWHUUDFRWWD}JXUHVFOD\ODPSVJODVVFHUDPLFSLHFHVMore than 100 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!


 6DPPOXQJ .XQVWREMHNWH  -K Y &KU   -K 6FKHUEH YRQ HLQHP JULHFKLVFKJHRPHWULVFKHQ *HIÂ&#x201D;g PLW :DVVHUYRJHOIULHV .RULQWK" %FP-KY&KUNRULQWKLVFKHU$U\EDOORVPLU 6SKLQ[+FPEHULHEHQLQWDNW-KY&KULVODPLVFKHV*ODV -KQ&KU+FPLQWDNWÂ&#x201D;WKLRSLVFKHV6LOEHUNUHX]-K +FPFKLQHVLVFKHV&HODGRQ*HIÂ&#x201D;g +FPLQWDNW XQG PLWWHODOWHUOLFKH.DQQH+FPLQWDNW6 StĂźck! u

 6DPPOXQJ DUDERE\]DQWLQLVFKHU 2EMHNWH 'DUXQWHU HLQH 6LOEHU /FP XQGHLQH~DFKH%HLQQDGHO /FP ]ZHLEURQ]HQH 9¤JHO + XP FP  HLQ EURQ]HQHU 5HLI PLW 7LHUN¤SIHQ XQG ]ZHL5LQJHHLQHJROGHQH$SSOLN kFP HLQHJROGHQHXQG IŠQI VLOEHUQH LVODPLVFKH 0ŠQ]HQ GD]X HLQ U¤PLVFKHU 5LQJ HLQ 6WHLQYRJHO XQEHVWLPPWHU +HUNXQIW XQG HLQH PRGHUQH 5ROOVLHJHOUHSOLN17 Stßck!*URgWHLOVJXWHUKDOWHQ u

3URYHQLHQ]([6DPPOXQJ)7%DGHQ:©UWWHPEHUJHUHU-DKUH

3URYHQLHQ]([6DPPOXQJ&%+HVVHQYRU

Collection of objects from Greek geometrical period to 20ties century, compri sing a Greek geometric sherd, a Corinthian aryballos, an early islamic glass, a Chinese celadon vessel, a medieval european jug, an Ethiopian silver cross. 6 pieces!

Collection of mostly arabic and byzantine objects and coins. Mostly in good condition. 17 pieces!

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 3HUOHQNHWWH XQG <RUWDQ*HIÂ&#x201D;g 'DUXQWHU HLQH 6DPPOXQJ LVODPLVFKHU *ODVSHUOHQ LQ XQWHUVFKLHGOLFKHQ )RUPHQ / FP DXIJHIÂ&#x201D;GHOWLVODPLVFK-KQ&KUHLQH3HUOHJHEURFKHQ XQG OLQVHQI¤UPLJHV0LQLDWXUJHIÂ&#x201D;gPLW]ZHL6FKQXU¤VHQVRZLH]ZHL /¤FKHUQ LQ +DOVQÂ&#x201D;KH + FP k FP JUDXEUDXQHU 7RQ PLW EUÂ&#x201D;XQOLFKHP Â?EHU]XJ <RUWDQ  -W Y &KU LQWDNW  XQG JHRPHWULVFKHP5LW]GHNRU2 StĂźck!,QWDNW u 3URYHQLHQ]([6DPPOXQJ++%D\HUQYRU &ROOHFWLRQRI,VODPLFJODVVEHDGVRIGLIIHUHQWVKDSHVDQGVL]HV PRGHUQVWULQ ging, one bead broken, 11th century A.D.) and a lentoid miniature vessel with JHRPHWULFDOGHFRU <RUWDQUGPLOOHQLXP%&LQWDFW 2 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ.OHLQREMHNWH'DUXQWHUHLQ8QJXHQWDULXP +FP U¤PLVFK-KQ&KULQWDNWPLW%OHLSORPEH DXVJUŠQOLFKHP .ODUJODVHLQ~DFKHV7RQVFKÂ&#x201D;OFKHQ kFPDSXOLVFK-KY &KU2EHU~Â&#x201D;FKHEHULHEHQLQWDNW PLWVFKZDU]HPÂ?EHU]XJHLQ 0LQLDWXUJHIÂ&#x201D;gDXVVFKZDU]EUDXQJHVSUHQNHOWHP6WHLQ +FP LP Â&#x201D;J\SWLVFKHQ 6WLO 5DQG XQG )XgIUDJPHQWH IHKOHQ 6SUXQJ DXI GHP &RUSXV  HLQ 7HUUDNRWWD5HOLHIIUDJPHQW + FP U¤PLVFK PLW*RUJRXQGHLQ7HUUDNRWWD*HVLFKWVIUDJPHQWHLQHU )UDXHQVWDWXHWWH +FPU¤PLVFK-KQ&KU PLWHLQHP NOHLQHQ$XIKÂ&#x201D;QJHORFKLQGHU)ULVXU5 StĂźck! u

VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 6DPPOXQJ 2EMHNWH GLYHUVHU .XOWXUHQ 'DUXQWHU HLQ EDXFKLJHV *HIÂ&#x201D;g PLW NXU]HP +DOV + FP JHNOHEW ZLQ]LJHV )UDJPHQW IHKOW GHUU¤PLVFKHQ*HEUDXFKVNHUDPLNHLQHLQKHQNHOLJHU0L QLDWXUNUXJ GHU <RUWDQ:DUH + FP LQWDNW  PLW KRKHP $XV JXVVXQG5LHIHO'HNRUDXIGHP&RUSXVHLQEDXFKLJHV7¤SIFKHQ DXV URWHP 7RQ + FP 5DQGIUDJPHQWH IHKOHQ  PLW 6WUHLIHQ GHNRU HLQH U¤PLVFKH 7RQODPSH / FP Â?EHU]XJ DQ HLQLJHQ 6WHOOHQ DEJHSODW]W  HLQ *URWHVNHQNRSI DXV 7RQ + FP  ]ZHL KHOOHQLVWLVFKH)UDXHQN¤SIHDXV7RQ +XFP )UDJPHQW HLQHV 7RQUHOLHIV PLW 5HLWHU + FP  GLYHUVH Â&#x160;J\SWLDFD GDU XQWHUHLQ)D\HQFH3DWÂ&#x201D;NH +FP HLQHVSÂ&#x201D;WQHROLWKLVFKH3IHLO VSLW]HDXV6WHLQ /FPLQWDNW VRZLHPRGHUQH%URQ]H]LPEHOQ 15 StĂźck! u 3URYHQLHQ] ([ 1DFKODVV .DULQ .RUWH %D\HUQ GDYRU )DPLOLHQEHVLW] LQ Deutschland seit den 1920er Jahren. Collection of objects from different cultures comprising a Roman clay vessel, D RQH KDQGOHG PLQLDWXUH MXJ RI <RUWDQ &XOWXUH D EHOOLHG YHVVHO ZLWK VWULSH decoration, a Roman clay lamp, a grotesque clay head, two Hellenistic women heads, a clay fragment with rider, different Aegyptiaca among them a faience patäke, a neolithic arrowhead of stone and modern bronze cymbals. Partially intact. 15 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

3URYHQLHQ] $XV GHU 6OJ '. .RSHQKDJHQ YRUPDOV DXV HLQHU 1RUGHXURSÂ&#x201D;LVFKHQ6DPPOXQJHUZRUEHQLQGHQHUHU-DKUHQ Collection of different objects including a Roman candlestick glass unguen WDULXP VWFHQWXU\$' D~DWHDSXOLDQPLQLDWXUHERZORIFOD\DQGEODFN VOLS WK FHQWXU\ %&  D VWRQH PLQLDWXUH YHVVHO LQ 1RUWK $IULFDQ VW\OH  D fragment of a Roman terracotta relief with gorgo and a fragment of a Roman female terracotta statuette with high hairstyle. All intact. 5 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

379


 6DPPOXQJNOHLQHU*HIÂ&#x201D;gHXQWHUVFKLHGOLFKHU.XOWXUHQD E =ZHL YRUGHUDVLDWLVFKH*HIÂ&#x201D;gH-WY&KUD +FP7¤SIFKHQDXV EHLJHP 7RQ PLW ]ZHL Â?VHQKHQNHOQ E  + FP .OHLQHU %H FKHUDXVEHLJHP7RQPLWVFKZDU]HPÂ?EHU]XJOHLFKWELUQHQI¤U PLJPLWJHUDGHU0ŠQGXQJ%HLGHLQWDNWF +FP.XJHOLJHV *HIÂ&#x201D;g PLW HLQHP NXU]HQ +HQNHO DXI GHU 6FKXOWHU XQG 5LOOHQ GHNRU$XVURWHP7RQPLWKHOOEUDXQHPÂ?EHU]XJ5¤PLVFK -K Q &KU ,QWDNW Â?EHU]XJ JU¤gWHQWHLOV YHUORUHQ G  + FP .OHLQHVGRSSHONRQLVFKHV'UHLIXgJHIÂ&#x201D;gPLWSODVWLVFKHP'HNRU GLH]ZHLNOHLQHQÂ?VHQKHQNHOZHUGHQYRQSODVWLVFKDXVJHDUEHL WHWHQ.¤SIHQJHIRUPW$XVRUDQJHURWHP7RQPLWXUVSUŠQJOLFK URWEUDXQHP Â?EHU]XJ =HQWUDOHV +RFKODQG &RVWD 5LFD 3KDVH &DUWDJRQ&KU,QWDNWÂ?EHU]XJJU¤gWHQWHLOVYHUOR UHQ4 StĂźck! u Provenienz: Ehemals Sammlung E.C., Franken, erworben in den 1920er und HU-DKUHQEHL*RUQ\ 0RVFK$XNWLRQ/RV &ROOHFWLRQ RI VPDOO YHVVHOV IURP GLIIHUHQW FXOWXUHV LQFO D  DQG E  :HVWHUQ $VLDWLFSRWDQGEHDNHUUGPLOOHQLXP%&F 5RPDQVSKHULFDOJURRYHGYHV sel, 1st century A.D. d) Precolumbian tripod vessel with plastic decor, central KLJKODQG &RVWD 5LFD    $' $OO LQWDFW VOLS LV SDUWLDOO\ ORVW 4 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

 7HUUDNRWWD}JXUXQG)LEHOIUDJPHQW)UDXHQ}JXUDXV7HUUDFRWWD+ FPPLWŠEHUGHQ.RSIJH]RJHQHP6FKOHLHUZRKOLWDOLVFK -KY&KU'D]XHLQ%ŠJHOHLQHU)LEHOYRP1DYLFHOOD7\SXV PLW*UDYXU /FP 2 StĂźck!  u Provenienz: Ex Sammlung E.F., Duisburg, 1980er Jahre. 7HUUDFRWWDIHPDOH}JXULQHQGVWFHQWXU\%&ZRUQVXUIDFHSDUWRIWKH EDFNPLVVLQJDQGWKHQLFHO\GHFRUDWHGERZRIDQDYLFHOOD}EXODWKFHQWXU\ B.C. 2 pieces! VERKAUFT WIE BESEHEN, KEINE RĂ&#x153;CKGABE! / SOLD AS VIEWED, NO RETURN!

380

Folgende Losnummern in diesem Katalog beďŹ nden sich in der VorĂźbergehenden Verwendung (gekennzeichnet mit â&#x20AC;˘) The following lot numbers in this catalogue are subject to temporary admission (marked with â&#x20AC;˘): 91, 92, 193, 198, 216, 218, 219, 220, 223, 229, 240, 249, 254, 259, 260, 268, 269, 270, 287, 290, 291, 294, 295, 296, 297, 300, 357, 377, 433, 434, 436, 437, 440, 459, 460, 467, 488, 532, 612, 614, 672, 673, 686, 730, 774, 778, 907 Das auf den Zuschlag zu zahlende Aufgeld beträgt einheitlich 20%. Zusätzlich werden Einfuhrumsatzsteuer und Versandkosten nach folgenden MaĂ&#x;gaben erhoben: FĂźr Käufer aus EU Ländern gilt: Nach der endgĂźltigen Zollabwicklung, die erst nach dem erfolgten Zuschlag erledigt werden kann, wird die gesetzliche Einfuhrumsatzsteuer auf den Gesamtbetrag von Zuschlag und Aufgeld in einer separaten Rechnung berechnet. Die Nebenkosten (z.B. Versandkosten) zzgl. 19% Ust werden separat in Rechnung gestellt. FĂźr Käufer mit Wohnsitz auĂ&#x;erhalb der EU (Drittland) gilt: Wird die Ware vom Käufer selbst oder durch Dritte ins Drittland ausgefĂźhrt, wird die gesetzliche Einfuhrumsatzsteuer berechnet, später bei Vorlage des gesetzlich geforderten Ausfuhrnachweises erstattet. Wird die Ware von uns selbst in Drittländer ausgefĂźhrt, wird die gesetzliche Einfuhrumsatzsteuer nicht berechnet. The buyer´s premium on the hammer price is 20%. Additionally, importation VAT and shipping fees will be dealt with as follows: EU citizens: After ďŹ nalization of the custom procedure, which can only be concluded after the goods have been sold in auction, the relevant importation VAT on the entire amount of hammer price and buyerâ&#x20AC;&#x2122;s premium will be charged by a separate invoice. Additional costs (f.e. shipping costs) plus 19% VAT will be charged separately. Non EU citizens: As far as these buyers export the goods in person or by a third party the relevant VAT will be charged but refunded after receiving the legal proof of exportation. In case that we export the goods the relevant VAT will not be charged.


Versteigerungsbedingungen I. Beteiligte 1. Versteigerer Wir versteigern im eigenen Namen für Rechnung der Einlieferer als Kommissionär nach Handelsgesetzbuch. 2. Einlieferer Unsere Rechtsbeziehung zu diesen gestaltet sich nach dem mit diesen geschlossenen Verkaufskommissionsvertrag nebst Anlagen. Die Einlieferer bleiben unbenannt; es sei denn, Behörden, Gerichte oder Erwerber machen von ihrem Offenlegungsrecht nach dem Kulturgutschutzgesetz (KGSG) Gebrauch. 3. Erwerber Wir sind nach dem KGSG verpflichtet, die Identität der Erwerber festzuhalten. Wenn der Erwerber für Dritte bietet, muss er seine Vertreterstellung vor Beginn der Versteigerung offenlegen und uns die Daten des von ihm Vertretenen zur Verfügung stellen. II. Regeln der Versteigerung 1. Die Versteigerung regelt sich nach den nachfolgenden Bedingungen. 2. Mit der Teilnahme an der Versteigerung erkennt der Erwerber diese Versteigerungsbedingungen an. Von unseren Versteigerungsbedingungen abweichende Allgemeine Geschäftsbedingungen des Erwerbers erkennen wir nicht an und widersprechen diesen hiermit ausdrücklich. III. Vertragsschluss 1. Erwerber a. Erwerber ist sowohl der Verbraucher als auch der Unternehmer oder Kaufmann. Sofern aus Vereinfachungsgründen vom Erwerber in männlicher Form die Rede ist, ist hiermit auch die weibliche Erwerberin gemeint. a.1. Verbraucher Verbraucher ist jede natürliche Person, die ein Rechtsgeschäft zu einem Zwecke abschließt, der weder ihrer gewerblichen noch ihrer selbständigen beruflichen Tätigkeit zugerechnet werden kann (§ 13 BGB). a.2. Unternehmer Wenn der Erwerber in unseren Bedingungen als Unternehmer oder Kaufmann bezeichnet wird, gilt dies nur für den Fall, dass er bei Abschluss des Vertrages mit uns in Ausübung seiner gewerblichen oder selbständigen beruflichen Tätigkeit handelt (§ 14 BGB). a.3. Kaufmann Kaufmann ist, wer ein Handelsgewerbe betreibt, also einen Gewerbebetrieb, der nach Art und Umfang einen in kaufmännischer Weise eingerichteten Geschäftsbetrieb erfordert (§ 1 HGB) oder dessen Firma im Handelsregister eingetragen ist (§§ 2, 19 HGB). b. Als Erwerber können Sie Ihr Gebot im Versteigerungssaal, schriftlich, telefonisch oder im Internet abgeben. 2. Gebot a. Jedes Gebot des Erwerbers stellt ein verbindliches Angebot zum Abschluss eines Kaufvertrages dar und ist wirksam bis zur Abgabe eines höheren Gebotes (Übergebot). b. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Bezahlung. c. Bei Zweifeln, ob oder an wen ein Zuschlag erfolgt ist, ob ein Übergebot übersehen worden ist, sowie bei sonstigen unklaren Fällen wird die Versteigerungsnummer nochmals ausgerufen. Bei mehreren gleich hohen Angeboten mehrerer Bieter entscheiden wir nach freiem Ermessen. Bei ausschließlichen Internetgeboten erfolgt der Zuschlag virtuell. d. Der Zuschlagspreis bildet die Berechnungsgrundlage für das vom Erwerber zu zahlende Aufgeld. IV. Gebote 1. Die Mindest-Steigerungsstufen betragen gerundete 5 % des Ausrufes bzw. des letzten Gebotes, d. h.

bis

100,00 Euro 200,00 Euro 500,00 Euro 1.000,00 Euro 2.000,00 Euro 5.000,00 Euro 10.000,00 Euro 20.000,00 Euro 50.000,00 Euro 100.000,00 Euro 500.000,00 Euro

5,00 Euro 10,00 Euro 25,00 Euro 50,00 Euro 100,00 Euro 200,00 Euro 500,00 Euro 1.000,00 Euro 2.000,00 Euro 5.000,00 Euro 10.000,00 Euro

2. Schriftliche Aufträge führen wir ohne zusätzliche Auftragsprovision durch. Im Bedarfsfalle erklären Sie sich damit einverstanden, dass wir die Limits der eingesandten Gebote bis zu 5 % überziehen. Schriftliche Gebote müssen bis 24 Stunden vor Auktionsbeginn bei uns vorliegen. Bei schriftlichen Geboten erhält unter mehreren gleich hohen Geboten das zuerst eingegangene den Vorzug. 3. Telefonische Bieter können wir nur berücksichtigen, wenn sie sich spätestens zwei Werktage vor der Auktion bei uns angemeldet haben. 4. Für die Teilnahme an der Auktion über Internet benötigen Sie einen Zugang zu unserem Internetportal, in dem Sie sich als Neukunde rechtzeitig zu registrieren haben. Mit der Registrierung erkennen sie an, die „Versteigerungsbedingungen“, die „Datenschutzerklärung“ und die „Wichtigen Informationen“ zur Kenntnis genommen zu haben und damit einverstanden zu sein. Als Verbraucher bestätigen Sie mit der Registrierung zusätzlich, die Widerrufsbelehrung und das Widerrufsformular sowie das Impressum mit dem Hinweis auf die Online-Streitbeilegung eingesehen zu haben. 5. Gebote von uns unbekannten Bietern können wir nur ausführen, wenn rechtzeitig ein Depot hinterlegt und diese Hinterlegung bestätigt oder über nachprüfbare Referenzen eine Bonitätsprüfung erfolgreich durchgeführt und rückbestätigt wurde. 6. Aufträge, die unter 80 % des Schätzpreises liegen, werden nicht ausgeführt. 7. Saalbieter kaufen „wie besehen“. Schriftliche-, telefonischeoder Internet-Erwerber haben die Möglichkeit, sich über den Zustand des Versteigerungsstückes während der Besichtigungstage vor der Versteigerung persönlich oder durch einen Vertreter in unseren Geschäftsräumen zu informieren; deren Missverständnisse zu Katalogangaben gehen infolge dessen zu deren Lasten. Bei Telefon- und Internet-Bietern übernehmen wir keine Haftung für die Risiken, die in der Nutzung elektronischer Kommunikationsmittel für die Gebotsabgabe des Erwerbers begründet sind, etwa für das Zustandekommen des Leitungsaufbaus, Leitungszusammenbrüche, Übermittlungsfehler, Ausfall- und Verzögerungszeiten und andere mit diesen Kommunikationswegen verbundene, typische, derartige Risiken mehr, die nicht in unserem Einflussbereich liegen; allerdings nur für den Fall, dass uns hieran der Vorwurf grober Fahrlässigkeit oder des Vorsatzes nicht trifft. V. Preis und Nebenkosten 1. a. Der Erwerber hat den Zuschlagspreis zu zahlen. b. Das Versteigerungsgut wird differenzbesteuert verkauft, es sei denn, einzelne Versteigerungsgüter unterliegen der Vollversteuerung oder befinden sich in der vorübergehenden Verwendung; diese sind sodann auf einer Liste im gedruckten Katalog speziell gekennzeichnet. Bei differenzbesteuerter Ware wird keine Umsatzsteuer ausgewiesen. 2. a. Wir berechnen dem Erwerber zusätzlich bei Auslandsschecks und -überweisungen bis 24.999 € Geldtransferkosten in Höhe von 15,00 € und ab 25.000 € Geldtransferkosten in Höhe von 50,00 €.

381


Wir bieten für Verbraucher, Unternehmer und Kaufmänner als kostenlose Zahlungsart Mitnahme gegen Barzahlung und im Inland Banküberweisung auch ohne Vorkasse gegen rückbestätigte Referenzen an. b. Eigene Kosten seines eigenen Zahlungs-Providers (Bank, Kreditkartenunternehmen u.s.w.) hat der Erwerber gegebenenfalls selbst zu tragen. 3. a. Wenn wir auf Wunsch des Erwerbers versenden, hat der Erwerber auch die Nebenkosten des Versandes zu tragen. Es handelt sich hierbei um Versandkosten, Verpackungskosten, gegebenenfalls Versicherungskosten, gegebenenfalls Export -Lizenzkosten. Diese sind erst nach Zuschlag bezifferbar, da sie individuell vom jeweiligen Versteigerungsgut abhängen. b. Handelt es sich bei dem Erwerber um einen Verbraucher und hat er an der Versteigerung per Brief, Telefon oder Internet teilgenommen, erhält er mit der vorläufigen Rechnung über den Zuschlagspreis auch die Nebenkosten des Versandes mitgeteilt. Diese sind wegen der unterschiedlichen Versteigerungsgüter, der jeweils angemessenen Verpackungs-/ Versandart und des Zielortes nur im Einzelfall und nicht generell im Vorfeld bestimmbar. Der Erwerber als Verbraucher hat die Möglichkeit, bei Nichtakzeptanz der Nebenkosten des Versandes, von dem Versteigerungsvertrag binnen zehn Tagen nach Zugang der vorläufigen Rechnung, mit Eingang bei uns, schriftlich zurückzutreten, ohne dass Kosten für ihn anfallen. Sein Widerrufsrecht wird davon nicht berührt. 4. Bei der Ausfuhr des Versteigerungsgutes aus der Bundesrepublik Deutschland entstehen dem Erwerber gegebenenfalls weitere Kosten für Steuern und Zölle sowie behördliche Aus-/Einfuhrgenehmigungen. Diese sind ebenfalls vom Erwerber zu tragen und im Preis nicht enthalten. 5. Der Erwerber kann seine Zahlung bar gegen Mitnahme erbringen oder durch Überweisung auf eines unserer nachstehenden Konten: Postbank BIC (SWIFT) : PBNKDEFF / IBAN : DE 28700100800150384802 Commerzbank München: BIC (SWIFT) : COBADEFFXXX / IBAN : DE 73700400410666711700 HypoVereinsbank München: BIC (SWIFT) : HYVEDEMMXXX / IBAN : DE 36700202700002860120 6. Die Zahlung hat in der Währung € zu erfolgen. Auslandserwerber sind für die Einhaltung der geltenden Devisen- und Einfuhrbestimmungen allein verantwortlich. VI. Aufgeld und Umsatzsteuern 1. Der Erwerber hat zu dem Zuschlagspreis ein aus diesem berechnetes Aufgeld zu zahlen. 2. Das Aufgeld beträgt bei Erwerbern aus EU-Mitgliedstaaten: a. bei differenzbesteuerter Ware aa. bei Münzauktionen: 23 % ab. bei Auktionen Kunst der Antike: 25 % b. bei vollbesteuerter Ware b.a. bei Münzauktionen: 17,5 % b.b .bei Auktionen Kunst der Antike: 20 % jeweils zuzüglich der jeweils geltenden gesetzlichen Umsatzsteuer auf die Summe aus Zuschlag, Aufgeld und Nebenkosten (Geldtransferkosten und Nebenkosten des Versandes). c. bei Ware in der vorübergehenden Verwendung c.a. bei Münzauktionen: 17,5% c.b. bei Auktionen Kunst der Antike: 20 % jeweils zuzüglich Einfuhrumsatzsteuer auf den Gesamtbetrag von Zuschlag und Aufgeld auf einer separaten Rechnung. Die Nebenkosten (Geldtransferkosten und Nebenkosten des Versandes) zuzüglich jeweils geltender gesetzlicher Umsatzsteuer werden separat in Rechnung gestellt. 3. Erwerber mit Wohnsitz außerhalb der EU: Das Aufgeld beträgt a.a. bei Münzauktionen: 17,5 % b.b. bei Auktionen Kunst der Antike: 20 % Die jeweilige Umsatzsteuer ist geregelt in Ziffer VII. 1. 4. Bei umsatzsteuerbefreiten Goldmünzen gilt generell ein Aufgeld von 15 %.

382

VII. Umsatzsteuerliche Sonderbehandlungen 1. Bei Erwerbern mit Wohnsitz in Drittländern, außerhalb der EU-Mitgliedsstaaten, wird auf den Zuschlagspreis, die Nebenkosten und das Aufgeld die gesetzliche Umsatzsteuer berechnet, jedoch bei Vorlage der gesetzlich geforderten Ausfuhrnachweise in der gesetzlich zulässigen Höhe erstattet. Sofern wir diese Ware für die Erwerber in diese Drittländer ausführen, wird die Rechnung umsatzsteuerfrei gestellt. Im Drittland anfallende Importsteuern oder Zölle trägt in jedem Fall der Erwerber. 2. Gewerbliche Erwerber mit Eintragung in einem EU-Mitgliedsstaat, mit gültiger UmsatzsteuerIdentifikationsnummer, können sich die Umsatzsteuer erstatten lassen; wir benötigen hierfür die gesetzlich erforderlichen Dokumente. Letztere bestehen aus der Umsatzsteuer-Identifikationsnummer und der Gelangensbestätigung des EU-Mitgliedsstaates, in dem die Umsatzsteueridentifikationsnummer erteilt wurde. Auch hier berechnen wir für den Fall, dass wir die Ware ausführen, und eine gültige Umsatzsteuer-Identifikationsnummer vor dem Erwerb vorgelegt wurde und wir die Gelangensbestätigung erhalten, keine Umsatzsteuer. VIII. Zahlung durch den Erwerber 1. Bei in der Versteigerung persönlich anwesenden Erwerbern (Saalauktion) ist der Kaufpreis zuzüglich des Aufgeldes und eventuell anfallender Nebenkosten sofort fällig. 2. Bei schriftlichen Erwerbern, telefonischen Erwerbern oder Internet Erwerbern versenden wir eine Vertragsbestätigung/ Vorläufige Rechnung, bei Verbrauchern nebst Versteigerungsbedingungen und Widerrufsbelehrung nebst Widerrufsformular, sowie eine Rechnung. Diese Rechnung ist fällig zehn Tage nach Erhalt. IX. Lieferung 1. Die Lieferung an Saalerwerber setzt sofortige Zahlung voraus und erfolgt an schriftliche, telefonische oder Internetkunden in der Regel gegen Vorkasse. Es sei denn, es wurde ein ausreichendes, angefordertes, Deposit hinterlegt oder die Bonität durch Referenz rückbestätigt. 2. Bei Münzauktionen mit Inlandslieferung: a. Verbraucher Wir liefern bei Verbrauchern das Versteigerungsgut – in der Regel – gegen Vorkasse; mit den kostenlosen Zahlungsmöglichkeiten nach Ziffer V,2.a.,Satz2 dieser Versteigerungsbedingungen. Nach Mitteilung des Zahlungsauftrages durch Sie an Ihre Bank werden wir die Versteigerungsobjekte spätestens innerhalb von 14 Arbeitstagen (ohne Samstage, Sonn- und Feiertage) an Sie übersenden. Im Falle der Kreditkartenzahlung oder PayPalZahlung erfolgt die Lieferung der Versteigerungsobjekte spätestens innerhalb von 14 Arbeitstagen (ohne Samstage, Sonn- und Feiertage) an Sie nach Auslösung des Zahlungsvorganges. b. Unternehmer und Kaufmann Wir liefern bei Unternehmern und Kaufmännern die Versteigerungsobjekte – in der Regel – gegen Vorkasse. Die Lieferung der Versteigerungsobjekte erfolgt spätestens innerhalb von 14 Arbeitstagen nach Zahlungseingang. 3. Bei Münzauktionen mit Auslandslieferung und bei Auktionen Kunst der Antike: Die Lieferfrist bestimmt sich nach der nach dem individuellen Versteigerungsgut erforderlichen speziell angefertigten Verpackung, der speziell erforderlichen Versandart und der behördlichen Dauer zur Erstellung etwaig erforderlicher Exportlizenzen/ Genehmigungen. Wir leiten die erforderlichen Maßnahmen unverzüglich in die Wege und führen die Lieferung unverzüglich nach Erstellung der Verpackung, Annahmebestätigung des Speditionsvertrages und Vorlage der behördlichen Urkunden durch. 4. Teillieferungen sind zulässig, soweit es für den Erwerber zumutbar ist. 5. Das Wiedereintreffen der Versteigerungsobjekte bei uns aufgrund Unzustellbarkeit oder verweigerter Annahme werten wir bei Unternehmern und Kaufmännern als Rücktritt und bei Verbrauchern als Widerruf.


6. Bei Rücksendungen muss aus versicherungstechnischen Gründen der Versand vorab mit uns abgestimmt werden. X. Eigentumsvorbehalt Wir behalten uns, soweit wir Kommissionär sind für den Einlieferer, bis zur vollständigen Zahlung des Kaufpreises nebst Nebenkosten, Aufgeld und Steuern durch den Erwerber, das Eigentum an den Versteigerungsobjekten vor. Solange der Kaufpreis noch nicht vollständig bezahlt ist, ist der Erwerber, aufgrund dieses Eigentumsvorbehaltes, ohne dass dadurch, soweit er Verbraucher ist, seine Rechte auf Prüfung der Objekte nach dem Widerrufsrecht eingeschränkt werden, verpflichtet, insbesondere Münzen, nicht zu reinigen und diese sowie wie andere Objekte nicht mit chemischen Mitteln oder anderen Gegenständen zu behandeln, nicht zu restaurieren, Slabs nicht aufzubrechen und den Zugriff Dritter auf die Objekte, etwa im Falle einer Pfändung oder einem Besitzwechsel der Objekte, sowie den eigenen Wohnsitzwechsel, uns unverzüglich anzuzeigen. Der Erwerber tritt uns bereits jetzt alle Forderungen in Höhe des Rechnungsbetrages ab, die ihm durch die Weiterveräußerung gegen einen Dritten erwachsen. Wir nehmen, soweit wir Kommissionär sind für den Einlieferer, die Abtretung bereits jetzt an. Nach der Abtretung behalten wir uns vor, gegebenenfalls für den Einlieferer, die Forderung selbst, gegebenenfalls als Kommissionär, einzuziehen, sofern und soweit der Erwerber in Zahlungsverzug ist. XI. Gefahrübergang 1. Verbraucher Ist der Erwerber privathandelnder Verbraucher, geht die Gefahr des zufälligen Untergangs und der zufälligen Verschlechterung des Versteigerungsobjektes erst mit Übergabe des Versteigerungsobjektes an den Erwerber auf den Erwerber über. 2. Unternehmer und Kaufmann Ist der Erwerber Unternehmer oder Kaufmann, geht mit der Auslieferung des Versteigerungsobjektes an das mit der Übersendung beauftragte Transportunternehmen, die Gefahr des zufälligen Untergangs oder zufälligen Verschlechterung des Versteigerungsobjektes auf den Erwerber über. 3. Annahmeverzug Im Falle des Annahmeverzuges des Erwerbers geht die Gefahr mit dem Annahmeverzug auf den Erwerber über. 4. Sofern wir haften und der Schaden durch eine vom Erwerber oder für den Erwerber abgeschlossene Versicherung gedeckt ist, hat der Erwerber diese außergerichtlich bevorzugt in Anspruch zu nehmen. Soweit erforderlich, treten wir bereits an dieser Stelle entsprechende Schadensersatzforderungen gegen Dritte an den Erwerber ab. Soweit der Erwerber hierbei Zahlungen erlangt, bleibt unsere Haftung nur für etwaig damit verbundene Nachteile, wie Prämienrückstufungen oder Zinsverluste, bestehen; andernfalls bleibt eine bestehende Haftung von uns unberührt. XII. Mängelhaftung 1. Der Erwerber hat die Möglichkeit, sich vom Erhaltungszustand des Versteigerungsgutes, dessen Qualität und dessen Eigenschaften durch Vorbesichtigung persönlich zu überzeugen. 2. Beschreibungen und Erhaltungsangaben im Katalog und auf unseren Internetseiten zur Versteigerung sind persönliche Einschätzungen unserer qualifizierten Mitarbeiter, die mit Sorgfalt und nach bestem Wissen und Gewissen nach branchenüblichen Maßstäben durchgeführt und formuliert werden. Sie dienen allerdings nur der Erläuterung und Einordnung, ebenso wie die beigefügten Abbildungen. Dies stellt keine Beschaffenheitsvereinbarung im Sinne des § 434 BGB und auch nicht die Übernahme einer Garantie im Rechtssinne dar. 3. Die Echtheit der Stücke wird gewährleistet, allerdings ohne Übernahme einer Garantie. Bei einer, ohne grob fahrlässige oder vorsätzliche Pflichtverletzung durch uns, nachträglich erkannten, Fälschung beschränken wir unsere Gewährleistung der Höhe nach auf den Zuschlagspreis einschließlich der Nebenkosten (Nebenkosten des Versandes, Geldtransferkosten)

sowie das Aufgeld und gegebenenfalls Steuer. 4. Wir übernehmen keine Verantwortung dafür, dass die durch uns versteigerte Ware von den sogenannten GradingUnternehmen angenommen oder die Erhaltungsqualität in einer ähnlichen Form eingeschätzt wird, wie durch uns. Reklamationen, die daraus resultieren, dass ein GradingUnternehmen zu einer abweichenden Qualitätsbewertung gekommen ist, berechtigen nicht zu einer Rückabwicklung des Kaufes. Bei Stücken, die von uns in den sogenannten „Slabs“, (Münzen sind eingeschweißt in Plastikholder, ausgegeben von den Grading-Unternehmen) verkauft werden, entfällt die oben genannte Gewährleistung der Echtheit. Auch für versteckte Mängel, z.B. Randfehler, Henkelspuren, Schleifspuren, etc., die durch den Plastikholder verdeckt werden, übernehmen wir keine Mängelhaftung. 5. Wir übernehmen als Kommissionäre die uns obliegenden Verpflichtungen nach dem Kulturgutschutzgesetz (KGSG). Wir sind hier verpflichtet, bei archäologischen Kulturgütern älter als 100 Jahre und mit einem Wert ab null Euro und bei sonstigen Kulturgütern, also Münzen, ab einem Wert von 2.500,00 Euro unseren besonderen Sorgfaltspflichten nachzukommen. Dazu sind wir allerdings nur verpflichtet im Rahmen des Zumutbaren, insbesondere einer wirtschaftlichen Zumutbarkeit. Wir erfüllen dies durch Prüfung des Versteigerungsgutes durch unsere in der Regel akademisch archäologisch qualifizierten Mitarbeiter. Die Angaben der Einlieferer zu Provenienz, Herkunft, Rechtmäßigkeit und Echtheit der Urkunden lassen wir uns von diesen bestätigen und prüfen dies gegen in den öffentlichen Verzeichnissen und Datenbanken (InterpolDatei of stolen works of art und ICOM Red Lists, Art-LossRegister, Internetportal des BKM nach § 4 KGSG). Darüber hinausgehende Garantien, Gewährleistungen, Zusicherungen oder Verantwortlichkeiten können wir nicht übernehmen, insbesondere auch nicht bei Rückgabeersuchen fremder Staaten oder behördlichen oder gerichtlichen Maßnahmen. Nach dem Hintergrundpapier Münzsammler, der Beauftragten der Bundesregierung für Kultur und Medien (BKM) vom Juli 2016, wird bei Münzen und anderen Kulturgütern eine lückenlose Provenienz durch das neue Kulturgutschutzgesetz nicht gefordert. Es gelten insbesondere Münzen, wenn es sie in großer Stückzahl gibt, diese für die Archäologie keinen relevanten Erkenntniswert haben und nicht von einem EUMitgliedstaat als individualisierbare Einzelobjekte unter Schutz gestellt sind, als keine archäologischen Gegenstände. Dabei können, nach einer Entscheidung des Bundesfinanzhofes, nur Münzen, die keine Massenware sind, von archäologischem Interesse sein. Münzen fallen deshalb als archäologisches Massenprodukt im Regelfall nicht unter die Regelungen des Kulturgutschutzgesetzes (Bayerisches Kunstministerium, Ministerialrat von Urff, BSZ, 15.07.2016). Wir gehen bei der Erfüllung unserer (Sorgfalts-) Verpflichtungen nach dem Kulturgutschutzgesetz von diesen eigenen Einschätzungen des Gesetzgebers und der zuständigen Obersten Bayerischen Landesbehörde aus. 6. Bei Lots und Serien kauft der Erwerber eine nicht näher beschriebene Gesamteinheit einfachen Zuschnitts. Es handelt sich hier bei den Angaben nur um Etwa-Angaben, wobei irrtümliche Zuschreibungen im Rahmen des Möglichen liegen. Versteigerungsstücke in Form von Lots sind nach erfolgtem Zuschlag daher von der Gewährleistung in branchenüblicher Weise ausgeschlossen, es sei denn, wir hätten bei der Beschreibung, der Zuordnung oder der Versteigerung arglistig gehandelt. 7. Als Kaufmann hat der Erwerber uns etwaige Mängel unverzüglich anzuzeigen. Ansonsten verliert er seine Gewährleistungsrechte. 8. Bei einem Sachmangel hat der Erwerber uns zunächst angemessene Gelegenheit zur Reparatur oder Ersatzlieferung, nach unserer Wahl, zu geben. Soweit uns dies nicht gelingt, stehen dem Erwerber die weitergehenden Rechte nach dem Gesetz zu. 9. Die Ansprüche der Erwerber wegen Sachmängeln an unseren gebrauchten Versteigerungsgütern verjähren in einem Jahr ab Erhalt des Versteigerungsgutes. Die besondere Klassifikation unserer Versteigerungsgüter in Form von alten numismatischen und antiken Gütern erfordert aber

383


im Interesse des Erwerbers eine unverzügliche Klärung von Abweichungsrügen zur Sicherung des Übergabezustandes binnen sieben Tagen. XIII. Haftung auf Schadensersatz neben der Gewährleistung 1. Maßstab Wir haften für die Verletzung von Vertragspflichten und aus Delikt nur bei Vorsatz oder grober Fahrlässigkeit. Diese Einschränkung gilt nicht bei der Verletzung von Leben, Körper und Gesundheit oder bei der Verletzung von Hauptpflichten. Hier haften wir für jedes Verschulden. 2. Betroffene Soweit diese Haftungseinschränkung reicht, gilt sie auch für unsere Erfüllungsgehilfen und die persönliche Haftung unserer Angestellten. 3. Weitere Beschränkungen gegenüber Unternehmern und Kaufmännern Sofern der Erwerber beim Zuschlag als Unternehmer und/ oder als Kaufmann für sein Unternehmen gehandelt hat, beschränken wir unsere Haftung darüber hinaus auf den vorhersehbaren und typischerweise eintretenden Schaden. Diese weitergehende Haftungsbeschränkung gilt wiederum dann nicht, wenn wir arglistig gehandelt haben sowie für Ansprüche nach dem Produkthaftungsgesetz und für Schäden aus der Verletzung von Leben, Körper und Gesundheit. XIV. Widerrufsrecht für Verbraucher Verbrauchern steht ein Widerrufsrecht nach der folgenden Maßgabe zu. Verbraucher ist jede natürliche Person, die ein Rechtsgeschäft zu einem Zweck abschließt, der weder ihrer gewerblichen noch ihrer selbstständigen beruflichen Tätigkeit zugerechnet werden kann (§ 13 BGB). Beginn der Widerrufsbelehrung: Widerrufsrecht Als Verbraucher haben Sie das Recht, binnen vierzehn Tagen ohne Angabe von Gründen diesen Vertrag zu widerrufen. Die Widerrufsfrist beträgt vierzehn Tage ab dem Tag, an dem Sie oder ein von Ihnen benannter Dritter, der nicht Beförderer ist, die Ware (oder die letzte Ware, letzte Teilsendung oder das letzte Stück im Fall eines Vertrages über mehrere Waren mit einer einheitlichen Bestellung oder die Lieferung einer Ware in mehreren Teilsendungen oder –stücken) in Besitz genommen haben bzw. hat. Um Ihr Widerrufsrecht auszuüben, müssen Sie uns Gorny & Mosch Giessener Münzhandlung GmbH Maximiliansplatz 20, D-80333 München Telefon: +49 89 2422643-0, Telefax: +49 89 2285513 E-Mail: info@gmcoinart.de mittels einer eindeutigen Erklärung (zum Beispiel ein mit der Post versandter Brief, Telefax oder E-Mail) über Ihren Entschluss, diesen Vertrag zu widerrufen, informieren. Sie können dafür das beigefügte Widerrufsformular verwenden, das jedoch nicht vorgeschrieben ist. Zur Wahrung der Widerrufsfrist reicht es aus, dass Sie die Mitteilung über die Ausübung des Widerrufsrechts vor Ablauf der Widerrufsfrist absetzen. Folgen des Widerrufs Wenn Sie diesen Vertrag widerrufen, haben wir Ihnen alle Zahlungen, die wir von Ihnen erhalten haben, einschließlich der Lieferkosten (mit Ausnahme der zusätzlichen Kosten, die sich daraus ergeben, da Sie eine andere Art der Lieferung als die von uns angebotene günstige Standard-Lieferung gewählt haben), unverzüglich und spätestens binnen vierzehn Tagen ab dem Tag zurückzuzahlen, an dem die Mitteilung über Ihren Widerruf dieses Vertrages bei uns eingegangen ist. Für diese Rückzahlung verwenden wird dasselbe Zahlungsmittel, das Sie bei der ursprünglichen Transaktion eingesetzt haben, es sei denn, mit Ihnen wurde ausdrücklich etwas anderes vereinbart; in keinem Fall werden Ihnen wegen dieser Rückzahlung Entgelte berechnet. Wir können die Rückzahlung verweigern, bis wir die Waren wieder zurückerhalten haben oder bis Sie den Nachweis erbracht haben, dass Sie die Waren zurückgesandt haben, je

384

nachdem, welches der frühere Zeitpunkt ist. Sie haben die Waren unverzüglich und in jedem Fall spätestens binnen vierzehn Tagen ab dem Tag, an dem Sie uns über den Widerruf dieses Vertrages unterrichten, an uns zurückzusenden oder zu übergeben. Die Frist ist gewahrt, wenn Sie die Waren vor Ablauf der Frist von vierzehn Tagen absenden. Sie tragen die Kosten der unmittelbaren Rücksendung der Waren. Sie müssen für einen etwaigen Wertverlust der Waren nur aufkommen, wenn dieser Wertverlust auf einen zur Prüfung der Beschaffenheit, Eigenschaften und Funktionsweise der Waren nicht notwendigen Umgang mit Ihnen zurückzuführen ist. Ende der Widerrufsbelehrung. Das Widerrufsformular halten wir auf unserer Web-Site für die Erwerber als Verbraucher bereit. XV. Verweigerung von Zahlung und Abnahme 1. Bei nicht fristgerechter Zahlung der Rechnung verliert der Erwerber bei Belehrung hierüber in der Rechnung seine Rechte aus dem Zuschlag und das Versteigerungsgut kann auf seine Kosten erneut versteigert oder, nach unserem freien Ermessen, freihändig verkauft werden. In diesem Fall haftet der Erwerber für den Mindererlös. 2. Als Erwerber haben Sie zusätzlich einen pauschalierten Schadenersatz in Höhe von 15 % des ersten Zuschlagspreises zu bezahlen. Ihnen bleibt jedoch das Recht vorbehalten, den Eintritt eines geringeren oder das Fehlen eines Schadens nachzuweisen. In diesem Fall schulden Sie geringeren oder keinen Schadenersatz. Uns bleibt die Geltendmachung eines höheren Schadens ausdrücklich vorbehalten. 3. Bei Verzug des Erwerbers mit der Zahlung der Rechnung schuldet dieser auch Zinsen. XVI. Aufrechnung Eine Aufrechnung gegen unsere Forderungen ist ausgeschlossen, es sei denn, die Forderung ist unbestritten oder rechtskräftig festgestellt. XVII. Schlussbestimmungen 1. Salvatorische Klausel Sollte eine Bestimmung der Versteigerungsbedingungen ganz oder teilweise unwirksam sein oder ihre Rechtswirksamkeit später verlieren, so soll hierdurch die Gültigkeit der übrigen Bestimmungen nicht berührt werden. Anstelle der unwirksamen Bestimmung gilt die gesetzliche Vorschrift. 2. Gerichtsstand bei Kaufmann als Erwerber Ist der Erwerber Kaufmann, juristische Person des öffentlichen Rechts oder öffentlich-rechtlichen Sondervermögens, ist ausschließlicher Gerichtsstand für alle Streitigkeiten aus diesem Vertrag der Geschäftssitz der Gorny & Mosch Giessener Münzhandlung GmbH, also München. Dasselbe gilt, wenn der Erwerber keinen allgemeinen Gerichtsstand in der Bundesrepublik Deutschland hat oder Wohnsitz oder gewöhnlicher Aufenthalt im Zeitpunkt der Klageerhebung nicht bekannt ist. 3. Grenzüberschreitende Versteigerung Wenn wir grenzüberschreitend versteigern, bedeutet das keine entsprechende Geschäftsausrichtung. Es gelten deutsches Recht und deutsche Gerichtsbarkeit. Die Geltung der CISG wird ausgeschlossen. Ist der Erwerber Verbraucher, gelten für ihn auch die verbraucherschützenden Vorschriften seines Wohnsitzstaates; er hat bei Rechtsstreitigkeiten darüber hinaus die Wahl des Gerichtsstandes unseres Firmensitzes oder seines Wohnsitzes. Wir müssen ihn stets an seinem Wohnsitz verklagen. Wenn Sie unsere Kataloge künftig nicht mehr erhalten möchten, können Sie der Verwendung Ihrer Daten für den Versand jederzeit widersprechen.

Gorny & Mosch Giessener Münzhandlung GmbH Auktionatoren: Dieter Gorny, Dr. Hans-Christoph von Mosch Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch Handelsregister München HRB Nr. 75528 Sitz der Gesellschaft: München


Gorny & Mosch‘s representative in Russia

Terminvorschau

Mr. Andrey Pyatygin Arbat 38/1, Bld. 2 119002 Moscow, Russia

Auktion 265

14. Oktober 2019 Münzen der Antike Einlieferungsschluss 2. August 2019

Auktion 266

15./16. Oktober 2019 Mittelalter, Neuzeit und Russland Einlieferungsschluss 2. August 2019

E-Auktion 267

17./18. Oktober 2019 Münzen aus Antike und Neuzeit Einlieferungsschluss 2. August 2019

Auktion 268

Dezember 2019 Kunst der Antike Einlieferungsschluss September 2019

7.-8. März 2020, Numismata München

Auktion 269-270

9.-11. März 2020 Münzen Antike und Neuzeit

E-Auktion 271

12./13. März 2020 Münzen Antike und Neuzeit

Office Phone: 007 915 014 3539 Email: gornyandmosch@mail.ru

Representative in Russia Mr. Andrey Pyatygin BC „Berta Khaus“ Staropimenovskiy per. 18 125009 Moscow, Russia Office Phone: 007 916 723 9527 Email: gornyandmosch@mail.ru

Die Echtheit der Stücke wird gewährleistet. All objects are guaranteed genuine. Impressum

Die Echtheit der Stücke wird gewährleistet. All objects are guaranteed genuine. Gorny & Mosch ist Partner von Art Loss Register. Sämtliche Gegenstände in diesem sofern sie Gorny & Mosch ist Partner von Art Katalog, Loss Register. eindeutig identifizierbar sind und einen Schätzwert Sämtliche Gegenstände in diesem Katalog, sofern von mind. 1.000,– identifizierbar € haben, wurden vor der Versteigerung sie eindeutig sind, wurden vor der mit dem Datenbankbestand des Registers individuell Versteigerung mit dem Datenbankbestand des abgeglichen. Registers individuell abgeglichen. Gorny Gorny & & Mosch Mosch have have retained retained the the Art Art Loss Loss Register Register to to check all uniquely identifiable items offered for sale check all uniquely identifiable items offered for sale in Art LossatRegister‘s in this this catalogue catalogue against that arethe estimated more than the computerized database of objects stolen equivalent of 1,000.– € against thereported Art Loss as Register‘s or lost. computerized database of objects reported as stolen or lost.

Herausgeber GORNY & MOSCH Giessener Münzhandlung GmbH München Bearbeitung Dr. Georg Morawietz Dr. Martin Schulz Irene Rulka, M. A. Dr. Margret Nollé Gestaltung GORNY & MOSCH Digitale Fotografie Michael Girschick, Starnberg Layout, Satz & Montage Hartmut Baier Grafikdesign Druck Meister Print & Media GmbH, Kassel Alle Rechte vorbehalten, insbesondere die der Übersetzung und der fotomechanischen Wiedergabe. Nachdruck, auch auszugsweise, nur mit schriftlicher Genehmigung des Herausgebers. Printed in Germany

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20, D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de www.gmcoinart.de Amtsgericht München HRB Nr. 75528 Geschäftsführer: Dieter Gorny, Dr. Hans-Christoph von Mosch


Gorny & Mosch • Giessener Münzhandlung Kunst der Antike Juni 2019

264

GORNY & MOSCH Giessener Münzhandlung GmbH Maximiliansplatz 20, D-80333 München Tel. +49 (0)89 24226430 · Fax +49 (0)89 2285513 E-Mail: info@gmcoinart.de www.gmcoinart.de

Auktion Kunst der Antike 27. Juni 2019

264

Profile for Gorny & Mosch Giessener Münzhandlung GmbH

Gorny & Mosch Auktionskatalog 264 "Kunst der Antike"  

Katalog zur Auktion 264 "Kunst der Antike" am 27. Juni 2019 bei Gorny & Mosch in München am Maximiliansplatz 20

Gorny & Mosch Auktionskatalog 264 "Kunst der Antike"  

Katalog zur Auktion 264 "Kunst der Antike" am 27. Juni 2019 bei Gorny & Mosch in München am Maximiliansplatz 20