The Ultimate Lifestyle By The Sea HOMES • INTERIORS • GARDENS • TRAVEL • FOOD • HEALTH & BEAUTY COMPETITIONS Win! Inside A three-night break in Port Isaac Worth £450 Issue 126 | October 2022 | £3.95 9271 ON SEASONALLUXURYDISPLAYSTAYSCOLOUR Exploring all that Cornwall has to offer as we fall into autumn THE SEASONA taste of Featured
CORNWALLSOUTH|POLPERRO EEPC|£950,000PRICEGUIDE 30636001872 info@rohrsandrowe.co.uk rohrsandrowe.co.uk
Welcome team effort. Saving lives is a Hannah
This issue, we are once again looking forward to the Cornwall Home Improvement & Self Build Show in our special supplement from page 55 Taking place from 1st-2nd October at the Royal Cornwall Showground, the event is set to be the biggest yet with exhibitors and experts on-hand for all your interior and property needs. A Bite of Cornwall, the event’s food and drink market, will again provide a place to rest awhile and sample some of the Duchy’s finest food and drink while you plan your next stand visit.
Operations Team Miguel Belert – Joanne Stinton – Holly Hunt Client JonathanDirectorPerkins – 07587 jonathan.perkins@enginehousemedia.co.uk072706 CEO & Founder Ben Pratchett – 01326 ben.pratchett@enginehousemedia.co.uk574842 Chairman & Founder Andy Forster – 07711 andy.forster@enginehousemedia.co.uk160590 FOR GUESTS, OWNERS & CORNWALL FOREVERCORNWALL.CO.UK
When it comes to a few of my favourite things, I think I’ve quite possibly hit the jackpot this issue. The Isles of Scilly is my dream Cornish destination. It’s Caribbean-esque turquoise waters and white sand beaches transport you a world away, yet they are just 28 miles from Cornwall’s mainland. There is a pace of life in Scilly like no other; shoulders drop and cares disperse as soon as you step off the Scillonian or the Airbus. When I visited as a child, holidays were full of simple pleasures and today these are only made better by the plethora of food and drink producers on Scilly. Ahead of the Taste of Scilly festival held in September, I’ve been finding out more about the island’s victuals (from page 25).
From the Editor to the October edition of Cornwall Living!
The Ultimate Lifestyle By The Sea
Food is something of a theme this issue as we welcome guest editor Jude Kerama (page 78) talking of his recent collaboration with Toll House Pottery who have created a unique, bespoke range of tableware for his award-winning restaurant Kota in Porthleven. This heralds the return of our Foodie section where appetites are sated and whistles whetted from page 80 …happy reading!
Member of: Engine House Media Ltd is a multi-platform media business with a passion for everything Cornish. Visit www.enginehousemedia.co.uk to find out more. Our mission is to create READ-WATCH-EXPERIENCE media opportunities marrying together consumers with the fabulous businesses across Cornwall. Our publishing and marketing teams are specialists in creating print and on-line communications, devised to achieve a range of marketing objectives. With over 20 years of marketing, brand management and magazine experience we develop effective communications that deliver your message in a credible and creative way. We operate across all media channels, including: print, online and video. ISSN 2049-8462 © All rights reserved. Material may not be re-produced without the permission of Engine House Media Ltd. While Cornwall Living will take every care to help readers with reports on properties and features, neither Engine House Media Ltd nor its contributors can accept any liability for reader dissatisfaction arising from editorial features, editorial or advertising featured in these pages. Engine House Media Ltd strongly advise viewing any property prior to purchasing or considerations over any financial decisions. Engine House Media reserves the right to accept or reject any article or material supplied for publication or to edit such material prior to publication. Engine House Media Ltd cannot take responsibility for loss or damage of supplied materials. The opinions expressed or advice given in the publication are the views of the individual authors and do not necessarily represent the views or policies of Engine House Media Ltd. It is suggested that further advice is taken over any actions resulting from reading any part of this magazine.
PROUD TO BE PART OF Cornwall Living is published by: ENGINE HOUSE MEDIA LTD Holbrook, The Moors, Porthleven, Cornwall TR13 9JX www.levenmediagroup.co.ukwww.enginehousemedia.co.uk Working in partnership with: The official tourist board For all editorial, production, marketing or design enquiries: 01326 574842 megan.watkins@enginehousemedia.co.ukMegandes.glover@enginehousemedia.co.ukDesClientrichard.mcevoy@enginehousemedia.co.ukRichardManagingcharlotte.forster@levenmediagroup.co.ukCharlotteAccountstracy.dart@levenmediagroup.co.ukTracyCreditproduction@enginehousemedia.co.ukControlDart–01326574842ManagerForster–07714718471DirectorMcEvoy–07771868880ManagersGlover–01326369426Watkins–01326369429
CORNWALL LIVING | 3
GOT TO EXPERIENCE 4 | CORNWALL LIVING HiddenExperienceGottoawayamongstthewildsoftheLizardpeninsula,HouselBay offers the perfect retreat for those looking for a winter escape. Perched on nature’s edge, above a secluded cove at the most southerly tip of the UK, Housel Bay is a hotel inspired by nature in an area where few have ventured, evolving magnificently from season to season. The quieter winter months are a particularly special time to visit, with dramatic storm watching, beautiful winter sunsets, epic stargazing and fresh cold-water swimming after which you can curl up by the fire with a book. Inspired by the season and their natural surroundings, the team bring the drama, warmth and beauty of winter into their menus, which can be thoroughly enjoyed with their three-night offer, A Taste of Winter, just made for foodies and nature lovers alike, only available when you book direct! HOUSEL BAY The Lizard, TR12 7PG 01326 567500 stay@houselbay.com | www.houselbay.com Find more like this: www.cornwall-living.co.uk A WINTER STAY AT HOUSEL BAY
GOT TO CORNWALLEXPERIENCELIVING | 5
(Previously Carpenter Oak Cornwall) Beautiful timber buildings | 01326 336554 | www.post-beam.co.uk | hello@post-beam.co.uk Homes | Extensions | Studios | Cabins | Garages | Commercial buildings
Guide to the show All you need to know about this year’s Cornwall Home Improvement and Self Build Show. 55 INSIDE CORNWALL LIVING | 7 CONTENTS Contents REGULARS 9 News & views Catch up with Cornwall 33 Luxury property Dream homes by the sea 52 Coastal escapes Our favourite Cornish stays 100 On display A window into Cornwall's art scene FEATURES 42 Iconic interiors Touched by the hands of iroka 75 A hidden foodie gem The timeless jewel that is Talland Bay 85 Rising high Elevating the gastropub to new heights 90 Welcome to Falmouth A walk along the cobbles of this famed town 97 One of a kind Re-use, re-love and re-style with Love of Lemons 122 A wild adventure Get up close to some of the wonders of nature Turn25to page 25 for this month's cover feature 75 97 85 100 ON THE COVER Taken and supplied by Doug Price of Doug E. Photography, our cover shot this month is of the stunning Gernards Head. www.dougephotography.com 9
Martyn Dempsey has been a professional painter for over 30 years, initially studying at the St Ives School of Art. His work is often experimental due to his intense passion for conveying what he sees on his travels, translating into sketches, which he then brings back to his studio in Zennor. It is here where he creates his work, mostly on canvas using oils but occasionally with pencil and water colour. Martyn has since studied at the famous Florence School of Art with the renowned painting and drawing instructor, Lukas Brandli. He has a permanent display at The Fornacia Art Gallery in the city Exhibiting with local artists from the north Cornwall area, Martyn has hand-picked fellow creatives – Emily O’Brien, Tash Owen, Gemma Lessinger, Emily Penfold, Paul Lock, Sian Burridge and Bernice Edgley – to showcase their work in an upcoming exhibition called Contemporaries, running from 19th until 23rd October. The show promises to deliver a range of fine art, craft and design. For more information call 01208 881032 or visit www.mdempsey.co.uk into September Synchronous display at Rock Institute
☞
Making its home at Gwithian Towans, widely regarded as the jewel in St Ives Bay, Global Boarders specialises in small, intimate group and private lessons, with a promise that no detail is overlooked to ensure an unforgettable surfing experience, and surfing is not the only activity on the agenda. Coasteering is one of the fastest growing adventure activities for families in the UK, and where better to experience it than from the rugged Cornish coastline? As the exclusive provider of coasteering adventures from Mousehole, you can expect to swim with seals, explore ocean caves, float through gullies and challenge yourself to take on rock jumps ranging from 2ft to 25ft! The only limit to this exciting ocean adventure is your imagination. Family run, Global Boarders offers everything from surfing at Gwithian and Praa Sands and Coasteering at Mousehole, from £45 per person for a 2.5 hour session, to bespoke, week-long private family activity packages. What’s more, with close proximity to the Sunset Surf Café, you’ll have everything you need to spend the day on the stunning Cornish coast.
For more information call 07769 831578 or visit www.globalboarders.com
the loop at www.cornwall-living.co.uk & viewsNews & viewsmore News
While summer may be nearing its end, coastal adventures with Global Boarders remain in full swing this September with the sea still warm from the heat of the months just gone by. With 17 years’ experience under their belt, and all the equipment and facilities you need to get out there and explore the stunning coastline, Global Boarders is one of very few schools in the country to hold the prestigious ‘Centre of Excellence’ rating.
www.thecarpettrader.com 01208 368643 • carpettrader@hotmail.com Unit 4 • Dunveth Business Park • WADEBRIDGE • PL27 7FE (Next door to Screwfix) | Monday to Friday 9.00am – 5.00pm • Saturday 9.00am – 1.00pm 15% off on fitted carpet and vinyl with code CL126 WE SUPPLY AND FIT AMTICO • BRINTONS • V4 • KARNDEAN • FIBRE • ABINGDON • CORMAR AND MANY MORE FREE QUOTATIONMEASUREANDSERVICE
Keep in
CORNWALL LIVING | 9
Surfing
With summer flying along, she is busier than ever, and if picking up a brand-new skill in pottery (or working on one you may already have) is on the agenda this year, now is the time to throw yourself in. With a limited number of spaces left on her hand building courses, time is of the essence when it comes to booking your space with Sally.
Meet ceramicist, Sally Tully, whose interest in all artistic mediums has allowed her to develop an extensive range of skills in both 2D and 3D materials. She has a pottery studio and creates both stoneware and Raku fired pottery, and believes that any and all creative activities hold merit and that there should be no boundaries to a person’s imagination in pursuit of their artistic goal.
which point the shop will be decked out in festive apparel with spooky themed toys and costumes. All of these will be announced on the Instagram page, so be sure to head online and give them a follow! For more information call 01208 622084 or www.www.bellaspetboutique.co.ukvisit Sophisticated canine success & viewsmore News ☞ www.mjchristophers.co.uk Please call for a FREE no obligation quotation and professional advice CORNWALL’S REMOVALS & STORAGE SPECIALISTS A Family Firm Established Over 3 GenerationsMemb No: C001 NEWQUAY 01637 872529 TRURO 01872 263373 REDRUTH 01209 313122 ST. AUSTELL 01726 66880
Although she makes mostly Raku fired vessels, Sally also makes utility ware, mugs, bowls and the odd tea pot. She likes the thought of people using these items every day and appreciating the skill used to make them, and that her pieces will actually enrich their everyday lives.
also including cat clothing, for those special moggies in your life. Of
Sign-up for creative days with clay
As she puts it: “My attitude has always been that ‘if it pops into your head, then try it. Experimentation is the route to success and should know no bounds.”
10 | CORNWALL LIVING
The Bowji Gallery at Roskillys has lots of her work on display, along with other local artists for everyone to see and purchase for that special present. Next year’s dates for workshops will be available soon, and you can be added to the mailing list by contacting Sally at the email address below. For more information orsallytullyceramics2021@outlook.come-mailvisitsallytullyceramics.co.uk Since opening in May 2022, it’s been a rollercoaster ride for Bella’s Pet Boutique. So much so that the team are launching an ecommerce website in order to cater for the demand from existing and new customers! All ready for the influx of visitors and their dogs this coming autumn, here the focus will be on stylish outdoor gear –They’re course, at at
coats, drying robes, t-shirts and jumpers for those colder days.
the end of the season we have Halloween,
CHRISTIES FURNITURE , COMMERCIAL ROAD, PENRYN, CORNWALL, TR10 8AE TEL: 01326 373 272 EMAIL: INFO@CHRISTIESFURNITURE.CO.UK WEB: WWW.CHRISTIESFURNITURE.CO.UK Sofas Dining Beds Bedroom The Big HALF PRICE SALE NOW ON! The Big Sale is now on at Christies Furniture & Christies Bed Shop in Penryn. Specialising in sofas, dining and living room furniture and of course beds. In addition, they have 100s of one-off pieces from ornaments and lamps to pictures and rugs to choose from. There will never be a better time to shop and save than in the Christies Big Sale.
& viewsmore News ☞
There’s nothing quite like a hug and thanks to technology, Cornwall Hospice Care now have special beds that allow families to climb in together for a cuddle. At first glance they look like any other single patient bed, but the design allows for them to be extended from the side to make room for “They’retwo.
The purchase of the cuddle beds was made possible with the generous support of a number of Trust funders. Paul Jones, the healthcare charity’s Major Gifts Manager, says; “We’d like to thank all the Trust Funds who helped to buy the new cuddle beds that are now in both St Julia’s Hospice and Mount Edgcumbe Hospice in St Austell. We’re grateful that they understood the need for these beds that are proving very popular with our patients and their loved ones.” For more information call 01726 839156 or visit www.cornwallhospicecare.co.uk
brilliant pieces of equipment” says Lou Ranford, Ward Sister at the charity’s St Julia’s Hospice in Hayle. “Our patients can share with a loved one to read, watch TV or just be together. We can then bring the bed back to its single form when we need to attend to the patient’s care. One of my fondest memories is of looking through the doorway of a patient’s room and seeing them with their partner and child on the bed all laughing and joking together.”
Cuddle beds for Cornwall’s hospices
12 | CORNWALL LIVING
One of Truro’s leading lights Truro School has been recognised as one of the leading independent schools in the UK after being shortlisted for three national awards, including the highly coveted ‘Co-Educational Independent School of the Year’, ‘Independent School of the Year for Sporting Achievement’ and the ‘Green Award for Environmental ItAchievement’.wasupagainst hundreds of schools from across the country in a scheme designed to ‘highlight the excellence of the student experience offered by the UK’s amazing independent schools’. Truro School Head, Mr Andy Johnson, says: “A huge thank you to our staff and pupils who work hard to ensure Truro School is at the forefront of educational excellence; it is wonderful to have their commitment and innovation acknowledged by these national awards.” For more information call 01872 272763 or visit www.truroschool.com
Please call us to see how we can help you Tel: 01208 812272 Email: ccconversions@btconnect.com Web: www.ccconversions.co.uk Disclaimer: We are an Independent business and in no way connected to AGA, AGA Rayburn or AGA Rangemaster Limited. We provide services relating to the product known as an “AGA”. We recognise and acknowledge all trademarks and patents in relation to the AGA product. THE FUTURE IS ELECTRIC UPGRADE YOUR RANGE WITH THE ENERGISER ELECTRICImproveCONVERSION…runningcosts Ease of use • No servicing • No fumes Can convert – solid fuel, oil and gas QUALITY GERMAN KITCHENS & APPLIANCES UNIT 13A, THREEMILESTONE IND EST, THREEMILESTONE, TRURO, CORNWALL, TR4 9LD | TEL: 01872 225 990 SALES@KITCHENKITSW.COM | WWW.KITCHENKITSW.COM FINDOUTABOUTOURLATESTOFFERSINTHESHOWROOM 01726 Cornwallsales,Onlinewww.plantsofcornwall.com884040plantbringingapieceoftoyou
Simply beautiful floors you’ll love for a lifetime. Available in a wide range of designs, colours, textures and sizes Lifetime guarantee Can be personalised with design strips or complementary borders South West Carpets invite you to view the new Karndean Select showroom in store * Receive a complimentary Floor Care Kit with installation of your Karndean fl oor. Golden Brushed Oak VGW122T Free Floor Care Kit* Visit us at: South West Carpets Ltd Treloggan Industrial Estate Newquay, TR7 2SX 01637 872023 | southwestcarpets.com
New
Into the Carrick Roads: Exploring Hidden Cornwall is an exhibition of paintings and drawings by award-winning Cornwallbased artist, Andrew Barrowman. The works are hung in sequence, following Barrowman’s journey around the river from Falmouth to St Mawes, visiting the many creeks, fields and farmland that are part of the Carrick Roads. The exhibition is open until 23rd December 2022, with free admission. A great way to support the museum and to not miss out on any exhibitions, is to join as a member. With your membership, you’re entitled to free entry, monthly newsletters, the annual journal, invitations to previews and other exclusive events, as well as discount in the museum shop. To join, either pop into the museum, or visit the website.
cornw ll
Homeowners are snapping up substantially discounted energy deals with rates as low as 10pence per kwh. Farmers and commercial property owners are also securing rental yields of £180,000 over 10 years as well as vast savings on rates (17pence per kwh). The scheme includes solar panels and battery storage as a warranted package with full maintenance included for the entire 10-year term, but hurry, it won’t last forever! For more information call 0345 065 8888 or visit ukretrofit.co.uk newowners@cornwallhideaways.co.uk01872888631
For more information call 01872 272205 or www.royalcornwallmuseum.org.ukvisit
CORNWALL LIVING | 15
Letting your holiday home has never been easier... We are looking to expand our portfolio across the county, and are dedicated to making the process of sharing your holiday home easy and enjoyable. With tailored services to suit your needs, you can be involved as much or as little as you like, knowing that you and your guests are in safe hands.
Solar is back, with energy prices from 10ppkw! & viewsmore ☞ exhibition at Royal MuseumCornwall
News
For Rubina and William Tyler-Street, founders of Curio Spirits, it all began back in 2012. “It started with us playing around at home with small bits of distilling kit on the kitchen table. We knew we wanted to make our own spirits, but at this point we were just trying to work out the ‘what’ and the ‘how’.” Ten years later and they have a thriving business based at the Shipyard in Porthleven. Here you’ll find their spirit shop, distillery and experience room for gin tasting and cocktail classes, enabling them to fulfil their desire to have direct contact with their burgeoning customer base. Inside, you’ll be able to fully immerse yourself in the Curio world – sampling their unique range of spirits and gaining an insight into processes and the thinking behind the brand. For more information call 07980 943391 or www.curiospiritscompany.co.ukvisit From kitchen table to harbourside
With the state of the nation’s energy costs in turmoil, ukretrofit.co.uk is busy delivering a price-busting solution to beat the energy crisis. Unsurprisingly, it’s taken off like a Increasingrocket! amounts of renewable power feeding the National Grid means an increased requirement for ‘grid-balancing’ via battery-storage systems. This has created exciting opportunities for savvy homeowners, farmers and commercial property owners. Ukretrofit’s Micro-GridBalancing Project (MGBP) offers substantial savings on domestic and commercial energy prices. “Demand for MGBP is through the roof because electricity costs of 50p per kwh are expected to double in October….” said a spokesperson from the firm.
A30 A30 STEAMERSHILL ANGARRACKLANECARWINRISE GWITHIANROAD TrevaskisFarm Connor Downs To Hayle Angarrack Marks&Spencer MARSH LANE w w w w e s t c o u n t r y b l i n d s.c o.u k i n f o @ w e s t c o u n t r y b l i n d s.c o.u k TR27 5JR 0 17 3 6 7 5 2 3 9 7 Your local suppliers of shutters, curtains, roller, venetian, vertical, roman & Duette pleated blinds. VISIT OUR SHOWROOM STYLE YOUR HOME FOR SUMMER WITH A SELECTION OF BLINDS MADE HERE IN CORNWALL beautiful blinds STYLE YOUR HOME WITH A SELECTION OF BLINDS MADE HERE IN CORNWALL
The team at Whitegoose love to finish a fabulous season on a high, and their now famous half-price sale is in full swing, with an exciting 50% discount on all clothing and 25% on jewellery. Naturally a chance like this will draw familiar faces and new customers from all around, so if you’re looking to find yourself an irresistible deal you’ve got until mid-September, after which the team will be delighted to introduce a stylish autumn/winter collection. It appears that green is the new black for the season ahead, alongside fresh colours like fuchsia pink, while puffer coats are back with a bang and the ‘après-ski’ look is both practical and on trend. Make sure to check out the gorgeous winter collection from One Hundred Stars, dresses, kimonos and beautiful gifts plus a sumptuous jewellery collection and much more.
For more information call 01208 815517 or visit Whitegoose(&Co), 1 Foundry Street, Wadebridge PL27 7NW.
CORNWALL LIVING | 17
For more information call 01326 368369 or
Mike Lacey Photography (Waves Gallery) has been capturing the mood of the sea for nearly ten years now. Based in Porthleven he mainly captures his photos around Cornwall at some of his favourite well known spots – Praa Sands, Kynance Cove, Porthcurno and of course on the reefs and cliff tops at Porthleven.
The gallery now stocks striking splash backs to bring a touch of Cornwall’s ocean life, via Mike’s photography, to your home. The finished results are waterproof, UV protected and easy to clean, making them perfect for kitchen or bathroom. What’s more you don’t have to be restricted to a standard sizes or proportions, so if you know the measurements and you’d like a bespoke back drop please email your required dimensions to mike@mikelaceyphotography.co.uk
www.wavesgallery.co.ukvisitEnysHouse
Making waves in Porthleven
& viewsmore News ☞
Antiques & Decorative Fair Antiques and art, coffee and cake, gardenalia, home, interiors, kitchenware, and lighting; magical, Nicki (& Ralph), original, persian, quirky, rustic, stylish, tasteful, useful, valuable, weird, exceptional, yearning, zoological... If any of the above piques your interest, then you should head to Enys Gardens on 24th and 25th September; a wonderful antiques and decorative fair awaits you. Ludgate House Antiques in Falmouth is proud to host around 30 dealers, spread from Penzance to Derby who will be bringing their finest stock. Over half of the dealers are travelling from out of county to this special fair, all set in the unique and wonderful grounds of Enys Gardens and Enys House itself. Alongside the established dealers they have some new faces joining them this year; Smith & Moon (mid-century decorative), Holbrook & Bray (period pieces for home and garden), Faded Vintage (French painted country furniture), Cunningham Whites from Totnes make a welcome return, as does Michael Thomas (bijouterie), Alasdair Scott trading as Gander at Gray, and Paul Drewett Decorative Art. Bill Carter ‘the Brocanteur’ retains the title of farthest travelled, heading down from Derbyshire. As a visitor you may be assured that all dealers will have quality items and are selected to provide a broad mix. Perhaps most importantly, everyone comes together to cultivate a friendly and welcoming atmosphere. They look forward to welcoming you, with full catering and bar on Entrysite.fee is £8 per head which includes entry to the gardens, under 16s go free. For more information www.ludgatehouseantiques.comLudgatehouseantiquesvisitor
A new season, at Whitegoose (&Co)
& viewsmore News ☞
Sunset stays through September and autumn A truly unique claim that can be made by the Land’s End Hotel is that it possesses an uninterrupted view across the water to the setting sun in the west, 23 minutes after it is already dark in the capital! Sitting proudly a top of a granite promontory you can gaze out from your bedroom window and take in the breath-taking view of the Atlantic Ocean, as it reflects the ochre-stained evening heralding a farewell to another day. Watch as the famous Longships Lighthouse becomes silhouetted against a blaze of orange and, on a clear evening, witness as that ripple of land that sits on the horizon retreats into the darkness as the Isles of Scilly settle down for the night. And then, in the morning, after a hearty breakfast prepare to step out and experience a meander along the coastal path – either toward Nanjizal to the south-east or Sennen Cove to the north-east. Breath in the chill, clean air and become invigorated by a feeling of being at the edge of the world. Watch the gannets spectacularly dive upon their pray out to sea and hear the resonating cry of the gulls as they swoop and then hang upon the updraft from the 200-foot sheer cliff. After you’ve had your fill, return to the luxury and warmth of your hotel bedroom that reflects its Victorian heritage but with a big nod to contemporary twists and modern whims. All in all, it’s a place to head to this forthcoming season. For more information call 01736 871844 or visit www.landsendhotel.co.uk
Importing from Burgundy with Wadebridge Wines Devastating frosts in April were just the start for the vineyards of burgundy in 2021. Snow and a cool, wet summer followed to only worsen the situation. Fortunately, Burgundian winemakers have seen their fair share of challenging vintages throughout the ages, and didn’t lose faith. Though some lost up to 80% of their crop, by late September the sun eventually shone and gave the grapes the final ripening they needed before harvest. Several months later, the shipment arrives at Wadebridge Wines directly from their favourite estates with a fantastic selection for you to try; whether you’re just discovering one of the oldest winemaking regions in the world, or you’re a traditionalist who won’t drink anything else. For more information call 01208 812692 or www.wadebridgewines.co.ukvisit
18 | CORNWALL LIVING MAD Water Sports Ltd 15 Dunveth Business Park, West Hill, Wadebridge. PL27 7FE 01208 www.madwatersports.co.uk814222 SUP & SURF CENTRE MAD WATER SPORTS LTD North Cornwall’s best Surf and Paddleboard store, located in Wadebridge, stocking 100’s of Paddleboards and Surfboards Top quality, brand leading, Surfboards, offeringonrunMADorAccessories.Windsurfers,Paddleboards,WetsuitsandPopintobrowsebuyonline!WaterSportsisafamilybusinessthatpridesitselfoldfashionedservicevalues,helpandexpertadvice. OPENALLYEAR (checkwebsitefordetails)
Shutters and blinds that transform your home! For your FREE consultation, contact Lynn and Steve, your local Shuttercraft specialists: 01637 849 153 www.shuttercraft.co.ukControloflightandprivacyinyourhome10YearWarrentyUnmatchedcustomerservice Print Ad A5 landscape.indd 1 21/04/2022 15:11:35 VERANDAS • CARPORTS • GLASS ROOMS • PERGOLAS PRICE PROMISE It’s simple, we will never be beaten on price • All year round barbeques and parties • Children can play outdoors come rain or shine • Cats and Dogs love the cover • Patio tables and chairs stay dry - No need to store away for most of the year Any colour and any size to suit you and your property Supply and install or Supply only • D.I.Y kits available - Trade Discounts For a FREE quotation or brochure call Truro 01872 470210 or www.allweathercanopies.co.ukvisit STAINED GLASS • WINDOWS • DOORS 07885 975 info@specialistglass-cornwall.co.uk324www.specialistglass-cornwall.co.ukinfo@specialistglass-cornwall.co.ukwww.specialistglass-cornwall.co.uk
“We chose ColourFence 15 years ago and it looks as good as new. ” Mr & Mrs P. Stringer Choose 25 years maintenance free metal fencing*. Choose ColourFence. Brown Cream Blue Green 25 YEAR guarantee For a free, no-obligation quote, find out more via: 01637 222 colourfencecornwall.co.uk578 *T&C’s apply – see website for details Unique ColourFence GUARANTEE ◆ Virtually, maintenance FREE for 25 years* ◆ Won’t warp, crack, shrink, rot or peel ◆ Withstands gusts up to 130mph Why choose anything else? ◆ Metal fencing available in four colours ◆ Established in the UK for over 15 years ◆ Professional installation Forget fence worries for good.
Oils and acrylics feature everything you will see in the landscape of north Cornwall –sunshine on the beaches, the energy of the ocean, the weather ravaging the moors. Among these works of art, you’ll find beautiful, delicate ceramics, an excellent selection of silver jewellery, wooden and glass pieces and cards for all occasions, with recycled and natural materials featuring in the three-dimensional pieces. For example, finds from beach cleans and ocean flotsam are incorporated into a new series of Mirolike mobiles from a local artist who creates fascinating 3-D printed acrylic jewellery, also available at Wave 7 Gallery. A talented artist in her own right, Plum’s contemporary painted mirrors are available directly from her in Wadebridge and are also stocked in other Cornish galleries. Whilst these may not be the pictures you might expect to see in a gallery nestled in central Wadebridge between coast and countryside, the quality of the art will certainly surpass your expectations. For more information call 01208 880605 or visit www.wave7gallery.com 01208
CORNWALL LIVING | 21
Located in Wadebridge’s pedestrian central shopping area, Polmorla Walk, Wave 7 Gallery is home to a wide range of stunning paintings to suit all tastes and budgets.
Passionate about the artists whose pieces she stocks, gallery owner Plum Mead has created a gentle, calm and inspiring space from which to select your next piece of art. Her infectious enthusiasm encourages an appreciation of the works beyond just looking at a painting hanging on a wall, and her knowledge and expertise is on hand to advise you on your next purchase.
Making room for inspiration
www.wadebridgedentalcare.co.ukinfo@wadebridgedentalcare.co.uk813816 • Implants • Invisalign • Teeth Whitening • Smile Makeovers • Sedation • Facial Aesthetics EMERGENCY APPOINTMENTS AVAILABLE FOR UNREGISTERED PATIENTS GENERAL PRIVATE DENTISTRY AND HYGIENIST APPOINTMENTS ALSO AVAILABLE FREE CONSULTATIONS & viewsmore News ☞
Founder of the national award-winning Golden Glow Yoga College, MD Sharon O’Neill was born and raised in the Cornish town of Falmouth. While the highly successful training scheme and studios opened in 2006 in Ireland, recently evolving to include virtual access, Sharon is heading back home to Penryn in Cornwall after over 25 years away to fully embrace the GGYC motto – ‘freedom to choose’. With a law degree, mediation training, and extensive Yoga Teacher Trainings under her belt, including Senior and Grandmaster in India, Sharon has acted as Yoga Alliance International Director for Ireland from 2013 to 2020. Receiving an Honorary Doctorate for the Yoga Teacher Training programs in 2017, Dr Sri Radha Sharon O’Neill BCL Hons Ph.D Yoga will continue this magical journey with all levels of Yoga Teacher Trainings, classes and retreats with locals in Cornwall and Ireland this September and is the Residential Yoga Teacher at the Royal Duchy Hotel Falmouth. For more information call 07934313386 or contact freedomYoga:info@goldenglowyoga.co.ukfindingthe to choose
CALL US TODAY FREE ON: 01209 780 034 MOBILE: 07537 149 128 www.garolla.co.uk It’s time to upgrade your garage door to a Garolla electric door. Not only are they strong and secure, they are also thermally insulated. So if you’re or even a garden bar, Garolla is perfect for you. Give us a call today and we’ll come and measure up FREE of charge. 2 REMOTE CONTROLS ACOUSTIC & THERMAL INSULATION FREE DISPOSAL OF YOUR OLD DOOR AVAILABLE IN 21 COLOURS Example shown: • 3.6m wide opening • 77” Anthracite grey slats Only £1,990 Price on this door style can range from £1,440 - £2,740 depending on the width of door opening
CORNWALL LIVING | 23 Inclusive accessibleandfun with CST! Children’s Sailing Trust has launched a new website for the public to quickly and easily book watersports activities, sailing courses, birthday parties and events. After a delayed opening to their new watersports centre in October 2021, the former quarry at Trevassack Lake is now home to CST headquarters, a selection of purpose-built, fully accessible holiday homes (Trevassack Holidays) and now, CST Experiences! CST Experiences brings watersports, activities and events on the Helford River and Trevassack Lake to the general public, with money raised through bookings helping to support the work the Trust does in providing sailing and watersports opportunities to all, whatever their financial situation or their physical or mental ability. For more information call 01326 702326 or www.childrenssailingtrust.org.ukvisit
Low energy prices fixed for 10 years (10p per kwh; Farms/commercial from 17ppkwh) Solar + Storage + fully maintained and managed No rental contract Farm Partnership options (£150k - £1.5M yields over 120months) Call for a discreet chat on 0345 065 88 88 www.ukretrofit.co.uk MGBP StorageSolarScheme •••• Getting more from energy
Authentic Cornish dining at Brasserie on the Bay Surrounded by Falmouth’s burgeoning food scene, local boy and Executive Head Chef Darren Millgate is making waves and taking diners on a laid-back tour of Cornish fields, farms and waters at the picturesque Brasserie on the Bay. Having trained under Michelinstarred Ben Tunnicliffe and learning his trade in the south of France, Darren is back on home turf with a food philosophy centred on honest, Cornish produce.
“One of my earliest memories was going out with my dad on our boat at Portholland to pull up the net and see what was in store for dinner. The excitement of not knowing what would be in the net still guides me today. It’s far more important than the flamboyance and waste of a fine-dining operation.”
On a regular trip to Newlyn Fish Market, Darren runs his eye over an array of hake, rays, brill, turbot and red mullet while Cornish Fish Direct co-owner Anthony talks him through his latest hauls. He points
Darren in the direction of his prized, fresh catches - farmed sea bass, smoked salmon and weaver fish, all of which Darren orders on the spot and ideas immediately spark on plating the dish and bringing it to the table at St DarrenMichaels.spends the afternoon in the fields of local organic vegetable suppliers WestCountry, getting first-hand experience of their ‘no dig, no fertilizer’ production Themethods.relaxed Brasserie on the Bay looks out across the shimmering seas and white sands of Gyllyngvase Beach and is open all year round. For more information call 01326 312707 or visit com/dine/brasserie-on-the-baywww.stmichaelsresort.
MADE IN CORNWALL FOR OVER 30 YEARS GET IN TOUCH: T: 01209 215 759 E: enquiries@philipwhear.co.uk FIND US: Philip Whear Windows & Conservatories Ltd. Wilson Way, Pool Industrial Estate, Redruth, Cornwall TR15 3RT BROWSE ONLINE: PHILIPWHEAR.CO.UK WE OFFER A COMPLETE RANGE OF CONSERVATORIES, ORANGERIES, WINDOWS, DOORS & GLASS BALUSTRADES TIMBER & UPVC IN ANY COLOUR VISIT OUR FACTORY & SHOWROOM CARBIS BAY ST AUSTELL PRAZE-AN-BEEBLENEWLYN FALMOUTH
COVERCORNWALLFEATURELIVING | 25 A taste Words by Hannah Tapping Celebrating the makers, bakers, growers and producers that are placing this enchanting archipelago on Cornwall’s food and drink map. OF SCILLY NorthDanny©Image BrownAdj©Image
Flowers rather than food were one of the main industries on the islands during that time, but the growth of overseas production resulted in a decline in the industry.
My first experience of Scilly was a holiday on St Mary’s as a young girl some 40 years ago. The nearest we got to a foodie feast back then was a bag of chips and an ice-cream sat overlooking Pelistry Bay. Subsequent years saw us spend two idyllic weeks every year on St Martin’s. This was a time of simple pleasures, where the absence of mains electricity meant that the hum of the generators played the soundtrack to our evenings. Each morning we collected our milk in churns from Carron Farm and a stroll to the pub for a rum and shrub at the Seven Stones was much loved.
Rearing their own Red Devon beef cattle, alongside chickens and bees, as well as growing fruit and vegetables, the farm offers a diverse habitat that is managed specifically to sustain wildlife.
Veronica Farm Fudge As with many of the producers on Scilly, small-scale production often begins with kitchen table R&D. This was the case for the Taylor family, whose Bryher-based fudge making ( veronicafarmfudge.co.uk ) began over 20 years ago on their AGA, using traditional methods and local milk from Troytown Farm on St Agnes. Moving to Bryher from the mainland in the 70s, owners Kris and Geoff were in the business of flowers rather than fudge, but when the narcissus market dwindled due to European competition they needed to diversify. Their entrepreneurial daughter Issy had been making fudge to fund dance lessons, and when she left for university, they took over the production of these sweet treats, scaling the business and rescuing the farm’s future. BELOW Chilli
& RIGHT Scilly
Lockdown, as with many companies, saw them hit rock bottom as income from their holiday lets and honesty stall disappeared overnight. A glut of chillies saw owners Ruth and Graham buy a dehydrator in a bid to find a product that would save the farm. Light to post, the resulting scarlet gems caused a stir on both the mainland and the farm stall and so Scilly Chilli (scillychilli.co.uk) was born.
DIDEXPERIENCEYOUKNOW? Fantastic feasts and where to find them… This year’s Taste of Scilly festival runs from the 15th25th September. Chef Simon Stallard, whose renowned clifftop café The Hidden Hut and recently opened pub The Standard, both on the Roseland, will be travelling to the islands using local produce to cook up some very special feasts in September. The events take place on the 23rd on Tresco, the 24th on St. Martin’s and the 23rd on St. Mary’s. Visit www.visitislesofscilly.com for more details.
BrownAdj©Image BrownAdj©Image BrownAdj©Image
Scilly Chilli The heat is on at Hillside Farm on Bryher.
Testament to their resilience, the islanders were undeterred and turned to production of a different kind – namely food and drink.
INSET WestwardFarmGin COVER FEATURE 26 | CORNWALL LIVING
Such is the plethora of producers and growers on the islands now, they even boast their own festival, The Taste of Scilly which takes place in September each year. We take a tasting tour of just a few who are leading way.
Westward Farm Neighbouring St Agnes farm (westwardfarm. co.uk) has been producing soap and toiletries for many years, growing plants on the farm which are then harvested and distilled to produce the quality essential oils that provide the enticing fragrance of their soap, shower gel and hand wash. Using their experience of extracting the very best qualities from different botanicals, thoughts turned to gin! Aiden Hicks, the seventh-generation custodian of Westward Farm, wanted to create an honest gin using as many seasonal botanicals from the farm as possible. Other ingredients don’t travel far, including honey from Tresco, used to create an exclusive Tresco Abbey Garden gin. Tresco Honey
ABOVE Tresco
CORNWALL LIVING | 27
Another farm to have lost their flower crop, the Hicks family knew they had to turn their attentions to production of a different kind to supplement the milk sales. Clotted cream came first, followed by a luxurious smallbatch ice cream that is now available in over 30 flavours.
BELOW SC
Troytown
Scillonian Bee Project in 2021 to protect the 11 hives they have on the island and to save the island’s native dark honey bee, is the custodian of the island’s bee population. With hives on Bryher, St Martin’s and St Agnes, each jar of island honey has its own unique taste due to its local conditions and is used to flavour other island produce such as fudge, ice-cream, gin and rum.
The Island Bakery Barney McLachlan is an early riser on St Martin’s as the island’s daily batch of organic breads and rolls is baked. Starting at 4am, the first task of the day is to decide how much to bake based on visitor predictions, which can be up to a staggering 600 a day If the weather is good and there’s a double landing of trip boats to the island. As well as daily bread favourites, including a reduced-sized camper’s loaf specially produced for St Martin’s campsite guests, Barney and his team also bake sweet pastries as well as a ubiquitous Cornish pasty (baked to a special island recipe of course!) that is always a sell-out.
COVER FEATURE
The bees who make the hives in the Abbey Garden (tresco.co.uk) their home have a very unique foraging landscape. As well as over 80 exotic sub-tropical species in the garden, the bees have access to botanicals from the length and breadth of the island. Tresco bee aficionado Jilly Halliday, who established The
SC Dogs Growing sugar cane on what were once flower fields on St Martin’s, Andrew Walder of SC Dogs’ (scdogs.co.uk) is hoping that his harvest will eventually result in the islands' first true field-to-bottle spirits. Based at Carron farm, each of SC Dogs vodka and rum (named for a combination of the island’s fishing boat prefix SC as well as Andrew’s and Scilly’s seafaring past) is dedicated to a venerable island ‘sea dog’. Bottles are adorned with a portrait of said sea dogs drawn by local artists, printed on the inside of the label appearing ghost-like through the Scilly spirits. honey Dogs BELOW Farm
dairy produce • LEFT FarmVeronicaFudge RIGHT St Martin'sBakery BrownAdj©Image BrownAdj©Image BrownAdj©ImageBrownAdj©ImageBrownAdj©Image
Troytown Farm With its campsite that sits at the very edge of the island, Troytown Farm (troytown.co.uk), as with many businesses on Scilly, has more than one string to its bow. It’s the only dairy farm on the islands with just 11 milking Jersey and Ayrshire cows. A daily milk round on St Agnes has expanded with Troytown milk now being exported to the other islands.
For more information call 01209 213701 or visit www.mhfl ooringspecialists.co.uk Visit Our Showroom
This unique coastal vineyard covers an area of just over a hectare of south-facing slopes with predominantly granite soils. Once a flower farm, whose bulbs still make a surprise appearance now and again with daffodils and lily of the valley flowering amongst the vines, its natural evergreen pittosporum windbreaks now protecting the vines rather than the bulbs. Grown just a few yards from where they are pressed, the vines have minimal input with a predominantly organic spray regime. This core principle of sustainable organic production encourages natural pest predators with flowers under every footstep.
Ultimate Lifestyle by the Sea has never
DIDEXPERIENCEYOUKNOW?
As always, there's plenty up for grabs over on the Cornwall Living website competitions page, and there are always more being added. To see what you could win, pay a visit to: www.cornwall-living.co.uk/competitions
BringingWIN!the Ultimate Lifestyle By The Sea to your screen wherever you area, be sure to check out Cornwall Living TV! www.cornwall-living-tv.co.uk
code below on your smart device and access all of the above within just a couple of clicks.
closer to hand... SHORT ON TIME? Read, Watch, EXPERIENCE
A trip to this island paradise is made easy with Isles of Scilly Travel. Just check out the incredible deals they have on offer by air and sea at islesofscilly-travel.co.uk!
Island Fish No round up of island produce would be complete without a fishy tale! The Pender family (islandfish.co.uk) has been fishing out of Bryher for hundreds of years. Mike launches daily to fish the waters around Scilly in his 43-year-old self-built vessel, The Emerald Dawn SC35. Ably supported by son Mark’s Dorothy Ethel and grandson Shamus’ Ma Vie, this little fleet of boats lands its catch of crab and lobster from up to 250 baited pots. This is truly a family business with Mark’s wife Amanda checking, cooking and picking the catch. What isn’t sold from their deli-counter is destined for the island’s restaurants and merchants on the mainland. ABOVE StVineyardMartin'sNick©Image
DISCOVERREADMORE…
READNoproblem! Simply scan the The been
Cornwall’s mainland also plays host to an incredible selection of food and drink favourites. Here’s just a selection of what you can expect to find over the coming pages… TOP TIPPLES Curio - page 15 Wadebridge Wines - page 18 Cornish Rock Gin - page 67 Copperfish Distillerypage 84 English Spirit - page 87 Mainbrace - page 89 FOODIE STAYS Housel Bay Hotel - page 4 Fowey Harbour Hotelpage 72 Falmouth Hotel - page 71 Talland Bay - page 75 DELI-CIOUS Oggies Cornish Kitchenpage 80 The Cornish Companypage 83 TOP TABLES Travellers Rest - page 77 Kota Kai - page 78 Trevaskis Farm - page 82 The Rising Sun - page 85 BELOW Island Fish BrownAdj©Image BrownAdj©Image
WATCHWhetheryouwant the best Cornish content delivered directly to your door, or to be among the first to receive the most exclusive discounts and special readers’ offers from our regular email newlsetters, head to our website and pick the subscription that works for you... www.cornwall-living.co.uk/subscribe/ It’s never been easier for those who love Cornwall to read, watch and experience for themselves the Ultimate Lifestyle By The Sea. From regular email updates and online blogs, to Cornish video content and incredible monthly competitions giving you the chance to win your own little piece of Cornwall, even if you can’t lay your hands on a copy of our monthly issues, our multi-media approach means you can access the best of Cornwall Living anywhere, at any time.
St Martin’s Vineyard
After more than 50 years of being different, the Penventon continues to provide the perfect base from which to explore Cornwall. Ideal for couples and families alike, the hotel features Cornwall’s largest gin bar, with over 140 gins, and aspires to host Cornwall’s largest wine bar too, with 120 wines and counting. To find out more about the Penventon Hotel, be sure to check out the video on Cornwall Living TV!
While we may be moving away from the heat of summer and into the cooler months of autumn, Cornwall is still alive with a hive of acitivity and we’re delighted to see the amazing content you’ve been sharing with us over the past couple of weeks. From antique fairs to luxurious hotel breaks, there’s always adventure to be found here!
ENYSDECORATIVEANwww.royalcornwallmuseum.org.ukANTIQUES&FAIRATHOUSE With everything from vintage kitchenware and lighting to gardenalia and interiors, this is not an event to miss, courtesy of Ludgate House Antiques. To read more about this exciting fair, be sure to turn to page 17 for all the information you need pay a visit this September! CORNWALLLIVINGUK
What’s on?
media
We recently revealed a chance hamper worth £100 plus a from The Cornish Company! Didn’t it? Then be sure to sign up to the Cornwall Living www.cornwall-living.co.uk/newsletter Did
newsletter!
you see? CURATED ONLINE Your Cornwall OCTOBER ONLINE DIGITAL SOCIAL
@
Where will your next Cornish adventure take you? Share with us on social and you could be featured
to win a
gift voucher
it
in print! Sharestoriesyour Magical Mevagissey! lifestyle_creative_photography The view from Cornwall... Mevagissey lifestyle_creative_photographyHarbour 30 | CORNWALL LIVING
you see
CORNWALL LIVING TV The bar is open at Penventon! www.cornwall-living-tv.co.uk
Cornwall Living blog
This month, Millie Fuller takes us on a tour of Newquay, intriducing us to some little known facts about this beloved Cornish seaside town. While famous for surfing and the vivid night life, there’s much more to discover than bars and beaches! www.cornwall-living.co.uk/blog
15 North Street, Ashburton, Devon, TQ13 7QH Tel: 01364 654888
From our studios, we work on projects across the South West and the UK, as well as overseas.
www.woodfordarchitecture.com
Woodford Architecture and Interiors were the winners of the 2020-2021 international property award for the best residential property in the United Kingdom.
Woodford Architecture and Interiors were the winners of the 2020-2021 international property award for the best residential property in the United Kingdom.
www.woodfordarchitecture.com
W OODFOR D ARCHITECTURE INTERIOR DESIGN
From our studios, we work on projects across the South West and the UK, as well as overseas.
W OODFOR D ARCHITECTURE INTERIOR DESIGN
15 North Street, Ashburton, Devon, TQ13 7QH Tel: 01364 654888
W eb : www.co r nwallkitc h enco m pany.co m E ma i l : in f o @ co r nwallkitc h enco m pany.co m T e l : 0120 8 36900 Q7 u a rr y m a n Sid e O ff ice , Ed m onton , Wadeb r idg e C o r nwal l PL2 7 7 J A
detached house of contemporary individual design and stylish exacting standards, Little Spring sits in the heart of the quaint rural hamlet of Penrose, just two miles from the stunning bay of Porthcothan.
LITTLE SPRING Two Twobedroomsdoublewithoptionalthirdsumptuousbathrooms Sleek modern Wood-burningkitchenstoveGroundsourceheatpumpDrivewayparkingwithchargingpoint A charming contemporary home inspired by luxury. LITTLE SPRING GUIDE PRICE: £775,000 JACKIE STANLEY 1 North Quay, Padstow PL28 8AF 01841 www.jackie-stanley.co.uksales@jackie-stanley.co.uk532555 CORNWALLPROPERTYPENROSELIVING|33 INFORMATION Newquay St IvesPenzance St AustellBodmin Rock Cornwall
Newly constructed in 2018 and inspired by luxury, the hallway welcomes you into a flood of natural light drawn in through the oversized windows and overhead glass walkway. To one side is the hub of the house, the spacious kitchen and dining area complete with quartz work surfaces and integrated appliances, with a convenient utility area and cloakroom with a rear door leading out to the garden. Find tranquillity in front of the free-standing, wood-burning stove in one corner of the living room, or seamlessly transition via full-height French doors into the private paved courtyard. A central oak and glass staircase leads to the first floor where you’ll come across two double bedrooms and two sumptuous bathrooms worthy of any boutique hotel. Complete with a high ceiling, the master suite enjoys a sit-out balcony with views across green fields and a contemporary en-suite bathroom with a walk-in rainfall shower, while the private dressing room can double as a third bedroom for children. The second bedroom benefits from similar views, while the family bathroom offers a serene space to soak away the day in the deep bath or invigorating walk-in rainfall shower. The gardens at Little Spring are stylishly landscaped, with attractive slate pavers encircling the property on all four sides. The warm outside shower can be found to the rear of the house alongside a useful wetsuit hanging rail, while space for an al fresco dining table on the other side makes for an ideal outdoor entertainment space.
Asplendid
TAMARISK
two large Velux windows to the front and rear, drawing in the countryside. Two further double-aspect bedrooms reside here, with far-reaching views, Velux windows, fitted wardrobes and en-suite shower rooms, making for plenty of space for the whole family.
ROCKPROPERTY34|CORNWALLLIVING
St AustellBodmin Rock Cornwall
drivewaySpaciousExteriorLightEnergydiningopen-planSenstationaldetailAttentionandGardenGardenbedroomsFourextendeden-suitestudioterracedeckingtothroughoutkitchen/roomefficientandspaciouslightingparking INFORMATION TAMARISK GUIDE PRICE: £1.5M SHORE PARTNERSHIP 01872 www.shorepartnership.comcontact@shorepartnership.com484484
T his inspired, imaginative and unique four-bedroom property blends classic and contemporary for a beautifully modern family home. Entirely re-modelled and extended, this twostorey detached home boasts a wonderfully open entrance hall. Light, spacious and well designed, the double-aspect kitchen benefits from two lantern roof lights and sliding doors leading out to the garden terrace, just perfect for entertaining. Through the barn-style sliding doors, the double-aspect living room also enjoys access to the terrace through full-width sliding doors along with a recessed ceiling lighting track, electric blinds and feature wall panelling. The master bedroom suite has views of the surrounding country through the two large picture windows, offering the luxury of a boutique en-suite shower room with twin basins, not to mention the walk-in wardrobe, while the second bedroom shares a similar view and the benefit of a fitted wardrobe and en-suite bathroom. Completing the ground floor is a home office, making working from home quiet and effortless. Natural light floods the galleried landing at the top of the oak staircase through the Recently re-modelled and
Outside, a full-width terrace with oak-effect decking provides a huge amount of space for dining and entertaining, communicating perfectly with the kitchen and living areas. Meawhile, the garden studio – a repurposed shipping container with contemporary cladding – features external lighting and has been fitted out as a guest ‘stayover’, providing a multi-purpose space that could also be used as a home office, playroom, music studio or gym, to name a few.
A beautifully re-modelled and extended, contemporary four-bedroom home.
Newquay St IvesPenzance
And what’s more it’s just minutes from the slipway, where you’ll find the Lugger, Cornwall's only AA-rated five-star inn as well as access to the South West Coast Path. Viewing is strictly by appointment. It won’t be on the market for long!
The locals all work to keep the community alive, organising events throughout the year. Not surprisingly most of the village has been declared a Conservation Area and there are many listed buildings.
S ituated in the quaint little harbour village of Portloe – arguably the ‘jewel’ in the crown of the Roseland peninsula – this is an absolute gem of a property.
Corfingle itself is a beautiful, wellproportioned property with three en-suite double bedrooms looking over an attractive semi-walled garden that is a veritable suntrap, with a stream running at the bottom that sets the scene for a peaceful enclosed space.
The village has seen little or no intensive development in modern times and still retains its traditional atmosphere with clusters of old stone cottages set in a cleft of the cliff and descending to a delightful small harbour that’s still used by local fisherman with the catch now consisting of crabs and lobsters.
A cherished family home, full of character and history replete with stable doors, wooden sash-cord windows, engineered oak flooring, wooden ceiling beams and multi-fuel burner sitting on a slate hearth; it has the versatility to be a large family home or a bed and breakfast. A true rarity to the market where internal viewing is absolutely essential. For sale for the first time in 160 years, a delightful stone-fronted Cornish cottage. PHILIP MARTIN 9 Cathedral Lane, Truro TR1 2QS www.philip-martin.co.uksales@philip-martin.co.uk242244
01872
CORFINGLE CORFINGLE OFFERS OVER: £725,000 Newquay St IvesPenzance St AustellBodmin Rock Cornwall CORNWALLPROPERTYPORTLOELIVING|35
INFORMATION Oil-firedFreeholdcentral heating Enclosed rear garden Local bus service EPC E
Local Westwood-FrameFlooringIndependentSpecialistsCarpets15bKilligrewSt,FalmouthMoor,FalmouthTR113PNTel:01326313352www.westwood-frame.co.ukAmticoKarndeanSisal&CoirCrucialTradingRogerOatesUnnaturalFlooringWoodFloorsCustomWindowBlindsAxminstersBrintons Do you own a holiday home within the TR postcode? Looking for a fully registered & reliable local waste and recycling collection service? We offer contracts to suit your needs….we offer ad hoc, monthly, 6 monthly or 12 month Ifcontracts…yourproperty has no guests in then let us know and you do not get charged! (monthly contracts only) • FREE duty of care waste transfer note • FREE waste and recycling bags (terms and conditions apply please see website) • Changeover day collections • We also cover small to medium sized businesses binsawaycornwall@gmail.com or visit www.binsawaycornwall.co.uk We supply everything for Plumbing, Heating and Bathrooms too! Please drop in and pick up our Esteem bathroom brochure available in-store Find us at: Unit 5, Trenant Industrial Estate, Bess Park Road, Wadebridge, PL27 6HB Email: wadebridge@plumbase.com Tel: 01208 815670 PLUMBASE WADEBRIDGE Brand New Luxury 1 & 2 Bedroom Apartments Luxury homes built to a high specification, incorporating energy efficient technologies, designed with stylish interiors and private balconies. Other features include parking, communal gardens, electric car charging points and lift access. Prices starting from £240,000. Please note that the images are CGI and are indicative only. LUXURY LIVING IN LOSTWITHIEL! MARKETED BY For further information, please call 01208 813874 today to find out more! PHASE 2 IS UNDER CONSTRUCTION Early Bird Reservations are being taken, so call today to avoid disappointment.
FARMGorgeousfarmhouseformer
room
ROSCARRACK Sitting with
inglenook Gardensconversionone-bedroomFamilyFive/sixGenerousfireplacekitchenlivingroombedroomsbathroomandshowerroomSelf-containedcottageBarnwithPPfortotwounitsLargehaybarnWorkshop31’x24’6"DoublegarageFormercatteryandgroundsofcirca4.5acresGradeIIlistedCouncilTaxBandE
Set in a peaceful country setting just inland and equidistant from the beaches of Maenporth and Swanpool, Roscarrack Farm comprises a charming former farmhouse with attached cottage, a barn with planning consent for conversion into two units, alongside further barns ideal for storage. There is also the set-up remaining from a former cattery. The main house offers delightful interiors and features, including inglenook fireplaces and stone flooring. The sitting room is utterly relaxing, with views over the rear courtyard, while the kitchen is perfect for entertaining with easy access through to the dining area and living room, as well as out into the gardens. With six bedrooms of flexible accommodation, plus an attached cottage that has been used as a successful holiday let, not to mention the delightful gardens flowing to the paddocks which themselves are perfect for all manner of animals, Roscarrack Farm has plenty to offer a family in need of the room to roam free. With Swanpool beach on the doorstep, this makes for the perfect location for any watersports enthusiast, with activities including swimming, kayaking and of course sailing due to the world class facilities on offer in the area. The nearby South West Coast Path offers miles of spectacular walks for those with a love for the outdoors, and surrounded by countryside on all sides, Roscarrack Farm could be a personal paradise for many. A gorgeous farmhouse with charming accommodation, an attached cottage and barns for conversion, set in around 4.5 acres.
CORNWALLPROPERTYFALMOUTHLIVING|37 INFORMATION Newquay St IvesPenzance St AustellBodmin Rock Cornwall ROSCARRACK FARM GUIDE PRICE £1.6M ROHRS & ROWE 01872 info@rohrsandrowe.co.ukwww.rohrsandrowe.co.uk306360
GOT TO EXPERIENCE 38 | CORNWALL LIVING HavingExperienceGottoenjoyedtheirfirstsummerinWadebridge,Melanieandtheteam at WOW have quickly made a name for themselves, carefully curating the most beautifully made, contemporary and vibrant wares and accessories for the home and garden, always with an eye on design and sustainability. New for late summer and as we head into autumn, you’ll find recycled glass lamps and coastal inspired dining and kitchenware, alongside a unique range of nature-inspired, laser-cut artworks from A Blackbird Sang, perfect for hanging indoors or out. Add to these a selection of natural home fragrances, skincare, and a gift section boasting a range of vegan luggage, and you may be surprised to learn that the items displayed in-store are but a sample of what Wow can offer. This means that even if you can’t find it on the shelves, you need only speak to the team – they’ll be more than happy to help source the items you have in your mind’s eye! WOW 41 Molesworth Street, Wadebridge PL27 7DH 01208 hello@wowwadebridge.co.uk640412 Find more like this: www.cornwall-living.co.uk A WARM WELCOME AT WOW WADEBRIDGE
GOT TOCORNWALLEXPERIENCELIVING | 39
Established by experienced Managing Director Chris Menear, the company was instilled with a set of core beliefs that inform all of their work at every stage. By focusing on sustainability, efficiency, value, effectiveness, drive and diligence, Cornwall Planning Group have been able to successfully collaborate with clients across a variety of sectors, both in-county and across the greater South West. Throughout the years, they have established an extensive range of executive clients such as housing developers, private builders, commercial retailers and even the National Trust, who have all been exceptionally happy with the attention to detail and passion that was poured into the project. Ultimately, the group’s process is informed by their rich history, their staff and their clients. They take great pride in providing a comprehensive service from start to finish - initial planning, to appraisals, master planning, administration, applications, all the way to final delivery. It’s this bespoke service and ambition to excel in every project they take on that has resulted in the highly esteemed practice they run today. 01736 448500 office@cornwallplanninggroup.co.uk “Their professionalism, knowledge and ability to problem solve is unrivalled. I don’t hesitate to recommend them to my clients.” Mr C Clifford of Savills, Cornwall
Westcountry eco-specialists for Owners, Renters & Landlords NO BENEFITS; NO PROBLEM * Terms & conditions apply www.Grants4homeimprovements.co.uk03450618888 Fully funded wall, loft and cavity insulation Fully funded HHR & ASHP heating Fully funded solar & more
| www.cornwallplanninggroup.co.uk
In association with Cornwall Planning Group is a planning-lead architectural firm with headquarters based in Hayle, Cornwall. The company prides themselves on holding a clear focus, drive and passion for producing exquisite builds across the country. Since 2014, the group have built their reputation as a firm that delivers ambitious yet practical designs of the highest standard.
ARCHITECTURAL | PLANNING | BUILDING REGULATIONS | RENEWABLE ENERGY
|
A
lthough a national brand, Andrew Cook and his team at Just Shutters pride themselves on being a local company. Based in Newquay you can expect excellent customer service across the peninsula, both for residential home owners and those in the holiday letting market. With the adoption and acceptance of online meetings, after the recent pandemic, nondomicile owners can utilise Zoom or Facetime hook-ups to engage with the company, negating the need to be on-site when choosing the right blinds or shutters. The whole process becomes very streamlined and stress free with some placements achievable within a two-to-three-hour window – a boon on changeover days.
Besides being relatively easy to install shutters have also shaken off their purely functional, minimalist genesis. The number of different designs and materials available has exploded over the years, allowing you to match them with the over-arching theme of your interiors. Essentially each one can be as bespoke as you want it to be, and of course made to measure. Whilst they might, in some instances, be the more expensive option, their versatility means they provide better value than curtains or blinds. If privacy, light control, efficiency and durability are important to you, there is no better window dressing option. In terms of use, window shutters can be set to be partially open which allows the required light into the room whilst simultaneously reducing the impact of full sun on fabrics such as furniture and carpets. A recent study proved that shutters reduce heat loss more than blinds and curtains – a big plus as we move toward a more sustainable future. Hence, they can help maintain a desired room temperature and ultimately reduce your heating bills. In colder weather, louvres should be fully closed so that your room retains more heat. So, there is no doubt they meet all the criteria for a practical window covering and when you change your colour scheme you won’t have to change your window covering.
CORNWALLHOMELIVING | 41
JUST SHUTTERS 01637 808397 | 07957 Findwww.justshutters.co.uk281802morelikethis:www.cornwall-living.co.uk Transform your home with bespoke shutters from a company leading the way in Cornish window coverings. ABOVE Beautifully bespoke to fit the shape of your home THE WORLDA window on BELOW Making the most of your space
A gorgeous old farm building turned five-star holiday rental at the hands of iroka.
A beautiful timber staircase, designed by the team, has been finished using flush stair nosings to keep the look as minimalist and seam-free as possible, while the feature slat wall certainly makes an impact to the downstairs living area, offering an architectural feature to provide natural light which runs up through the staircase. Bespoke carpentry has been integrated throughout; fixtures and fittings like the stunning oak acupanel wood cladding system in the dining area is in keeping with the Nordic feel, which is reflected in subtle details throughout the property.
é ABOVE A fresh layout by the expert eye of iroka
Possibly our favourite room in The Granary, the cosy living room is the essence of Hygge, a defining characteristic of Danish culture
INTERIORSIconic
With a reputation for a keen eye when it comes to innovative, fresh interiors, it comes as no surprise that iroka were the top choice for Boskensoe Barns when the time came for an overhaul. As part of a collection of five stunning barn conversions – including The Stable, Long House, Pig House and The Mill – The Granary was the final addition to the enchanting group of luxury holiday rentals, touched by the expert hands of iroka.
A custom kitchen and utility was also designed in-house, and features a matt black longline handle, contrasting wonderfully against a light driftwood-style slab door. Integrated LED strip lighting was installed along with a full-height Caesarstone splash back and worktop with streaks of grey vein, finished with draining grooves, while the cabinetry was produced by German manufacturers AGKU and installed by their dedicated, specially selected and highly skilled trades and craftsmen.
Wanting to combine the heritage of the buildings with a modern and contemporary look, each barn was individually styled by iroka, incorporating their history and identity. Features like exposed beams are in keeping with the rustic feel of the farm, while Scandinavian and Japandi inspired interiors add a modern, natural and luxurious touch, with a comprehensive range of finishes handpicked by the iroka’s Hayle-based interior design team.
HOME 42 | CORNWALL LIVING
It’s certainly clear that every detail has been taken into consideration by the design team at iroka, from the floors and doors to the handles and hinges. Every piece of furniture finds purpose in its rightful place, and nothing has been overlooked when it comes to this enchanting five-star holiday rental, which is lying in wait for you to book your next stay with Sykes Cottages. For all things interior, iroka have a wealth of information and services available via their showrooms, so make sure to get in touch with the experts of the industry.
which draws on the feeling of comfortable conviviality that brings with it a feeling of calm contentment. One particular highlight of the room is the wood burning stove feature wall, designed by the iroka team and thoroughly thought out, incorporating a slate split face tile chimney breast, slate hearth, bespoke oak shelving, lined log store, modern inset wood burning stove and finished with a handless, stone-top storage unit and accent slatted wall panelling. A natural colour palette of deep forest green and stone greys from Ecru is accentuated nicely with paint colours from Little Greene, and the study area features wall cladding for an added texture against Little Greene’s shade of ‘Livid’.
IROKA01736757333studio@iroka.comwww.iroka.comFindmorelikethis:
Restful tones of rich greens and earthy rust notes layered with textures of matt cotton velvets and linens bring a restful, calm feeling into the bedrooms, very much in keeping with the farm setting. Light wood furniture fitted and installed by the in-house delivery team complement the stunning A-frame beams that crown the master bedroom, while handmade curtains and roman blinds dress the windows throughout the property in neutral, simplistic fabrics, hung by iroka’s in-store specialist.
Comfort and durability line the floors in the form of quality carpeting, something which iroka pride themselves on with department specialists on hand in their Hayle showroom primed to advise on the perfect flooring.
Let’s not forget the striking contemporary bathrooms, adorned with rich, dark herringbone tiles against the statement oval-shaped freestanding bath, while the contrasting brushed brassware finishes off the look with a high-end finish, and the over-sized walk-in shower provides a luxurious addition amidst the neutral base of the light grey porcelain stone tiles.
www.cornwall-living.co.uk CORNWALLHOMELIVING | 43 é ABOVE contemporaryComfortably é ABOVE TheofessenceHygge
We are the cornish experts Britannia Lanes of Cornwall have a dedicated team to assist you in planning and moving your personal effects from one home to another. We have a wealth of experience. Please don’t hesitate to contact me at mark.lane@britannialanes.co.uk or by calling my team on 01872 560147. We are here to help. www.britannialanes.co.uk Video Surveys Available
ALFRED SMITH & SON 31 Clarence Street, Penzance TR18 2NX Findwww.alfred-smith.co.uk01736enquiries@alfred-smith.co.uk363134morelikethis:www.cornwall-living.co.uk
DISCOVEREXPERIENCEMORE
Standard showroom opening hours are Tuesday to Saturday 9am to 5pm, with bookable out-of-hours appointments also available.
Alfred Smith & Son certainly delivers on both counts. One brand that caught our eye was Rest Assured, which has 122 years of bed-making expertise to its name, offering handcrafted, pocket-sprung mattresses with natural fibres and sustainable materials for a sound sleep.
CORNWALLHOMELIVING | 45
As a ‘Premier Stockist’ of Rest Assured beds, Alfred Smith & Son is able to offer a 60-night comfort guarantee, giving peace of mind on what can be a substantial investment, and the range features a variety of mattresses depending on your needs. The Wool Collection features British Wool which naturally regulates your temperature for a comfortable sleeping environment in all seasons. Wool helps to remove pollutants and allergens from the air for a cleaner and healthier sleep, every night. The gentle cushioning and support in The Latex Collection, with its pressure relieving properties, is especially beneficial for sleepers with back and joint pain. It features a durable and responsive blended natural latex comfort layer resulting in an undisturbed and restful night. For an advanced breathable sleep system, The Refresh Collection channels moisture away from the body to prevent you from overheating, creating the ideal conditions for deep, fresh and restorative slumber. The right mattress is an investment in your health and wellbeing, providing you with the support and comfort you need to sleep well, every night. Rest Assured works hard to have a positive impact not only on your sleep, but also on our planet. The mattresses are handmade in Britain, come with the allergy UK seal of approval and are foam and FR chemical free. So, if your mattress has seen better days and you want to make restless nights a thing of the past, we recommend a visit to Alfred Smith & Son very soon.
ABOVE Investing in your health and wellbeing
A s you walk around Alfred Smith & Son, Penzance, the first thing that strikes you is its enormity, with an extensive bed showroom of over 40 mattresses on display. Undeniably one of the most important purchases that anyone can make for their home, it’s imperative that when buying a mattress there is a wide choice available and that knowledgeable staff are on hand to guide you through the buying process.
We’ve found one of the most comprehensive range of mattresses, divans and bedsteads on display in Cornwall, so you’re assured of a good night’s sleep.
TIGHTSleep READ DID YOU KNOW? Alfred Smith & Son also stocks mattresses, divans and bedsteads from leading brands such as Relyon, Harrison Spinks, Hypnos and Tempur.
Founded in 2004, Oltco has over 18 years’ experience as a leading flooring specialist for the domestic and commercial markets. With a passion for innovation and a desire to offer superior products, it is a Cornish business with national reach, dedicated to delivering solutions tailored to each client’s specific requirements. The creation of two unique outdoor flooring solutions, Recycle Bound and Recycle Base, has transformed driveways, patios, footpaths and balconies, terraces, courtyards and beer gardens across Cornwall, the wider UK and Channel Islands.
HOME 46 | CORNWALL LIVING
GROWTHSustainable BELOW A Recycle Boundoutsidepracticalityaddssurfacebothstyleandtoanyarea
With its 50th franchise launch in sight, the UK's and Channel Islands' leading sustainable resin bound driveway specialist, Oltco, is laying the foundations for an exciting year ahead.
S ustainability is something very much at the forefront of Oltco’s business ethos.
If you’ve not heard of these groundbreaking products, we urge you to read on as they really are leading the way when it comes to putting sustainable flooring under your feet. Recycle Bound was developed in-house by Oltco’s team of technical experts and is a world first with the waste plastic used being obtained from a dedicated plastic recycling point and including plastic drink bottles, food packaging and straws. Combining this recycled waste plastic with a mixture of stone and aggregates creates a product which is low maintenance, has both longevity and durability, and also looks beautiful.
ABOVE é Left to right, Johnny Pearce and Tom Stringer
CORNWALLHOMELIVING | 47
Low-grade plastic is difficult to recycle and is often incinerated, releasing CO2 into the atmosphere. Oltco, however, has managed to create a ground reinforcement system which utilises stone mixed with this low-grade plastic, with the added benefit of also including waste ocean plastic. Recycle Base, as it is known, uses a grid made from 100% recycled plastic and has a load bearing capability of up to 800 tonnes per square metre. An average 70m2 driveway using Recycle Base could offset as much as a tonne of CO2, or the equivalent of planting six trees! Recycle Bound is then laid over the top resulting in a surface fit for both purpose and the planet. Such is the popularity of Oltco products, the business has now recycled the equivalent of over 200 million plastic straws in Recycle Bound transformations across the UK and Channel Islands, and has this year alone launched ten new franchises. The summer of 2022 has been an incredibly busy one for the team as they have installed some stunning outdoor transformations, and the versatility of the product means that it’s not just patios and driveways that have received the Oltco treatment. A glorious raised seating area at a property in Port Isaac benefitted from the smooth surface and marvellous anti-slip properties of Recycle Bound. What’s more, as the surface is permeable it means there are no annoying or unsightly puddles to dealWithwith.a20-year guarantee and a choice of colour blends and patterns, it’s no wonder that so many home and business owners are opting for this versatile product. If you’re unsure if this could be the flooring for you, the Oltco team is always on-hand to listen to your requirements in order to recommend the best option for your property. From the initial planning stage through to installation they will guide you through each stage of the project, ensuring that the finished product exceeds expectations. Such growth this year has seen two new members of the team join Oltco’s head office in Newquay; Tegen Mitchelmore as Franchise Account Manager, and Jess Pollard as Social Media Content Manager. Tegen will be onhand to support Oltco’s growing franchise network, while Jess will be capturing engaging content on-site, sharing it across Oltco’s social media platforms. Jess will also be liaising with each of Oltco’s franchisees to ensure that all of their platforms are kept up to date. As a skilled photographer and videographer, she will be perfectly placed to offer Oltco’s network the visual content they need to showcase their exciting work. Oltco Directors Tom Stringer and Johnny Pearce are immensely proud to continue to be growing both their team and their franchise network ahead of a busy 2023.
OLTCO LTD The Feel Good Building, 13 Pargolla Road, Newquay TR7 1RP 01637 Findwww.oltco.co.ukinfo@oltco.co.uk839000morelikethis: www.cornwall-living.co.uk
MAKE
he rising cost of energy bills and the impact on the environment means we all want to keep our consumption to a minimum. One of the best ways to achieve this is to choose
T
Traditional Door Styles
Your front door is the entrance to your home and says so much about you, so why compromise? AN
These are designed to replicate the most popular timber doors with highly defined mouldings and realistic wood-grain embossing on the surface. Whether used in a Victorian home, a modern townhouse or a cottage, these doors add to the appearance of any home. And with a 10-year guarantee, the woodgrain finish was developed from oak tree grain. You’ll also find the same woodgrain effect and moulding design on the slim glazing cassette, giving a seamless and authentic finish.
48 | CORNWALL LIVING
Things have changed from the traditional pushy salesman to a modern way of pricing with smart technology that can be used to visualise how a new door could look on your home, so customers can see before they buy.
Contemporary Door Styles
Rodda & Hocking have many happy customers in the local area who have come back to them time and again over the years. Get in touch today for your free no-obligation quote and see how a new door might look on your home. Or why not visit the showroom for your free quote? The team also specialise in conservatory roof replacements, so be sure to visit the website to find out more.
thermally efficient products which will keep warmth in and cold out, saving money and emission levels.
A selection of stunning styles with a range of carefully selected decorative glass options that enhance the look and feel of the door whilst maintaining the clean good looks.
RODDA & HOCKING College Street, Camborne TR14 7LE 01209 Findwww.conservatoriesincornwall.com718002morelikethis:www.cornwall-living.co.uk
ENTR ANC E PhotographySkinsRichard HOME
At Rodda & Hocking, the team’s cuttingedge composite doors not only look great and offer superior security locking, but deliver the highest energy-efficient performance levels, too. They offer doors in a variety of glazing configurations, so whether you are looking for high levels of light, a more private environment or you want to replicate an existing door, they have the style to suit you.
01637 860322 www.theparkcornwall.com Your home away from home! Cornwall’s exclusive award winning holiday village. Just a stone’s throw away from Mawgan Porth beach, complete with numerous play areas, an indoor and outdoor pool, holiday fun activities, resident chickens and not forgetting our friendly goats. Each of the properties is unique with a variety of luxury lodges, some with private hot tubs, cottages, superior caravans, park cabins and our yurt village is just magical. Essentially, there is something to cater for every taste. Our Restaurant – The Kitchen by The Beach just the place for yummy locally sourced food. Inspiring better holidays... EXPLORE CORNISH COTTAGES FOREVERCORNWALL.CO.UK • 01326 567838
ABOVE
HOME 50 | CORNWALL LIVING
TOPICHot
Electric fires have always traditionally been thought of as an inefficient way of heating your home, but with the trend for a cleaner way to heat your property, alongside the versatility an electric fire provides, many manufacturers are now placing more importance on the energy efficiency of these products than ever before. The rise in the popularity of electric heating means that the consumer has a much wider variety of products to choose from. Electric fires will convert 100% of the energy used into heat with very little wastage. Almost every penny spent on electricity is converted into heat for your home and, with the introduction of LED lighting and thermostatic controls, electric fireplaces only use the energy needed to keep the room at the temperature you desire. In addition to this efficiency, unlike other types of fires such as wood-burning or gas, electric fires don’t produce a real flame which means they don’t omit any nasty by-products such as smoke or waste gases, making them much better for the environment. Further benefits are that you can have heat at the touch of a button, installation is easy with little disruption, maintenance is minimal and you don’t need to have a flue or a chimney; all of which makes an electric fireplace or heating system a solid energy efficient investment for your home. We get some advice from the experts on how to heat your home in the most efficient way possible. The Eden Hearth & heatinghasshowroomHomedifferentoptionsateveryturn
E nergy use is on the tip of everyone’s tongue at the moment and rising fuel prices have become a household topic.
In light of this, we got in touch with the experts at Eden Heath & Home, who have over 21 years of expertise in the fireplace and heating industry. You might think that due to the recent hike in electricity prices, with more forecast later this year, that this form of heating wouldn’t be the best choice. However, here are some myth-busting facts about the use of electric fires versus gas and solid fuel which might just be a pleasant surprise!
Heating is one aspect of your electricity bill which often costs the most but with the right radiators and electric heating system in place you could actually be reducing your bills. At Eden Hearth & Home you will find a fantastic range of electric fires, fireplaces and heating products on display including energy efficient electric radiators that are a great replacement for old and ugly storage heaters. The Electrorad range of radiators come in various sizes and heat outputs, with one to suit every room in the house. They also have the bonus of WiFi or digital controls making each radiator independent in the home. Having the Wi-Fi option gives you greater flexibility and offers much more control over the energy usage and temperature requirements and can be controlled from your smart phone or tablet, wherever you are. Gone are the worries of burst pipes in a cold snap if you’re away and there’s no need to come back to a cold house in the evening; simply turn up the heat using the remote features and your home will be toasty on your return. From the latest trendy media walls to high efficiency heaters or a showpiece electric stove, Eden Hearth & Home has an amazing range of fires and fireplaces on display for you to see.
EDEN HEARTH & HOME Unit 6, Goonhavern Garden Centre TR4 9QQ 01872 Findwww.fireplacecornwall.cominfo@fireplacecornwall.com572303morelikethis:www.cornwall-living.co.uk
CORNWALLHOMELIVING | 51 ABOVE Make statementa with an woodburnerelectric ABOVE radiatorsElectricareeasytofitandcontrol
The team have a wealth of knowledge and can advise on all aspects of your heating needs so, if you are not sure how to keep your home warm and toasty this winter then why not pay a visit to their showroom in Goonhavern? Here you can meet with one of the team who can talk you though your options and you can see the products up close. Eden Hearth & Home is also offering free surveys during September and October; a great reason to get in touch and book an appointment with one of their professionals and to get your home winter-ready.
Coastal ESCAPES STAY
Wyvern House, Bude
Beautiful stays in Bude, Port Isaac and Fowey. Our choice of Cornish coastal getaways
Living areas are capacious; ideal for groups of friends or extended families to come together. Bedrooms are havens of calm, some with views across to the sea and all except one has anTheen-suite.proximity to Crooklets Beach, which you’ll find just 500 yards from the property, makes this the seaside holiday home that dreams are made of. Inspiration has been taken from the ocean surroundings and used to create interiors with more than a nod to the nautical. High ceilings and the retention of character features make this a residence of distinction just waiting to be discovered. There is plenty of outdoor dining space and to the side of the house is a safe place to store surf boards and bikes. An outdoor hose also means that wetsuits can be rinsed off, hung up and readied for the next day, and with your own hot tub, you can soak away all your cares in the privacy of the garden.
Built in 1900, Wyvern House is a beautiful and imposing gentleman’s residence in this much-sought-after holiday destination on the north Cornish coast. Lovingly refurbished from top to bottom with nautical-inspired interiors, the property maintains the original charm and character that make this home unique.
01288 www.elitewestholidays.co.uk354470
52 | CORNWALL LIVING
Sleeping up to five guests, and with so many amenities on offer to provide comfort and convenience, this really is the perfect cosy place to stay. The clear waters in the harbour with bobbing fishing boats makes a picturesque place to spend your evenings or days watching the world go by. Through a maze of narrow streets, you may also find ‘Squeezy Belly Alley’, or take a fishing or scenic trip around the coast during the summer months. Sandy beaches, with large waves ideal for surfing or some gentler boogie boarding, are only a short drive away with some allowing dogs all year round. 01208 www.thecornishholidaycompany.co.uk814497
Lundy Cottage, Port Isaac Lundy Cottage is a beautiful threebedroom stone cottage in Port Isaac’s ancient fishing village. You will find Lundy Cottage tucked away in the heart of the village, making for the perfect retreat for families or couple wishing to explore Port Isaac and the surrounding areas. Why not enjoy a glass of wine in front of the open fireplace, or gather around the kitchen’s central island while cooking and entertaining your friends or family?
Lamellyon Roundhouse, Fowey Situated in the middle of beautiful unspoilt rolling fields with superb coastal walks nearby giving access to secluded coves and beaches, the Roundhouse was formerly a working annexe to the main barn (next door) and now offers comfortable and cosy accommodation for two. Approached down a 300-metre unmade drive, the cottage is entered from the sheltered sunny patio through French windows which open directly into the light and airy living room. The ground floor is open plan and tiled throughout with a spacious sitting area with television, and benefiting from a feature fireplace with log effect electric fire and two large south facing windows providing wonderful views over the open, lawned gardens and countryside beyond.
There is a sofa bed for alternative sleeping arrangements, a dining area, fitted kitchen, bathroom with hand basin and shower over the bath and separate W.C. An attractive wooden staircase leads up to the mezzanine bedroom, with a king size double bed and is crowned, as is the living room, by the original timber beams and braces. The surrounding grassy garden is fenced off from the farmland but guests with pets are requested to supervise them at all times.
CORNWALL LIVING | 53 STAY
01208 www.corncott.com895354
BUDE MAERVIEW For some, Cornwall is a tourist destination; perhaps a beach or specific beauty spot to take the perfect picture. For the Cornish, however, this beautiful, rugged, charming landscape runs deep through their blood. It is home in every sense of the word. Burrington Estates will pay tribute to this tradition by building a new collection of 30 sustainable, and energy efficient luxury four-bedroom homes in the heart of its northernmost town. For further details, or to book an appointment, email maer.view@burringtonestates.com or call on 01872 890033. LUXURY SUSTAINABLETRADITIONALHOMES.VALUES.LIVING. Call 01872 890033 to book an appointment. Marketing Suite open 7-days a week, call The Teal *Images (CGIs) are intended only for illustrative purposes and are subject to interpretation. Actual finishes, details and any landscaping may vary from plot to plot. www.burringtonestates.com
Media Partners SPONSORED BY HOME IMPROVEMENT & SELF BUILD SHOW The Ultimate Lifestyle By The Sea Inside We welcome you to join us for the 9th Cornwall Home Improvement & Self Build Show GROUND UPFrom the RENEWABLEGARDENSHEALTHHEATING 66 INTERIORS • KITCHENS • HOT TUBS • GARDEN • RENEWABLES HEATING • FLOORING • FURNITURE • SELF BUILD • AND MORE 63 Cornwall 65
SPONSORED BY Taking place on SATURDAY 1ST AND SUNDAY 2ND OCTOBER , you can get fast-track, reduced-price entry via the website for just £8. £10 on the door. B k your tickets! We invite you to join us for the 9th Cornwall HOME IMPROVEMENT & SELF BUILD SHOW book tickets & get info CORNWALLSELFBUILDSHOW.CO.UK
THE SHOW? Welcome to Cornwall
HOME IMPROVEMENT & SELF BUILD SHOW
Secure your tickets at: www.cornwallselfbuildshow.co.ukMANAGINGDIRECTORAndrewWeaver For exhibitor or media enquiries,
CORNWALL LIVING | 57
entry
hello@cornwallhomeshow.co.ukemail SHOW FOUNDER 58 Your home, your way Introducing this year’s show 60 Floor plan Find what you’re looking for 61 Exhibitor list Who’s at the show 63 The natural solution From Kernow Springs 67 The gift of glass With Kestrel Specialist Handrail Systems Contents Sponsored by Media SupportedSponsoredPartnerbycharity DIVEPROJECTCORNWALL Education I Environment I Experience
Welcome to the 9th annual Cornwall Home Improvement & Self Build Show! This year the show is back with a bang and a huge range of exhibitors primed and ready to help you with your next project. For those out there who haven’t before been to this superb show, it brings together the region’s best interior, garden, renewable and self-build products all under one roof. Taking place at the Royal Cornwall Event Centre in Wadebridge, not only does it make a wonderful day out for everyone, it’s a must if you’re looking for sound professional advice on how to best move your project forward, from experts across multiple disciplines who really are the ‘best in business’.
Share yourstories @CORNWALLLIVINGUK#HOMEIMPROVEMENT
SO, WHY VISIT
The food and drink market, ‘A Bite of Cornwall’, provides the chance to eat, drink and read brochures at your leisure as you contemplate the wealth of advice you’ve been offered by the experts around you. Whether you’re updating a tired home interior, embarking on your first renovation project, contemplating making the switch to renewable energy, or building your dream house from the ground up, this premier Cornish event – proudly sponsored by Kettle Co – has all the inspiration you need to bring your vision to life. ON THE COVER This stunning kitchen image was supplied by the experts at Kettle Co. – headline sponsors of this year’s show. If you’re hoping to upgrade your kitchen, be sure to pop by their stand!
and services,
Taking place on 1st and 2nd October. Get fast track reduced price via the website for only £8pp (under 18s free). £10 on the door. call 01872 888733 or
Book
Saturday 1st (10am to 4.30pm) and Sunday 2nd October (10am to 4pm) at the Royal Cornwall Showground, Wadebridge your
tickets
ABOVE Receive 58expertsfromadvicetheintheindustry|CORNWALL LIVING HOME IMPROVEMENT & SELF BUILD SHOW
H osting stands from over 120 of the region’s finest home and lifestyle businesses, this year’s Home Improvement & Self Build Show is sure to offer everything you could possibly need for your next project, and with an extensive array of local architects, designers and suppliers to discuss your thoughts with, you can be confident in taking your first step towards your ultimate home-improvement or self-build goal. Whether you’re looking to start fresh from the ground up, re-imagine your outside spaces, or you’re looking for a little inspiration and advice from an expert, here is the perfect opportunity to find exactly what you’re looking for. With many of us on a mission to get our homes just the way we want them, Cornwall’s premier Home Improvement & Self Build Show has everything you need to make your dreams a reality. YOUR WAYYour home,
INTERIORS Kitchens, bespoke cookers, flooring, flooring, blinds furniture and more. HOME IMPROVEMENT & SELF BUILD Windows and roofing, smart home timber eco fabrication, balustrades, builders, ICF, construction, more.
and curtains,
home
WATCH NOW TICKETS!
GARDENS Garden furniture, hot tubs, design, landscaping and more.
CORNWALL
Findwww.cornwallselfbuildshow.co.ukhello@cornwallhomeshow.co.uk01872WadebridgeThe&IMPROVEMENTHOMESELFBUILDSHOWRoyalCornwallShowground,PL277JE888733morelikethis:www.cornwall-living.co.uk CORNWALL LIVING | 59
theexpectyoualong?ofThinkingcomingIfso,cantofindfollowing:
joinery, doors, stairs, stoves and
thermal
worktops, tiles,
trade services, plumbing and
BOOK YOUR
framing, joinery,
RENEWABLES Solar PV, solar ground and air source heat pumps, battery storage and more.
‘A BITE OF CORNWALL’ FOOD & DRINK MARKET & CAFÉ Sample and take home some of the finest local artisan food and drink, including: local gins, preserves, honey, spices, chocolate, deli foods, food boxes and more, as well as fresh, quality catering onsite and a licensed bar.
technology, woodburners,
advisors,
HOMEWARE MARKET Art, glassware, rugs, cushions, blankets and throws, ceramics, furniture, kitchenware and more.
PROFESSIONAL SERVICES Architecture, planning, surveying, mortgage lenders, utilities, financial VAT Reclaim, holiday and and more.
building, heating systems,
bathrooms, bedrooms,
conservatories,
domestic letting agents
Thinking of heading to this year’s Home Improvement & Self Build Show? Head to the website below and check out the video from the last show, giving you an insight into everything you can expect at this fantastic Cornish event.
Taking place on 1st and 2nd October. Get fast track reduced price entry via the website for only £8pp (under 18s free). £10 on the door. Secure your tickets at: www.cornwallselfbuildshow.co.uk
TOwww.cornwallselfbuildshow.co.ukBOOK,VISIT
MAIN ENTRANCE OrganiseReceptionr’s Office 1 2 5 10 22 6 7 8 1 1 12 13 14 15 CL 39 37 38 43 4044 45 73 75 72 74 76 41 42 46 47 48 49 50 51 78 79 81 80 6970 7 717 16 17 29 30 33 63 64 66 32 36 67 65 68 31 34 35 9 23 24 26 27 3 4 18 19 20 21 SR2 SR1 SR4 SR6 SR3 SR5 FD1 FD2 FD3 FD4 FD5 HM1 HM2 HM3 HM4 HM5 82 FD 1 3 FD 1 2 FD 1 4 FD 1 5 FD 1 6 FD 1 7 FD 6 FD 7 FD 8 FD 1 1 FD 9 FD 1 0 H M 6 H M 7 H M 8 H M 9 H M1 0 H M 1 1 H M1 3 H M1 2 H M1 4 5662 57 58 59 60 61 25 28 52 53 54 55 SR8 SR 1 1 SR9 SR12 SR13 H M1 5 SR14 SR7 SR10 V 3 V 1 V4V 2 Recycling HALLSEXHIBITIONINDOOR INDOOR EXHIBITION AREA PARKING PARKING PARKING G12 G12 G2 G9 G8 G3 G1G4 G10 G7 V7 V8 V2V5V6 V3 V4 G6Taking place on 1st and 2nd October. Get fast track reduced price entry via the website for only £8pp (under 18s free). £10 on the door. Secure your tickets www.cornwallselfbuildshow.co.ukat: Book your tickets changeto*Subject Sponsored by HOME IMPROVEMENT & SELF BUILD SHOW 60 | CORNWALL LIVING
EXHIBITOR LIST Details accurate at time of print. To see the full and updated exhibitor list and for more information please visit www.cornwallselfbuildshow.co.uk KETTLE CO. KITCHENS AMICA SMART HOMES A & K ARCHITECTURAL SERVICES ARBORAFWMFARM AR CARPETS & RUGS BLACK ROCK BONSAI TREES BLACK UNDERFLOOR BLUE FLAME HEATING SOLUTIONS CARBON SAVING GROUP CORNISH COTTAGE HOLIDAYS CORNISH HOT TUBS CORNISH TRADITIONAL COTTAGES CORNWALL GARAGE DOOR CENTRE CORNWALL HEATING CONTRACTORS CORNWALL HIDEAWAYS CORNWALL ZINC C-TECCREATECOTTAGES.COMROOFINGDESIGNSWSOUTHWESTEASYBATHROOMSECOPLUGLTD EPS PLUMBING HEATING & GREEN ENERGY ERCLE ARCHITECTS EXE KESTRELHORIZONHARVESTGREENGENUKMORTGAGESCORNWALLHEBASKHOMESHOMEIMPROVEMENTSJCHBESPOKESURFACEDESIGNJWDMORTGAGESKERNOWSPRINGSKERNOWSTONESPECIALISTHANDRAILSYSTEMSLANGLEAVESTREESURGERYLAURENCEASSOCIATESLLAWNROCFURNITUREMDARBYELECTRICALSERVICESMIKEFREEARCHITECTURALDESIGN MOR TRIPLETHESOUTHPYGMALIONPROTECOCEANINTERIORSTEAKINSULATIONANDFUNCKROZENWORKSHOPSAILSHADESDIRECTSAVILLSSMARTERECOWESTHEATINGSOLUTIONSSOUTHWESTVENTILATIONSUNSETSHUTTERSLTDCORNWALLKITCHENCOMPANYTHEFELLPARTNERSHIPTIMBERFRAMEDESIGN&BUILDTIMBERCUBETOADHALLCOTTAGESCORNWALLTOTALAIRQUALITYXTRADING(DRILLALLDRILLBITS)UTILITYWAREHOUSEVARCURNMARBLEVOYAGERHOUSESWADEBRIDGEBATHROOMSTUDIOWADEBRIDGEKITCHENSWILSONFINKWOODSHOPDIRECTZLCENERGY FROM INTERIORS AND SELF-BUILD TO GARDENS AND CORNISH FOOD, HERE ARE SOME OF THE FANTASTIC BUSINESSES YOU CAN EXPECT TO FIND AT THE SHOW DON’T MISS OUT! With a host of exclusive special offers – deals only available at the show – this seasonal event is one you certainly don’t want to miss! CORNWALL LIVING | 61 FOOD AND DRINK MARKET CAFÉ BRING ME PADSTOWFALMOUTHCORNICOBUTTERNUTBUBBLESBOXCOFFEECO.BLACKROCKGINFLAMEANDDOUGHFLAPJACKERYGLASTONBURYCHEESECHEESECOMPANYREDROBINPANTRYROCKGINTHEMELTINGPOTKITCHEN MORE TO BE ANNOUNCED INTERIORS POTSNPANSNIKOEDENDANNICROWNALLCRAPMARKETOAKFURNITUREBRADFORDSTUDIODRMARTINRASKOVSKYGARDENEQUIPMENTFIONACANTSTUDIOIKIRUARTSKELSEYCORNISHBROWNFUSEDGLASSNO1BRANDEDCOOKWARERESINARTREVIVEPOWERPASTESEEDHOMEDESIGNSTHESHOAL HOME IMPROVEMENT & SELF BUILD SHOW
Callwww.southwestheatingsolutions.co.ukinfo@southwestheatingsolutions.co.ukuson: 01209 714 600 GERMAN Manufacturing Excellence 25 YEAR GUARANTEE At the core of our heating 4 YEARS FREE Repair Cover Your radiators are miles better. Clearly built and finished to a higher standard and that is most definitely reflected in far superior performance. Mrs Campbell, Tregony Be warm, when you want Say hello to efficient & sustainable electric heating Time to make a change Installed by a Which? Trusted trader, ELKAtherm® electric radiators from South West Heating are the perfect solution for homes looking to future proof themselves against 100%afossilexpensiveincreasinglyandpollutivefuels.Simplychooseproviderthatguaranteesrenewableenergy! ELKAtherm ® ELKAtherm radiators provide a simple, efficient and controllable way to heat your home Sunampsustainably.HeatBatteries are the most compact thermal storage technology available on the market today, saving space in your home and delivering cascades of hot water.
For centuries, different cultures around the world have recognised the many benefits associated with soaking in a traditional wooden hot tub. The Greeks, the Romans and the Japanese regard it as a ritual – an act of comforting the body and nourishing the soul. With the woodfired hot tubs of Kernow Springs, the occasional whiff of smoke and the crackle of the fire is a comforting reminder that the water in your hot tub is being heated by burning carbon neutral ‘coppiced’ wood – no electricity, no pumps, 100% natural and 100% sustainable. Now in collaboration with Water and Stone, to which Kernow Springs supply their beautifully crafted wild spas, it is easier than ever to experience your very own taste of outdoor luxury. Kernow Springs’ wood-fired wild spas are an idyllic off-grid solution that come free of any surprise energy bills, and installation is a breeze. Using his extensive knowledge and experience, Martin is leading the way in the industry of wood-fired hot tubs here in the south west. To find out more, be sure to visit the team on their stand at the Cornwall Home Improvement & Self Build Show, on 1st and 2nd October. KERNOW SPRINGS Trevisker Garden Centre, Padstow PL28 8LD 07779 374017 | Findwww.kernowsprings.co.ukinfo@kernowsprings.co.ukmorelikethis:www.cornwall-living.co.uk For a sustainable luxury wild spa experience, Kernow Springs’ hot tubs are an eco-choice that will nourish body and soul. READ DID YOU KNOW? The Eco Garden Pod design used for the outdoor saunas can also be used in a multitude of other ways, from outside office spaces to garden rooms.
C ornwall-based, former boat builder and father of two, Martin Dean, built a couple of wood-fired hot tubs for his garden after sampling their relaxing delights whilst on a family vacation. His beautiful back yard creations garnered much interest and as word spread demand for Martin’s hot tubs increased to the point he was able to launch his own company, Kernow Springs. Now a thriving business, Martin and his team build and supply eco-friendly wood-fired hot tubs across the south west. Many of us are choosing a greener lifestyle, becoming more conscious of ways we can reduce our environmental impact.
THE NATURAL Solution
Purchases and lifestyle habits affect the environment, and it’s important that we spend time evaluating the eco-friendly and sustainability aspects of the products we buy. Combine this with the rising energy bills of recent months and it’s no wonder that any dreams of a traditional hot tub may feel further from reach than ever. However, Kernow Springs has something in store that might have you re-considering giving up on your luxury dream.
HOME IMPROVEMENT & SELF BUILD CORNWALLSHOWLIVING | 63
EST. 1964 A local agency Holidaywithcottages throughout Cornwall... aspirations big Whether you’re after a dog-friendly break, beachside cottage or luxury family home, we’re sure we have the ideal escape for you. Choose from over 900 coastal, waterside and rural cottages throughout the South West. Call us now for free and honest advice. T:www.toadhallcottages.co.uk08006101122
CORNWALL LIVING | 65 H aving an outdoor area at home that’s close to nature and away from the madding crowd, can provide us with a much-needed sanctuary in which to relax and recharge. This is the founding principle behind Sail Shades Direct, that is, creating bespoke, beautiful shelters that enable home improvers to add a luxury finishing touch to their outside space.
SAIL SHADES DIRECT
Indeed, more people than ever are hoping to create a year-round space at home, which Sail Shades Direct has seen first-hand. Having been involved in an array of exclusive projects, from those looking to build a luxury outdoor kitchen, to clients simply elevating their garden to incorporate a comfortable seating area, Sail Shades are made to order, and can be produced and installed to suit a variety of spaces, be it a canopy to protect the designated barbeque chef – surely the MVP of any summer soiree – or a means of creating a shady seating area in an otherwise exposed garden. They are an investment in your future enjoyment of the outdoors, and when you consider that the team have access to some of the finest fabrics and structural materials on the market, each shade is genuinely made to last.
Providing a luxury, made-to-measure solution to anybody hoping to bring their dream garden to life.
HOME IMPROVEM ENT & SELF BUILD SHOW
It could be that you need a retractable system that can be easily and safely dismantled during high winds, in which case, Sail Shades have you covered.
The Sail Loft, Ferry Street, Torpoint PL11 2AX 01752 Findwww.sailshadesdirect.co.uk816125morelikethis:www.cornwall-living.co.uk
Alternatively, you might want to install a permanent pergola in a more sheltered spot to bring that stunning interior feel you’ve worked so hard to achieve, outdoors. Again, look no further. Whatever it is that you have in your mind’s eye, when it comes to fabrics, all of Sail Shades’ materials are carefully curated for their quality and longevity. They source them from a list of specialised suppliers from around the world who can provide the correct, technical fabric to suit each and every project, from small sails to provide shade in your garden, to large, waterproof solutions for large family gatherings and even events. Put simply, if you’ve decided to invest in your own outdoor space – and therefore in your own future enjoyment of it – Sail Shades Direct can, and will, find a bespoke solution to suit you. To find out more and to get your project underway, be sure to contact the team and see how they can help.
OUTDOORSMake a great
UnitGREENGENUKACoberHouse,Wheal Vrose Business Park, Helston TR13 0FG 01326 Findwww.greengenuk.comenquiry@greengenuk.com564513morelikethis:www.cornwall-living.co.uk With winter just around the bend, ways in which we can tackle the ever-increasing energy bills have never been more necessary.
out more about the Boiler Upgrade Scheme (BUS) and exactly how much money you could claim, visit www.greengenuk.com or www.ofgem.gov.uk
EFFICIENCY Effortless HOME IMPROVEMENT & SELF BUILD SHOW 66 | CORNWALL LIVING DISCOVEREXPERIENCEMORE...
A s the days begin to grow colder as we venture into autumn, now is the perfect time to get your new, renewable heating system installed, running and ready for the winter. As such, there has never been a better time to buy an air source heat pump. Much has been made of what's going on with electricity prices, but gas prices have already quadrupled and will be increasing again. Heating oil prices are in excess of £1 per litre – meaning homes heated by oil are looking at a bill in excess of £1,000 to fill up their oil tanks. Whichever way you look at it, heating prices are going up and installing an environmentally-friendly, energy-efficient heating system is the best way forward. Air source heat pumps run off electricity and convert heat stored within the air to supply our home's heating and hot water. As a result, they can output more than four times the energy they consume, making them highly efficient! As they work at low temperatures over longer periods of time, living in a home heated by a heat pump is noticeably friendlier. Maintaining your property's temperature means a home never feels too hot or too cold. As well as these benefits, the government is currently offering a £5,000 contribution towards the installation of an air source heat pump system. The Boiler Upgrade Scheme, or BUS, provides £5,000 towards the upfront costs of an installation. Offsetting nearly half of the total installation costs, meaning a home can convert to renewable heating for a similar cost to installing a replacement gas or oil boiler. With the heating season just around the corner and the inevitable rush on heating installation, get ahead of the game and install an air source heating system with GreenGenUK.
ABOVE Getting ahead of the game with air source heating To find
Find moments of peace in privacy without compromising on quality, functionality and stunning designs. ABOVE Privacy glass screens are an excellent addition where both light and privacy are key INSET Sectioned handrails using different thicknesses of glass and a similar post design to allow both to work together gift
Kestrel Specialist Handrail Systems are a small, family-run business that have all the knowledge and expertise to bring a functional quality to your home. Kestrel installs balustrades, Juliet balconies and privacy screens using 316 grade mirror polished stainless-steel posts and handrails, which are particularly suited to coastal areas, and when combined with opaque glass create a personal environment with excellent weather protection. The versatility of using glass as a privacy screen means that you can create everything from a sheltered, private balcony to a full-height wind break. Or, if you are looking to create a low-level, secluded seating area, the use of satin glass means you get the benefit of privacy, while still being able to enjoy the view when moving around. There is also the option of using a combination of privacy and clear glass panels in different areas depending on what you want to obscure.
Recently, Kestrel worked with a customer and the carpenter that created a beautiful decking area to decide together on the best design for retaining their astonishing view and the functionality of the space. Using a 316 marine grade stainless steel with a high mirror polish to withstand the Cornish elements, and bearing safety in mind, the design used a handrail with toughened glass and also a toughened laminated glass without a handrail to achieve an uninterrupted view on the main deck. In order to accommodate the different glass thicknesses whilst still offering design continuity, the team were able to use a similar post design and glass clamp shape for a flawless finish. With a bit of innovation and determination, it seems that Kestrel are prepared for all sorts of circumstances and requirements when it comes to your outside space. KESTREL UnitsHANDRAILSPECIALISTSYSTEMS1&2ManfieldWay,Holmbush Industrial Estate, St Austell PL25 3HQ 01726 338086 | Findwww.kestrelshs.co.uksales@kestrelshs.co.ukmorelikethis:www.cornwall-living.co.uk
CORNWALL LIVING | 67 HOME IMPROVEMENT & SELF BUILD SHOW
OF GLASSThe
I n recent times, our outside spaces have meant a lot more to us, with many of us spending more time outside than ever. In an effort to truly make the most of these spaces, and with things like safety and privacy held in mind, glass balustrades are becoming increasingly popular. Stunningly sleek in design and truly innovative when it comes to installation,
CORNISH HOLIDAYS With a locally-based team of experts, plus a full property management service, holiday letting with us has never been easier. Contact our owner team today: Call | 01326 331173 (Option 2) Email | enquiry@cornishcottageholidays.co.uk Visit | cornishcottageholidays.co.uk/letyourcottage Cornwall’s holiday cottage experts for over 50 years Sea the View (Ref. 1044483) Sennen Cove
he idea to make gin was conjured up after a throw away remark: "You like gin, so why not make it?" As Angie and George continued walking their dog on Rock beach, little did they realise what that simple comment had put in motion. All they had to do was come up with a really good gin.
Next came the production of our first 1,000 litre distillation – very scary, but once bottled and released, they too were very well received. The adventure had begun and really became an unstoppable force.” It wasn’t long after that a fashion began to emerge for ‘instant’ cocktails in the home market, which is when Angie and George began to devise a series of rums to add to their repertoire. Five years later, and Cornish Rock Gin has eight gins and eight rums in its portfolio!
CORNISH ROCK GIN Penvose Cottage, Atlantic Highway, Nr Rock PL30 3NP 01208 Findwww.rockgincornish.cominfo@rockgincornish.com851718RockGinCornwallmorelikethis:www.cornwall-living.co.uk A walk along a beautiful Cornish beach and a spirit of distinction was born.
Simple, right?
Although not strictly a cocktail, their Rock Blue Angel Gin simply served with ice and tonic would be acceptable in any cocktail bar. Their Rock Mellow Yellow Gin, meanwhile, makes the perfect dry martini – just mix chilled dry vermouth with a shot of Rock Mellow and stir with an olive on a stick. Another gin cocktail they’ve devised was for the opening night of Hillary Bonners' play Dead Lies. To make the ‘Dead Lies’ cocktail, add a shot of Rock Cherry Kiss gin with a shot of Campari and top up with Fever Tree raspberry and rose petal soda. As for rum cocktails, their Coconut Paradise Cornish Rum makes the perfect piña colada. Then there’s the Tropics Mango & Passionfruit Cornish Rum, which makes the most amazing Porn Star Martini! Alternatively, if you’re after the best ever espresso martini, grab some White Espresso Cornish Rum and their Golden Vanilla Cornish Rum topped with espresso coffee – very special. Many more cocktails are set to emerge from the Cornish Rock Distillery, so be sure to keep an eye on the website and follow them on social media.
CORNWALL LIVING | 69
T
Angie and George take up the story: “The beginning was the hardest part, when producing the gin to a recipe was only an idea. Initially we produced 25 bottles just to test out on friends and family. After a big thumbs up and with great excitement we produced 500 bottles and, having sold them, we’d stumbled upon a market eager for more.
OF DELIGHTS A cocktail HOME IMPROVEMENT & SELF BUILD SHOW
A collection of some of the best holiday homes on the North Cornish Coast. We’re looking to expand our profile for 2023. Let your holiday home with Shore Stays for a bespoke, full service solution to bring you peace of mind. Trust the local experts! 07432 202884 hello@shorestays.co.uk@shore_stays_cornwall@shorestays Guests • Amazing locations across the Cornish Coast • A personal booking service from start to finish • Complimentary welcome basket on arrival • Welcome folder full of holiday ideas Owners • Personal approach to you and your guests • Unlimited homeowner stays • Commission as low as 10% • Based in Cornwall t: 01208 814 497 e: thecornishholidaycompany@gmail.com w: thecornishholidaycompany.co.uk Making Your Cornish Holiday Memorable CL126--PCV29--AD--Cornish Holiday--0.5.indd 1 17/08/2022 16:51
Heading to Devon or Cornwall? Then experience a Richardson Hotel break.
ABOVE Standing apart from the rest
Bag a late SUMMER STAYCATION
RICHARDSON HOTELS 0800 005 Findwww.richardsonhotels.co.ukreservations@richardsonhotels.co.uk2244morelikethis:www.cornwall-living.co.uk
A re you looking for a luxury stay by the beach but with something special added to your southwest break? Well, at a Richardson Hotel you’ll find a selection of special offers tailored specially to meet your requirements. Each hotel has lifted the bar this summer when it comes to providing new experiences for the holiday maker – unbeatable prices, awardwinning food and of course spectacular views of Devon and Cornwall beaches. These are just a few of the inducements that set this small chain of hotels apart from the rest.
Depending upon your choice of destination, you can choose from the Grand Hotel or Abbey Sands Hotel in Torquay, the Royal Beacon Hotel in Exmouth or the Falmouth Hotel in Falmouth. All four are perfect for short escapes where you’ll find plenty of space to relax and unwind. It’s where traditional luxury combines with cosy sea-facing bedrooms that have en-suite bathrooms, all of which are elegantly themed with individually styled mural art. Three of the four hotels have facilities that offer you the opportunity to stay in shape while you’re away, via a special unlimited membership access package. Wind down and relax to the sounds of the sea and soak up the holiday atmosphere in one of the large heated pools, next to the beach, or work out in the gym. The choice is yours. Not far from all of the hotels are an abundance of beaches as well as a variety of local attractions and opportunities to have fun – such as the English Riviera Walking Festival in October in Torquay; or the quirky 18th-century, 16-sided house with fascinating interior decoration and collections near Exmouth, and of course the National Maritime Museum in Falmouth. Each hotel is situated at the hub of one of these fantastic resorts, so why not check out their website for latest offers and get down to the west country now that the summer hordes have departed.
STAY CORNWALL LIVING | 71
Experience a late summer stay, lunch, dinner or drinks at the Fowey Harbour Hotel. BELOW Enjoying the freshest of seafood with an ocean backdrop
CUISINECoastal READ DID YOU KNOW? This vibrantly restored Victorian boutique hotel is an idyllic Cornish wedding venue for your ceremony, breakfast and reception as well as offering meeting rooms and event spaces just steps from the beach.
DISCOVEREXPERIENCEMORE For room details and offers, sample menus or to book a table visit the Fowey Harbour Hotel website.
STAY 72 | CORNWALL LIVING T he swallows might be thinking of packing their bags but we are still making the most of this glorious summer. If you’re looking for a place to enjoy some fabulous food and drink as we head into September, we recommend a trip to Fowey Harbour Hotel. Whether it’s lunch, afternoon tea or dinner expect a great menu in lovely contemporary surroundings – when the weather’s kind lunch outside on the terrace is a real treat. You might even feel like you have earned some special pampering after a busy summer, so why not stay for a day or two? The hotel rooms are delightful and will allow you to grab some precious relaxation time, sipping on a complimentary gin and tonic in your room while planning your evening or indeed the next day’s adventure. Any stay is made special by the attentive hotel team and the finest of food comes courtesy of Head Chef,MarkMark.hasbeen at the helm of the kitchen at the Fowey Harbour Hotel for over 20 years, guiding the team through some significant changes during that time, not least recently becoming part of Harbour Hotels. Striking a new balance, Mark cooks really good food served in a relaxed brasserie setting. From core company dishes, which you can enjoy across all of Harbour’s coastal hotels in Devon and Cornwall, to his own daily specials, Mark maximises on long-standing relationships with local suppliers to bring the finest of ingredients to the table. Mark is committed to buying local, using the highest quality produce he can and food at its freshest. With supporting the local region and economy in mind, why not take a stroll around Fowey where you will find a plethora of independent shops, boutiques and galleries – the town even has its own Gin Shop and Tasting Room courtesy of local distillers, Tarquin’s. Or for those that prefer to be on the water, take a cruise on a luxury motorboat from Fowey Maritime Centre and enjoy one of the hotel’s luxury picnics moored up in the calm waters of Lantic Bay. FOWEY HARBOUR HOTEL Fowey Harbour Hotel, Esplanade, Fowey PL23 1HX 01726 Findwww.harbourhotels.co.uk/fowey832551morelikethis:www.cornwall-living.co.uk
We see wheneververyOrFancylooking…youaholidayinCornwall?evenbetter,relaxinyourownholidayhome,youlike! St IvesNewquayBay Bay Bude Newperran Retallack Resort & SpaiFveCornwall locations Investment properties available at Retallack Resort & Spa With 7%*Fixedreturn*rate Scan me! awayresorts.co.uk*The Away Resorts investment product offers a fixed return of 7% over a choice of 3 or 5 years available at Retallack Resort & Spa. This product is only available to qualifying investors. Terms and conditions apply.
live! performances:20-24septembertrebahgarden.co.uk/tempest 01736trebahgarden.co.uktickets810181 CL126--PCV29--AD--Trebah Garden--0.25.indd 1 19/07/2022 11:25
To eat at the hotel is to go on a sensory journey. The evening starts in the bar, where appetites are whetted with a pre-dinner tipple and intricately crafted canapés. All of this, before moving through to the restaurant where the amuse-bouche sets the tone for the hotel’s modern take on classic British dishes.
TALLAND BAY HOTEL Porthallow, Looe PL13 2JB 01503 Findwww.tallandbayhotel.co.uk272667morelikethis:www.cornwall-living.co.uk
Away from the crowds, in a quiet nook, you’ll find this timeless jewel. ABOVE John Dory with curry oil, toasted cauliflowermacadamia,andchicory INSET Goat's cheese and aubergine tortellini
ining at Talland Bay Hotel is a must for anyone visiting or living in Cornwall that loves their food.
CORNWALLFOODIELIVING | 75
D
The experience is nothing short of a show-stopping culinary adventure, with many different components and performers contributing to the final dishes that appear on your plate, from the fishermen in Looe and the neighbouring farmer, to the wild mushroom forager and Cornish cheese makers. Not to mention the hours of toil committed by Head Chef Glen Merriott and the team in the kitchen.
The menus change to reflect the seasons and spoils of the surrounding countryside and sea. Seasonal highlights for starters might include a heritage tomato salad with gazpacho and a crunchy sesame cracker, or John Dory with fragrant curry oil, toasted macadamia, cauliflower and bittersweet chicory. For the main event, Glen cites the melt in the mouth fillet of beef with beer-braised beef cheek amongst his favourite dishes. And while the menu is unashamedly heavy on meat and fish, when it turns to vegetarian options, it does so with no less aplomb. There is also the regularly changing specials menu, which works to the mantra ‘when they’re gone, they’re gone.’
FOODIE GEM
A hidden
EXPERIENCE If you want to enjoy the dining experience at its very best, says Head Chef Glen: “Add a wine flight!”
The dessert menu is where the young pastry chef Alisha gets to shine, carefully pairing palette-pleasing sorbets with a delicate strawberry mille-feuille or a black forest dark chocolate delice. Alternatively, cheese-lovers can opt to take a taste tour around the county via Bude, Redruth, Padstow and the Helford. What is abundantly clear is that a good deal of love has gone into the execution of every dish. That such a small team can turn out such exquisite fare is a delightful surprise, one that simply has to be enjoyed first-hand to be believed.
“This is a great restaurant! The views are fantastic watching the Cornish sunset. The meals are very tasty and suitable for children and adults alike…” Review from Trip Advisor LUNCH • DINNER • SEAFOOD • BAR 01208 862333 • www.thecrackingcrab.com HigherCORNWALLPolzeathTristramPL276TD GLORIOUSFANTASTICVIEWSSUNSETS WOOD FIRED • WELLBEING • EXPERIENCE With wellness at the core of sauna culture we have created an authentic experience by the Cornish sea. A LITTLE OASIS BY THE SEA saunasbythesea | www.saunasbythesea.co.uk RECHARGERELAX,&REFRESH SCAN ME TO BOOK
CORNWALLFOODIELIVING | 77
TRAVELLERS REST Trevarrian Hill, Newquay TR8 4AQ 01637 Findwww.travellersrestcornwall.co.uk861633morelikethis:www.cornwall-living.co.uk A warm welcome awaits you at Travellers Rest, a place to rest, refuel and relax in natural surroundings. ABOVE Authentic, fresh local ingredients to delight in
Alongside the pub, Travellers Rest has a selection of luxury glamping pods, some of which are pet friendly, and all with incredible views of the north Cornish coastline. The pods offer home-from-home comfort as they are all double glazed with underfloor heating, a kitchenette and a bathroom with shower, with the added bonus of being immersed in incredible natural surroundings. The site benefits from a delightful wildlife pond, where you can expect to see dragonflies circling or young starlings being taught how to scoop up water in their beaks as they fly over the pond.
I
f you are looking for a traditional warm and welcoming experience, then we’ve found just that at Traveller’s Rest. Offering a relaxed Cornish pub with onsite glamping, the team take great pride in their friendly and informal approach to dining. The food is authentic and uses fresh local ingredients wherever possible, including a fresh fish of the day caught and landed within the county wherever possible. Great care is taken in preparing and producing their own unique versions of great pub classics; for example a rich and hearty steak and ale pie with slow cooked tender beef. Head Chef Becky Thorbes is vegan, so is experienced in creating dishes that can be adapted to various dietary requirements including gluten free, vegetarian and, of course, vegan options. “The ingredients are the highlight of any dish and ensuring that we do them justice by cooking them well and partnering them with complementary herbs and spices is of the upmost importance to us,” says SustainabilityBecky.is also high on the agenda at The Travellers Rest, with plans in place to evolve their practices and futureproof the business by 2025. “We have been exploring the use of wind and solar to supply the pub with energy as well as removing any equipment requiring fossil fuels,” says owner Martin Watts. “We have also addressed our supply chain to ensure we are minimising our impact on the environment by using suppliers who meet our high standards. We have introduced an allotment and poultry keeping in a community outdoor space and will shortly be involving local primary schools in the use of these facilities as an educational tool for teaching next generations the importance of caring for the land we share with nature.”
REPEAT
Eat, sleep,
FOODIE 78 | CORNWALL LIVING
Hugh, who already had experience supplying a top regional restaurant during the 14 years he spent working in France, was inspired to do the same for Kota. “For Jude, we make plates with a ‘wave’ theme to the edges, in blue-green. We also create
Working with Hugh West and Karen Carlyon at Tollhouse Pottery, Jude explains: “They now provide all of the crockery for Kota. Before we started collaborating, I was taken aback by their enthusiasm at the prospect of working together, but also by what they can create and have already achieved as high-end potters. They are both super busy, but were nevertheless looking for a new challenge. Luckily for me, that challenge was to work with Kota and ensure our diners were eating off fine crockery that did justice to our food.”
THE TABLE é ABOVE Jude Kereama BELOW Hugh West and Karen Carlyon
Porthleven based chef Jude Kereama delivers flavours with a flourish with help from Tollhouse Pottery.
Thrown for
A couple of issues ago we spoke to Porthleven based chef Jude Kereama, whose collaboration with local artist Maxine Greer has seen the walls of his Porthleven restaurant come to life with colour, interest and creativity. It’s a combination that matches the food that Jude and his team bring to the table of every guest, and serves as proof of the magic that can happen when creatives come together. But it’s not only the restaurant walls on which you’ll find the marks of Jude’s determination to champion local artistry. In fact, while some of us may find ourselves ravenously focused on the food in front of us, the more discerning diners will appreciate the difference that the plate beneath it can make, something that Jude is acutely aware of.
The ethos at Tollhouse Pottery goes hand in hand with that which Jude continues to champion at Kota – being creative and presenting quality ingredients perfectly on fine crockery. “Hugh and Karen are fantastic people to work with and they are just like us in the way they love to create and make people smile with their craft.”
It seems that Hugh and Karen are destined for a busy few months as they continue to bring Jude’s imagination to life. As the chef himself puts it: “What we do in this industry is to try and keep our ideas interesting for our guests and luckily for us, we have Tollhouse Pottery to help keep that fire burning.”
Hugh and Karen also provide open bowls in autumnal colours, deeper bowls in a mushroom shade, as well as plates with chattered and shaded russet rims. “The attention we give to the detail, colour and quality of our handthrown porcelain work complements Jude’s beautiful menus.”
Hugh agrees, adding: “Working with Jude is always a pleasure. We love his cooking and he’s always receptive and complimentary about the pieces we produce for him.”
KOTA & KOTA KAI 01326 Findwww.hughwest.comwww.kotarestaurant.co.uk562407morelikethis:www.cornwall-living.co.uk
straight-sided dishes with chattered outside edges that create texture, and we do these in both white and leaf-green.”
Jude picks up the story. “Our first collection of crockery started with our reopening back in February. I was after a collection that reflected our upcoming seasons, but also the dishes that we serve in the restaurant. Each time a season changes, I talk to Hugh and Karen in advance about the shapes, colours and sizes of crockery we need for the new dishes.”
It’s a tall order, too, especially when you realise that Kota serves a lot of tasting menus, meaning they need crockery for nine courses. “That’s a lot of plates to fire!” says Jude. “It’s been a great challenge for us to get everything just right with what we are trying to create with Kota, and it’s a chef’s dream to have crockery made for you.”
So, what can we expect at Kota now that the leaves are beginning their annual fall? “We are always excited by what each season brings,” says Jude. “Autumn will bring more brown and orange glazes that reflect the ending of the hot summer season and the beginnings of autumn and mushroom season. We’ll start creating warmer dishes to reflect the season, and look at little cups that you can grasp to warm the hands as the weather turns. When the winter arrives, we’ll be creating a menu based on all the dishes I've made over the years on Great British Menu. I’m already imagining the crockery I need for those wintry evenings, and this will be the next project for November and December.”
CORNWALLFOODIELIVING | 79 é ABOVERIGHT& The complementarydifferingyetstylesofHugh(left)andKaren(right) RIGHT Coastal palettes with flourishes of individuality
Briefing them in every detail, including size, colour and texture, it is no small undertaking to create the next season’s crockery for Kota. “The making of the piece takes a long time,” says Hugh. “After the initial meeting comes designing, throwing, firing, a second glaze firing, and experimenting, until we have the colour and form that’s in Jude’s mind. It’s a challenge, but as a pottery, we are continually striving to stretch our skills ever further, producing pots that are not only beautiful, but that instil a wish in the viewer to handle and admire by tactile means. We pay special attention to pleasure in use and in enhancing a room with individual pieces.”
T he Cornish Kitchen is a modernday delicatessen set in the heart of Falmouth, mixing locally sourced groceries, fresh produce, accompaniments, coffee, wine, beer, plantbased milks and more – all relying upon Rebecca and John’s keen curatorial taste and eye before they’re allowed space on the shelves. Nothing is stocked if they don’t love to eat and drink it themselves; everything is sampled, and if the duo doesn’t think it works in terms of quality or provenance, it simply doesn’t make it. Hoping to bring healthy and tasty inspiration to everyday life, along with a little bit of luxury, the deli welcomes all to come in, take a seat and enjoy a dish created from the produce, whether inside or on the patio, with flaky pastries on offer for morning visitors. From freshly baked cakes, to cheeses, aged charcuterie, and even picnic hampers for a day to remember, there’s something for all tastes at The Cornish Kitchen. Come in to do your weekly shop or have a sit down with one of their lovely specialty coffee, teas, gourmet hot chocolates, or treat yourself to a tasting platter, deli sandwich, salad, soup or slice of cake whilst relaxing on the patio or inside in the comfy seating area. And that's not all! Their new website launched at the end of August, giving you the opportunity to order your in-store favourites online. Choose anything, select a basket size, and they’ll do the rest, putting together a hamper-style package that would be perfect for catering events, get-togethers, parties, and of course, Christmas.
Visit a world of victual delight, right in the heart of Falmouth.
FOODIE 80 | CORNWALL LIVING
THE CORNISH KITCHEN 2 Bank Place, Falmouth TR11 4AT 01326 Findwww.thecornishkitchen.cominfo@thecornishkitchen.co.uk617916morelikethis:www.cornwall-living.co.uk
A GREAT TASTEof Cornwall
gfg BOOK NOW HALLFORCORNWALL.CO.UK 01872 262466HALL for CORNWALL TICKETSFROM£15 CLASSICAL CONCERTS CONCERTNEWORCHESTRAOPERANATIONALWELSHPIANORELENTLESSTHEFITKINGRAHAMFAIRLYQUARTETYEAR ORCHESTRASYMPHONYBOURNEMOUTH CLASSICAL SUBSCRIPTION Enjoy 15% off when you book tickets for all three concerts (Bands A-C). SUN 09 OCT WED 11 JAN FRI 04 NOV LOOKFALMOUTHTHAT’Swww.FalmouthHolidayHomes.co.ukWHYYOUSHOULDCHOOSEHOLIDAYHOMESTOAFTERYOURPROPERTY. We Love Falmou�!
FOODIE 82 | CORNWALL LIVING FRUITFULNESSMe llow WATCH DID YOU KNOW? All of the latest offers and deals are released on social media first. Give them a follow for some foodie treats! trevaskisfarmtrevaskis.farm DISCOVEREXPERIENCEMORE Dare we takingtheyourbutchersChristmas…?!mentionTrevaskis’arereadytodiscussfestiverequirementsandrestaurantteamisalreadybookings!
READ DISCOVER MORE With so much on offer on the Trevaskis Farm menu, it’s not easy to choose which quality dish to go for, but we’ve managed to whittle down our favourite choice. Starting with seared scallops with Aja Blanco, grapes and olive oil, the South Devon breed beef short rib with bourguignon sauce and root vegetables was impossible to resist for a main course, and the selection of desserts at the counter is simply mouth-watering!
So, whilst the farm team are in the fields pruning fruit bushes galore in preparation for next year’s growing season, the kitchen and retail teams are ready to welcome diners and shoppers galore to sample everything that's on offer. If you don’t want to miss out on some great foodie deals and produce offers, make sure to keep an eye on Trevaskis’ social media accounts and website to be the first in the know.
As summer produce at Trevaskis Farm comes to an end, the restaurant takes on the foodie baton with some tasty autumn offers.
T he words of John Keats’ poem Ode to Autumn are a fitting tribute to life at Trevaskis Farm. As we head into autumn, the heat of the sun dips away and the farm embraces a calmer Cornish ‘season of mists of mellow fruitfulness’. The fields and polytunnels at Trevaskis Farm head into a more tranquil period during the shoulder months while from now, and on into festive period, the renowned farm eatery gets little chance to slow down. While the hospitality sector in the rest of our county tends to slow in pace at this time of year, the restaurant at the farm actually starts to gear-up, as local customers take advantage of the autumn offers they have come to enjoy soThroughoutmuch.
October and November you’ll find a selection of deals from the farm centred around a fine dining theme across a great value, set menu platform. “We find the excellent price point gives our customers the opportunity to make a real night of it with a bottle of wine (or two!), creating a lively, almost party, feel,” comments owner Giles Eustice. This sort of atmosphere can be hard to find in November in Cornwall’s restaurants, but Trevaskis Farm yet again seems to pull it off in style! The offers are not only limited to the restaurant, as there are always some great prices to be had at The Market, Trevaskis’ wonderfully well-stocked farm shop. Customers can expect to find deals on the sublime offering from the butchery department and its award-winning meat products, including home-reared British Lop pork and finest local South Devon breed beef.
FindShop:Restaurant:hello@trevaskisfarm.co.uk5JQ0120971393101209714009morelikethis:www.cornwall-living.co.uk
é ABOVE Getting ready to Cornishtheembracecalmerseason
TREVASKIS FARM Trevaskis Farm, Connor Downs, Hayle, TR27
Tom enthuses: “We’ve been absolutely blown away by the support our customers have shown CHSW and would like to thank everyone who has donated; the work that this hospice does for our local community is invaluable and we’re honoured to have raised vital funds for the charity.” He goes on: “Cream teas are a great way to keep in touch with old friends, show someone you’re thinking of them or to remember happy times by the coast.”
THE CORNISH COMPANY Unit 3, Indian Queens Trading Estate, St Columb TR9 Findwww.thecornishcompany.comsupport@thecornishcompany.com6TLmorelikethis:www.cornwall-living.co.uk
As a consequence of this laudable stance, The Cornish Company’s most recent Corporate Social Responsibility venture has been to support Children's Hospice South West (CHSW), working in partnership with the charity on its ‘Big South West Cream Tea’ campaign. The aim is to raise as many funds as possible by getting family and friends to enjoy a cream tea, by giving customers the option to add a donation to their order, which is on course to raise £5,000 for the charity by the end of August. Operating throughout Cornwall, Devon and Somerset it provides care for children with life-threatening conditions along with professional family support services. They offer a home-fromhome, where children with life-limiting conditions and their families can take a short break to recharge their batteries in a homely, warm and welcoming environment.
A s a company with obvious vested interests in Cornwall, The Cornish Company likes to keep itself in tune with the community and is constantly asking how it can help local people and businesses. After all, we all have to pull together to make this world a better place, especially if through dint of hard work or luck, fortune has seen fit to place you in a position to exercise your philanthropic function.
The Cornish Company continues to grow since its inception in 2020, but one of its core values – a determination to support the community – will always remain the bedrock of its ethos.
FOODIE
AT A TIMEOne scone CORNWALL LIVING | 83
Proud to acknowledge its roots, The Cornish Company has teamed up with a local charity.
DIDEXPERIENCEYOUKNOW?
At the heart of what they do is great taste and quality. Rob, the distiller works tirelessly to create the best drinks they can by keeping to a simple mantra: “proper spirits made proper.”
A Cornish
COPPERFISH DISTILLERY The Quay, East Looe PL13 01503www.copperfishdistillery.co.uk1DX262327 | 07913 707566 Find more like this: www.cornwall-living.co.uk
Quayside
W hen Copperfish Distillery opened its doors four years ago on Buller Quay in East Looe, the founders were keen to create great tasting, truly authentic Cornish drinks with a plan to grow the business, developing local employment and supporting the local economy. Four years on and the team of Bill, Jemma, Rob and Andy still share that plan, along with their quest of helping to put Looe on the Cornish food and drink map. And why not? There are some truly fabulous restaurants, hotels and producers in the locality, including The Sardine Factory, The Sail Loft, great tapas at The Portbyhan Hotel, fish and chips at The Coddy Shack, along with some of best pasties in the county including Sarah’s, a firm favourite.
craft distillery, making small batch spirits with pride and passion. TIPPLES
Not only does Copperfish distil their own gin and rum, they also make Cornish Moonshine and, if you love the Copperfish logo as much as we do, they’ve got some cool merchandise on offer too!
In essence, this means they don’t cut corners and use the best ingredients and methods they can. Take their rum for example, Copperfish Rum is one of the very few rums actually made from scratch in Cornwall. It starts from creating a wash from sugar cane molasses, which is then fermented before it enters the stills. This rich sweet earthy liquid is then heated gently up towards 80°C when the magic of distillation takes place. A pure white rum comes out of the still which is then poured into oak barrels to age for many months to develop taste and colour. Their great tasting drinks have been recognised by the Taste of the West awards where the team received four golds and three silvers in 2022. So what’s next for Copperfish? The team have taken on an additional premises on the quay that will be developed into a visitor centre where tours, tastings and makings will be open to the public. However, if you can’t wait until Spring 2023 when it’s due to open, why not visit the shop and bar or check out their website for more information.
FOODIE 84 | CORNWALL LIVING
INSET
Katie’s background in art and design has ensured the quirky, intimate spaces in the 18th century building are used to their full potential, adding a contemporary feel to a relaxed and unpretentious environment. Tom and his kitchen team create a dining experience that is sophisticated and creative with a fantastic balance of flavours and textures cleverly constructed to elevate and enhance the best seasonal ingredients. Procurement from passionate local suppliers is at the core of the kitchen ethos and shines through on the menu, from rod and line-caught fish (they are licensed to buy direct from fishermen) to vegetables from a justice-oriented, ecologically supportive and sustainable farm a few miles away. You could be forgiven for assuming it is all about the food at this little gem of a pub, but with one of the best back bar selections to be found in the county it is most definitely a destination for craft spirits, carefully curated cocktails, unconventional wines and award-winning national and local beers. The same ethos to responsible sourcing and sustainability in the food runs right through the pub. From biodynamic wines (Katie is a trained sommelier and curates the wine list around these values whilst creating a list perfectly in sync with Tom’s indulgent food) and local craft beers to locally grown, seasonal flowers on the tables. In spite of such excellence across the board, there is not an ounce of snobbery to be found here. Whether you fancy a refreshing cold pint of Sharps Offshore or an exquisite wine to match every course, the crew are more than happy to share their knowledge and recommend favourite tipples. THE RISING SUN Mitchell Hill, Truro TR1 1ED 01872 Findinfo@therisingsuntruro.co.ukwww.therisingsuntruro.co.uk240003morelikethis:www.cornwall-living.co.uk
Marrying incredible menus with a country pub feel, The Rising Sun has elevated the gastropub to new heights. HIGH Roscoff onion tarte tatin with crispy chicken skin and a jus gras (paired with a glass BELOW Lemon meringue pie and raspberry sorbet
Back in 2014 Tom Hannon realised his dream. Now Chef Patron of The Rising Sun in Truro, Tom, and wife Katie, extend a warm, friendly and genuine welcome (there are no ‘too cool for school’ attitudes here) at this wonderfully unassuming dining destination that has created a loyal foodie following and industry acclaim based on their ethos of inherent and uncompromising quality and attention toHavingdetail. trained alongside Michelin star chefs, Tom’s passion, energy and drive are infectious. His love of classic flavours and precision cooking see him develop menus that guests want to return to again and again.
RISING
CORNWALLGrandeChampagneofKrug,Cuvée)FOODIELIVING | 85 TOP Duck breast pomegranatebonbonsorange-glazedwithcarrots,parmentierpotatoes,goat'scheeseandajus
16 OCT - PLYMOUTH THEATRE ROYAL, 01752 267 222 17-18 OCT - TRURO HALL FOR CORNWALL, 01872 262 466 Half page ad.indd 1 25/07/2022 15:22:19 01736 enquiries@caravanparkcornwall.com762231•www.caravanparkcornwall.com Set in 12 acres of Cornish countryside only two miles from the beautiful sandy beaches of Praa Sands, Boscrege Caravan & Touring Park is the best place to enjoy your Cornish holiday. We also sell luxury homes with a smallhire luxury fleet. Boscrege • Ashton • Cornwall • TR13 9TG BOSCREGE CARAVAN & TOURING PARK CARAVAN & TOURING PARK A wide range of flooring and furnishings, all supplied with individual care and attention. Carpet and Homestore • Unit 3 • Longrock Business Park • Penzance • TR20 8HT 01736 330 279 • www.carpetandhomestore.co.ukinfo@carpetandhomestore.co.uk
Exciting times ahead for the Treguddick Distillery as a new face joins the team.
ARRIVESA master chef TOP LEFT Tom Elson-Knight
Opened in October last year, Treguddick is located just outside of Launceston. In 2019 the barn was transformed into a beautiful and versatile venue, perfect for events, days out and memorable experiences. The captivating distillery tour and tasting experiences are always popular, with a bar stocked with over 40 bottles from English Spirit’s premium range. Not forgetting the restaurant where you can enjoy a unique dining experience. ‘Treguddick’s Epicurean Adventure’, as the venue’s first anniversary event is called, will see a five-course adventure menu that follows the journey of founder and Master Distiller, Dr John. From his first still, commissioned over ten years ago, John realised there was a gap in the market for genuinely high-quality spirits. Suitably galvanised, he set out to bring the methodology of distilling firmly into the 21st century. His creations have won the most prestigious awards at leading international spirit competitions and he is consistently leading innovation in the spirit’s market. In fact, he was first in the UK to distil rum, sambuca and baijiu, and has developed worldleading techniques for extracting flavours and accelerating ageing processes. The adventure evening will see the unveiling of the next venture with the final course! The event takes place on Saturday 5th November, with booking details available on the Treguddick website.
T reguddick Distillery is all about experiences that bring taste, quality and innovation to the table with the best ingredients the south west has to offer. To elevate this stance even further, Tom Elson-Knight will become a member of the team in September. His credentials are impeccable, having appeared in the 2019 series of MasterChef where he made it to the final, followed by appearances at pop-up shows around the UK with Salt Kitchen. Putting his itinerant lifestyle on hold, Tom explains: “Treguddick is an incredible and unique venue with bags of potential, and I am really excited to take the kitchen to the next level. I have already begun working with the team on our first events and I have been delighted to put together a five-course menu for the first anniversary of Treguddick on November 5th.”
CORNWALLFOODIELIVING | 87
TREGUDDICK DISTILLERY Treguddick Manor, Treguddick PL15 7JN 01566 Findwww.treguddick.com/events788310morelikethis:www.cornwall-living.co.uk
sales@mountsbaydistillery.com The Old Factory Workshops, Praa Sands TR20 9RA Golden Rum from Mounts Bay Distillery, with Smoked Manuka & Earl Grey Tea from Tregothnan Estate. Rum & Tea once shared tall ships, now they share a bottle. Mariner’s Rum & Tea Spirit. Mounts Bay Distillery in Cornwall
Mainbrace are changing the way we think about rum by infusing tradition with a fresh modern twist. ABOVE Celebrating courage, teamwork and Innovation BELOW Premium Golden Rum and Always Sunny Cocktail
Run by a father and sons team based out of the Helford passage, the idea for Mainbrace was born when together they watched a team of local gig racers celebrating their win, and a moment of courage, teamwork and friendship inspired a venture into the spirits business to find a way to bottle that feeling.
FOODIEfriendshipBOTTLED
As a family of varied tastes, they wanted to create something that would fit perfectly into a refreshing long drink, a sophisticated cocktail or to be savoured neat. Eventually they’d settle on a unique blend of two distinct and never-before bottled styles to produce a smooth, perfectly balanced golden rum with no additives, sourced from Guyana and Martinique. This splicing of two rums got them thinking, and, knowing the phrase of “Splice the Mainbrace”, they thought it perfectly encapsulated the product and spirit of the rum, and we couldn’t agree more.
By working with smaller, local brands the team hope to alter the perception of drinking rum to one of sophistication, introducing the thought of rum in a simple cocktail or with a delicious mixer like ginger ale or tonic, with an added slice of orange of extra flavour. With the perception of drinking premium rum in a simple way so as to not ruin the quality spirit in mind, Mainbrace’s favourite cocktail is the Always Sunny, an easy cocktail to make at home. Just add plenty of ice into a high ball glass, followed by 50 ml of Mainbrace Premium Golden Run, 25 ml of fresh orange juice, and then top up with ginger ale. Garnish with an orange wedge and you will have the perfect drink to bring sunshine into your life, no matter where you are! The rich and natural flavours with notes of dried fruits, spices, apple and toffee, Mainbrace is also wonderful savoured neat for those experienced rum and whisky drinkers.
With the rise of new gins and rums, naturally an increase in new and innovative mixers has followed, which can only mean exciting and creative opportunities for brands like Mainbrace, who recently collaborated with small mixer brands like Navas Drinks, a local premium Cornish mixer, and Sekforde Drinks.
CORNWALL LIVING | 89
Findhello@mainbracerum.com01326MAINBRACE735026morelikethis:www.cornwall-living.co.uk
Inspire Makers is for the creatively curious, celebrating the handmade and encouraging well-being and community through making.
No.29 No.5 FALMOUTH FOCUS 90 | CORNWALL LIVING
Located towards the top of the historic old High Street, opposite a glorious view to the river down Barracks Ope, it is a creative space showcasing the talent of over 50 small Cornish, creative businesses. Offering affordable, contemporary design-led work, you will find a carefully curated selection of original paintings, limited-edition prints, ceramics, glass, jewellery, stationery and textiles.
Inspire Makers
There is also a gallery area with a full programme of local artist exhibitions, and a workshop calendar with a range of creative classes that might inspire you to take up making yourself.
Welcome to
F almouth has long-since been known for its world-class sailing waters and is a port of maritime significance being the third largest natural harbour in the world and the deepest in Europe. Alongside its sea-faring traditions, Falmouth has also become well-loved over recent years for its boutique shopping and thriving café culture and in particular its eclectic High Street which makes its way from the Prince of Wales Pier at the bottom, winding uphill to the Star and Garter Inn at its zenith. Here you will find a heady mix of shops, cafés, bars and restaurants, the likes of which you won’t find on any traditional high street. The sellers and makers here are unique and each brings a vibrancy and buzz to this area of the town. Expect to find the finest of handcrafted gifts and carefully curated treasures you won’t be able to
Cornish Curtains Cornish Curtains takes a more personal approach to choosing your home fabrics than most other establishments purporting to do so. Head inside the store at 29 High Street, Falmouth, and you’ll find they have one of Cornwall’s largest selection of fabrics for all your needs. With the dominance of online shopping, many of us find ourselves missing out on the personal service that can guide us to make the right choices. Here you will receive individual attention and advice from their expert team, who will take you through the selection process. Whether it be the most suitable fabric, made-to-measure curtains, roman blinds, tracks, poles or the style for your room. They also offer a cushion, upholstery and fitting service.
www.inspiremakers.comcreate@inspiremakers.com
FALMOUTHresist!
TimGreenCCBY2.0
Call 07912 280888 to find out more.
Walk with us over the cobbles to explore Falmouth’s famed High Street.
www.cornishcurtains.comenquiries@cornishcurtains.com
Located in the historic Old Brewery Yard, just off the High Street, lies The Chintz & Underland. Climb the stairs to Chintz, enter through door 69 and let the adventure begin… From hidden rooms, dinosaurs come popping out of walls, and cows appear on the ceiling! This specialist, unconventional cocktail bar specialises in wines, cheeses, cocktails, wise debates, music and awesome parties, offering a cornucopia of delights to fuel a night you won’t forget for a long time… until the next time! If you fancy a boogie then head downstairs to Underland where you can watch some of the finest bands and DJs from across the UK. The party starts early and finishes late, so bring your dancing shoes, some friends and plenty of energy. thechintzbar@gmail.com | 07538006495
www.greylurcherfalmouth.com | 01326 618240
A trip to Ludgate House Antiques is an absolute must for anyone visiting Falmouth’s historic Old High Street. Owners Ralph and Nicki Retallack can be found in the 17th century merchant’s house which houses the shop, fronting the high street and inviting passers-by to take a peek into the treasure filled window. Specialising in decorative antiques, Ralph and Nicki source unique pieces with a particular passion for elegant furniture dating from the 17th through to the 20th century. You’ll be met with friendly assistance and advice on period interior, and if you haven’t come across the item you’ve been looking for, the helpful team will be able to advise you on sourcing that wishlist item. ludgatehouseantiques@gmail.comwww.ludgatehouseantiques.com
FALMOUTHCORNWALLFOCUSLIVING | 91
The team have renovated the shop interiors and courtyards, built a website (still a work in progress) and through all of that they’ve sold and used gallons of one of their key products – the iconic Annie Sloan Chalk Paint. They were selected as stockists early on, and it has steadily become one of their bestsellers. They’re happy to help with colour choices, finishes and anything paint related, with customers ranging from professionals to weekend upcyclers. Along with paint you’ll find brushes, waxes and varnishes, along with the very inspiring Annie Sloan magazines and books.
Found on the beautiful Old High Street, Mirri Damer’s showroom and workshop is the perfect place to see her range of unique, sculptural designs and one-off creations. Inspired by the surrounding textures and mood of the Cornish landscape, Mirri’s work is hand made from 100% recycled or Fairtrade gold and silver. The subtle palette of ethical precious gemstones reflects the ever-changing colours of our beautiful Popcoastline.into browse or make an appointment to discuss modern re-designs of heirloom pieces and private commissions. www.mirridamer.commirridamer No.8
Chintz Bar and Underland
Mirri Damer
Ludgate House Antiques
The Grey Lurcher
Five years and counting – it seems like only yesterday that Grey Lurcher opened its lifestyle shop on the High Street in Falmouth. They’ve made it through Brexit and Lockdown, all with a relocation in between. What a journey it’s been!
NNo.20o.51a
31MAXARIChurchStreet,
Softly READ DID YOU KNOW? With two stores here in Cornwall, one in Falmouth and another in Padstow, Maxari is the place to go if you want to add some colour to your life. Alternatively, if you can’t make it in-store, simply head to the new website and have your order delivered straight to your door! BELOW Inject some colour into your wardrobe this winter with a statement knit OFFER DISCOVER MORE This voucher entitles Cornwall Living readers to £20 off any purchase of £60 or more, excluding sale items. Voucher until 31st December 2022.
A fter featuring Maxari in a previous edition of Cornwall Living, we were drawn to their vibrant stock and the carefully-chosen designs and so were keen to catch up with them again to discover more about their AW2022 collection. Run by husband-and-wife team Mike and Vicky, who opened their first store in Salcombe and now have five shops across Devon and Cornwall, Maxari’s collection is sourced from the finest French fashion houses alongside their own in-house brand. We spoke with Vicky to find out more. We have noticed many fashion boutiques move to a more muted palette for autumn/ winter, but not so at Maxari: “I feel that colour is so important for these seasons,” says Vicky, “as it brightens up those dull days and women often feel happier when wearing colour. We love the sumptuous and warm feel of a cosy knit. So, what can we expect when it comes to styling this winter? “We really feel that oversized is back,” says Vicky, “alongside a batwing sleeve which can be very flattering. We also love plain jumpers with a slight twist, such as a colourful button, detailing on the sleeve or a subtle rainbow somewhere. When you’ve fallen in love with a knitwear piece it’s important that you know how to care for it. Hand washing is key and your knit will also benefit from a specialist washing liquid that will help to protect both the colour and the fibre. It’s also a good idea to invest in a cashmere comb to remove any unsightly bobbles. I love wearing one of our knits with my favourite pair of jeans, boots and a bright beanie hat – the perfect outfit for a Cornish beach walk, whatever the weather!” Falmouth TR11 3EQ 28 Duke Street, Padstow PL28 8AB Find As we say farewell to summer, cosy knits in bright colours are the perfect way to ward off the winter blues.
LIFESTYLE 92 | CORNWALL LIVING
more like this: www.cornwall-living.co.uk
READER
valid
SPUN
enquiries@maxari.co.uk | www.maxari.co.uk
Multi-award-winning farm shop and restaurant. Open 7 days a week for breakfast, lunch and afternoon tea Cornish through and through – our fully stocked farm shop showcases our very own Landue beef, lamb and honey and only the finest Cornish produce. Boasting a wine cave, delicatessen, butchery counter and an ample homeware and gifts section, Tre Pol & Pen is not to be missed. Regular Cornish Makers Markets showcasing Cornish Craft. Coming up – outdoor cinema nights, circus skills workshops, murder mystery evenings, falconry displays, craft workshops, Mad Dog Mcrea. MORE THAN JUST A FARM SHOP LEZANT | CORNWALL | PL15 9NN 01566706527 | WWW.TREPOLANDPEN.CO.UK All events are listed on the website. The Thirstea Co | Porth Farm Cafe | St Anthony Portscatho | Truro | TR2 5EX 01872 580773 | info@thethirsteacompany.co.uk@thethirsteaco Opened in 2020 our converted stable barn sits just 100yds above the beautiful Towan beach on the Roseland Peninsula, we offer a range of hot and cold light lunches, and a small breakfast menu during the winter season. Our focus is local, nearly everything on the menu is either homemade from local ingredients or sourced from Cornish suppliers, Cornwall has such quality to offer it’s a joy to pass on to our customers. 8&KINChiMyghtern Arthur ǀ Plen Tennyson Nansledan ǀ Newquay ǀ TR8 4SE @andkinshop
JEWELLERYSILVERORIGINS.COMBOUTIQUESSTIVES|MARAZION Cornwall's largest independent clothing store. Celebrating 100 years. 31-32 River Street, Truro 01872 273313 | trevails.co.uk
F or the summer collection, Ayr Space has applied minimal print detail against relaxed silhouettes, using contrasting tones inspired by the shallow sandy waters, white walled cottages and warm nights spent in St. Ives. The series is made up of standalone pieces that quickly become day-to-day wear once the temperatures start to soar. “We saw the 2022 season as the perfect platform to reintroduce ourselves; to express who we are and what we are about. Summertime in St Ives and Cornwall can be a little insane, so we wanted to reflect a more subdued, laid-back approach in our new series,” explains owner, Dan Chater.
Combing coastal elements with modernstreetwear and graphic work inspired by spaceflight and cinema, Ayr Space produce high-quality pieces in small runs, avoiding the mass-production side of the fashion industry.
Dan continues: “I began working on a design during the early months of the pandemic; something that could represent all of Cornwall and Scilly. Many towns and villages were rocked with the sudden loss of loved ones and key pillars of their communities. Jobs were lost and many businesses relying on tourism had to shut their doors leaving families struggling, all while house prices soared along with the overall cost of living. Once the country had begun to open up again in limited capacity, surviving businesses, particularly hospitality found themselves at breaking point with limited staff and supply chain delays – yet everyone just kept going and pushing on!”
FROM SEA
ABOVE Minimal prints against silhouettesrelaxed to stars
His design represents a community of people like no other that even in the darkest of times, still produced the brightest of stars. “This is for them,” concludes Dan.
Independent clothing brand, Ayr Space touches down with its latest range of apparel and a new designs for the 2022 season.
CORNWALLLIFESTYLELIVING | 95
The latest design, From The Sea To The Stars, combines themes of cinema and space travel by constructing the entire map of Cornwall and Isles of Scilly as if it were a constellation of stars. Including all the key towns and villages with the connecting network of roads, each star represents not only the place but everyone who resides there.
AYR Findayr_space@icloud.comwww.ayrspace.co.ukSPACEmorelikethis:www.cornwall-living.co.uk
quality. style. mélangeservice Nalders Court n Pydar Street Truro n Cornwall n TR1 2XH 01872 223 www.melangefashion.co.ukenquiries@melangefashion.co.uk767melangeladiesclothing S u i t e O n e , M a n s i o n H o u s e , P r i n c e ' s S t r e e t , T r u r o , T R 1 2 R F w w w e t h i c a d i a m o n d s c o u 0k 1 8 7 2 2 2 2 2 4 8 @ e t h i c a d i a m o n d s A W A R D W I N N I N G , K I N D N O T M I N E D J E W E L L E R Y S p e c i a l i s t s i n t h e h i g h e s t q u a l i t y l a b g r o w n d i a m o n d a n d g e m s t o n e j e w e l l e r y , m a d e t o o r d e r i n t h e U K S h o p o n l i n e o r m a k e a n a p p o i n t m e n t a t o u r T r u r o s h o w r o o m CL124--PCV27--AD--Ethica Diamonds--0.5.indd 1 07/06/2022 16:41
CORNWALL LIVING | 97
Settled nicely amongst the now thriving atmosphere that Nansledan has provided, a carefully curated selection of vintage and vintage inspired fashion, accessories and lifestyle goods are just waiting to be discovered in this stylish and inspiring emporium for all things unique. “There’s such a strong local community vibe in Nansledan of start-up businesses and established Cornish brands, I couldn’t wait to open my shop here,” Bex explains. “I’m thrilled to say that I feel my brand is now complete and I can start fully rolling out my vintage mission. Let’s do this together, let’s shop for one-of-a-kind finds!”
S
Having launched this incredibly successful business online after lockdown was lifted earlier this year, the old vintage styles that make Love of Lemons so unique are entirely handpicked by Bex with the idea of reusing these star finds and inviting people to add them to their existing wardrobes. Her motto is ‘Re-use. Re-love. Re-style.’ and the aim is to bring the old back to life alongside the new, all the while reducing the impact that the fashion industry has on the planet.
elling a uniquely curated edit of vintage fashion and accessories, alongside a considered range of vintage inspired, sustainably produced brands, Love of Lemon’s long-awaited new shop in Nansledan has opened its doors to the public and invites us all to dive headfirst into the fascinating world of founder, Bex Osman.
After the grand opening in November of last year, Bex has enjoyed a wonderful reception, welcoming newcomers to the Love of Lemons' world, alongside some familiar faces, as she goes on to explain: “I want to thank everyone who has backed my dream and supported me on my vintage journey, and to those who have already become loyal customers to my online store, the response has been overwhelming and affirmed everything I felt when dreaming about starting Love of Lemons.”
LOVE OF LEMONS 1 Chi Esels, Gwarak Esels, Nansledan, Newquay TR8 4SB 01637 Findloveoflemons.co.uk520379morelikethis:www.cornwall-living.co.uk With a motto to re-use, re-love and re-style, Bex Osman is making waves in the world of vintage fashion. ABOVE Old handpickedstylesvintageeach by Bex herself
One of LIFESTYLE A KIND
For over fifteen years Bishop Phillpott has been the name for designer fashion in Cornwall.
B ishop Phillpott is a designer womenswear boutique based on New Bridge Street in Truro. Run by a mother and daughter team, with a background in the fashion industry, the store prides itself on stocking brands that offer that little something different – high-quality pieces that you will treasure now and for years to come. Each season they try and bring new and exciting labels to their established range, most of which they sell exclusively in Cornwall. They really love the idea that people are moving towards buying fewer clothes, opting for style and quality over quantity.
SARTORIAL Shine
LIFESTYLE 98 | CORNWALL LIVING
BISHOP PHILLPOTT New Bridge House, 24 New Bridge Street, Truro TR1 2AA 01872 Findwww.bishopphillpott.co.uk261750morelikethis:www.cornwall-living.co.uk
Brands include well-established favourites such as items from famed British designer, Paul Smith, with his signature prints and unusual colour combinations providing discerning fashionistas with something truly special; Weekend by MaxMara, an Italian brand that’s famed for its classic pieces with a twist – from gorgeous wool knits, to cotton shirts and their famed range of coats; and American Vintage, a collection full of beautiful and vibrant coloured knits, basic tees and jackets that are made to last and promise to bring some fun to your wardrobe. Marc Cain and Paige jeans can also be found in-store. Fresh new players include British cashmere brands like Jumper 1234 and Van Kukil cashmere – both of whom import the highestquality sustainably and ethically sourced cashmere from Mongolia. Bishop Phillpott has also recently welcomed Spanish label Ecoalf on-board, a company that has won awards for its planet-friendly approach, recycling plastic from the ocean and crafting it into beautiful, wearable pieces for the everyday. The personal service on offer here is second to none, and the team are always on hand to offer style advice for those who feel they are stuck in a fashion rut, or perhaps need some inspiration for a special occasion. They really want women to feel great and to experience the fun of wearing something different; they love nothing more than witnessing the transformation in their customers, having helped them to radiate with confidence as they leave the store with their chosen items.
SLICKERS • DOGHOUSE І 5 North Quay І Padstow І Cornwall PL28 8AF Contact: +44 7917 005071 І www.slickersdoghouse.co.uk Slick s DOGHOUSE • PADSTOW As an online and in-store pet shop, we are on a mission to provide eco-friendly, sustainable products for our planet as well as our dogs. In fact, we were recently awarded ‘Britain’s Favourite Independent Pet Shop’ by Beco! Opening Hours Mon-Sat: 10am - 5.30pm І Sun: 10am - 4pm
6THE COWHOUSE GALLERY River Fal near Trelissick by Paul Young photography Situated in the picturesque coastal village of Perranuthnoe, the Cowhouse Gallery is run entirely by a group of local artists and craftspeople, offering a wide range of original pieces including paintings, ceramics, jewellery, glass and more! Make sure to pay the gallery a visit, which is open daily, summer hours 10am to 5pm.
In the penultimate week of the season for the gallery, we have an exhibition of four guest artists! Maxine Whitbread-Abrutat says her work is “the emotive questioning of landscape”. Vast skies and changing light inform Jo Cottam’s work. Liz Dickinson describes her style as “abstracted, interpreted rather than an exact response” while Sue Loydell depicts landscape and sea. The exhibition of The5Collective runs from 15th – 21st October. ROSKILLY’S, TREGALLAST BARTON FARM, ST KEVERNE TR12 coastcolourcanvasgallery6NX
OnDisplay
THE STUDIO, GOLDMARTIN GARAGE, SAMPYS HILL, MAWNAN SMITH, FALMOUTH, TR11 5EW 07768 193848 | info@melchambers.commwww.alchemytiles.com
43 162 5
3 COAST COLOUR CANVAS Booby’s Bay by Maxine Whitbread-Abrutat
1 SUSY WARD CERAMICS Stoneware by Susy Ward Wheel thrown and looking luscious. Two very different stoneware platters, a sgraffito mug and a coffee cup and saucer. As Susy says: “Production is diverse in my studio because I cover all aspects of ceramics in my weekly workshops.” She’s always happy to show visitors around and of course Stone’s Bakery café at KROWJI is one of the best! 07855 www.susywardceramics.comsusywardg10@yahoo.com102598
2 ALCHEMY TILES Home by Mel Chambers Featuring John Cage’s words, “We carry our homes within us, which enable us to fly”. Cornish made and exquisitely hand carved by Mel Chambers of Alchemy Tiles. Using ancient 13th Century inlay techniques each piece is individually hand carved (not painted) with beautiful images and words into stunning bespoke and unique creations. Each handmade tile held eternal in earth and time. Commissions welcome.
4 JESSICA THOMAS ARTWORKS Collage Mackerel by Jessica Thomas Jessica captures her love of wildlife from the garden to the sea, using a diverse range of techniques including paper cut, lino print and collage. This ‘Collage Mackerel’ comes framed and was created using recycled guitar strings, workbook acetate, bike handlebar tape and bike inner tube. Her online shop has a beautiful range of work featuring greetings cards, small gifts, prints and original artwork. Commissions taken. jessicathomas.uk.com | jt@jessicathomas.uk.com jessica JessicaThomasArtworksthomas_artworks
ART 100 | CORNWALL LIVING
5 DR MARTÍN RASKOVSKY Wiggly Trees by Dr Martín Raskovsky Since early childhood photography has been Martín Raskovsky’s passion. From simple beginnings with a makeshift darkroom in the bathroom of his parents’ house to his current digital edit suite, his imaginative work is, and always has, rested in the realm of surrealism and impressionism. Subsequently, his photographs are often mistaken for paintings – ones that capture the workings of the sub-conscious and echo a dreamlike quality. martinraskovsky | mail@martinr.commartin.raskovsky.photographymartinraskovsky|www.martinr.com
LYNFIELD CRAFT CENTRE, PERRANUTHNOE TR20 9NE 01736 www.cowhousegallery.co.uk710538
11 COLOUR & SPACE Chapel Rock Pool By Joe Mcdonald
ART CORNWALL LIVING | 101
10 VINCENT BASHAM High Tide Porthcothan by Vincent Basham Vincent has a purpose-built studio in Wadebridge, Cornwall adjacent to his home which has far reaching views over the Camel Estuary, open from 10am until 4pm daily, but these hours can be flexible. Simply give him a call to check if he’s available outside of these hours. Vincent takes his inspiration for his seascape paintings from the wonderful Cornish coast. The last exhibition dates for 2022 in the Padstow Institute, Padstow, Cornwall PL28 8AB, are 15th to 31st August. Vincent is happy to take on commissions or reproduce any of his paintings from his website in a size of your choice. 07836 www.vincentbasham.co.ukvince@vincentbasham.co.uk244983
11
Emily creates work that is beautiful yet thought provoking, delving into the fragile dimensions of sea-life. The jellyfish sting is like an electric shock – a spark of nature’s energy. ‘STUNG’ is a striking aqua neon, handblown to Emily’s handwriting, mounted on acrylic with a UV print taken from an original EP ink painting. The use of light adds movement to the paintings and brings the energy of the sea into your home! www.emilypenfold.comeompenfold@hotmail.com
1 THE GOUNCE, PERRANPORTH TR6 0JW 01872 www.colourandspace.co.ukinfo@colourandspace.co.uk575689
7BESPOKE SURF Handcrafted Home Décor by Michael Jenkin
9 EMILY PENFOLD STUNG by Emily Penfold
Taking inspiration from the intrinsic surf culture that lies at the heart of Cornwall, Michael Jenkin, owner and founder of Bespoke Surf, channels this lifestyle into hand-crafted, functional pieces to adorn the home of any wave lover. From full-size decorative boards to coffee tables, candle holders, wine caddies, and even shelves and mirrors, there’s a little something to suit any corner of your house. 07856 www.bespokesurf.co.uk594414
12 ATISHOO GALLERY Starlight, Charlestown by Alan Arthurs
1297
Atishoo Gallery is a family business with a fantastic selection of original paintings and prints, many produced by owners Liz Hackney and Paul Clark. The gift shop also sells pottery, glassware, jewellery art cards and homewares. Atishoo can be found in a pretty courtyard opposite the old Charlestown Methodist Church. Liz and Paul also have an onsite bespoke picture framing workshop. Please see the website for opening times.
Celebrate the local landscape with the new exhibition – A Cornish Summer. It highlights a new collection of original artworks which explores the colours and atmosphere of the coastline and captures those easy-going beach days. The Gallery is run by artists who take inspiration from the landscape and wildlife around Cornwall and the south west. Free UK delivery and framing options available.
Showcasing local artists and art galleries.
71 CHARLSETOWN ROAD, CHARLESTOWN, ST AUSTELL PL25 3NL 01726 65900 | www.atishoogallery.co.uk
8 FUSED GLASS BY CLAIRE HARRIS Beach Scene by Claire Harris In this beautiful piece, the thin layers of glass are carefully cut to create the background image, then crushed glass (called ‘frit’) is added. Course frit adds extra texture, whilst the powdered frit creates the fluffy look of the clouds. This piece is depicted in its unfired state; it will gradually be heated in a specialist glass kiln to around 800 degrees Celsius, in a process that will take around 12 hours. UNIT 8, THE MARKET HOUSE, MARKET HILL, ST AUSTELL PL25 5QB | 07719 www.fusedglassbyclaireharris.co.uk321348 8 10
www.jodowns.com padstow | st ives | fowey | tintagel | launceston 15% off any purchase over £30* when you enter ‘CG30’ at checkout or present this advert in galleries *excludes commissions. Not in conjunction with any other offer. Chrismas cards 15 for £9 In stores and online now Cards | Art | whistlefish.comGifts FROM OUR TO YOURS home Christmas cards designed and printed in Cornwall, delivered to you. Famous Cornish Heart image
Photographer Ander Gunn has spent a lifetime turning his lens to the world. From a photo of a workingclass Londoner framed in the doorway of a red-brick clad public convenience, to intimate portraits of the brightest lights of the St Ives School, this exhibition of photographic images reflects his output over the last 70 years to offer a sample of both rural and urban subject matter. “Watching my father at work felt like being with a magician conjuring up images that floated into life,” explains his daughter, Charlotte Gunn. “Time always seemed to melt away. It was a very magical experience. To wash his photographs Ander had to use the bath. Large prints of people, landscapes and seascapes floating as we cleaned our teeth. I’d often see people that I recognised locally – Roger Hilton, Patrick Heron, a tin miner, a farmer with his cattle. Other familiar faces included writers and artists such as Tom Stoppard, Barbara Hepworth, Jean Rhys, Karl Weshke, Brenda Wooton and my uncle Thom, Ander’s brother.”
CELEBRATIONAn exhibition of
JACKSON FOUNDATION GALLERY Findwww.jacksonfoundationgallery.comjacksonfgalleryjacksonfoundationmorelikethis:www.cornwall-living.co.uk
ART CORNWALL LIVING | 103
For Helford River, Jackson turns his eye to that stretch of water running west to east, entering the sea into Falmouth Bay. The Helford’s shoreline is vast, taking in a wide range of habitats; its exposed rocky estuary stands in stark contrast to the sheltered muddy creeks found further inland. This flooded river valley is fed by seven streams including Frenchman’s Creek, immortalised by Daphne DuMaurier’s enduringly popular novel of the same name. A dedicated environmentalist, Kurt Jackson is drawn to the Helford not just for its stunning vistas and romantic associations, but equally for its significance as an area rich in biodiversity and importance to conservation and wildlife. In what is sure to be another blockbuster, this exhibition draws together Jackson’s paintings, sculptures, etchings and ceramics to celebrate a truly unique part of Cornwall.
The name Kurt Jackson is synonymous with large-scale, ambitious, visceral plein-air paintings that capture the raw power and natural beauty of the landscape laid before his canvas. In his newest collection, leading British contemporary artist Kurt Jackson revisits the Helford River, its creeks and tributaries to reveal stunning beauty and incredible biodiversity. Along the way, Jackson explores the wildlife and the communities that live in and on this unique watercourse.
Introducing two blockbuster exhibitions at the Jackson Foundation Gallery, St Just. ABOVE Kurt Jackson - A jar found in Frenchman’s Creek with flowers from a Helford daffodil field. 2022. BELOW RIGHT Kurt Jackson - With the first swallows and the gorse perfume, Nare Head and into the Helford. 2022. BELOW Ander Gunn - Hyde Park. 1984.
Kurt Jackson: Helford River & Ander Gunn: Seven Decades will be exhibited at the multi-awardwinning Jackson Foundation gallery in St Just, West Cornwall until February 2023.
ART 104 | CORNWALL LIVING H
Join us, as we look forward to a celebration of Atishoo Gallery’s two decades of providing a unique creative space in the heart of Charlestown. ABOVE Atishoo CharlestownGallery, TOP A unique creative space INSET Show Me The Honey (limited edition) by Dawn Maciocia
Owned and run by artists and bespoke picture framers Liz Hackney and Paul Clark, you'll find originals and prints by both of them displayed amongst the eclectic collection of art and crafts from artists and designers across the UK, including Stephanie Axtell from Wadebridge and Duporth artist Alan Arthurs. New for this year, Atishoo is delighted to introduce collage artist Dawn Maciocia, based in Fife, Scotland. Her artwork, made with torn paper, includes foxes, hares, owls and British garden birds. She prints her own fabric from the designs and produces lampshades, cushions and tiles as well as limited edition prints of her stunning work. The lampshades are completed with recycled coloured glass lamp-bases and colourful flexes all handmade in the South West. Another new addition this year are raku clocks made by the incredibly talented Stonesplitter Ceramics which complement the colourful paintings that hang in the gallery. If you look very carefully, you’ll find a little mouse hidden on each clock! Liz and Paul also offer a bespoke picture framing service from the onsite workshop with over 40 years of combined experience between them. Atishoo is the official picture framers for some of Cornwall's leading artists, including Amanda Hoskin and Ben Taffinder; with an eye for detail, they are known for their quality framing work and are often booked up four to six weeks in advance, so it's worth planning ahead if you have a show coming up and require their services.
idden behind pretty cottage gardens opposite the Old Charlestown Chapel, Atishoo Gallery will be celebrating 20 years in the town in 2023. Sometimes overlooked by visitors and locals alike due to its tucked-away location, it is a place well worth seeking out if you are in the area. Full to the brim with original art, prints, glassware, ceramics and homewares –from plush faux velvet cushions to beautiful lampshades – it's not what you would expect from a normal formal gallery space and that is part of its elusive charm.
An artist’s DISCOVEREXPERIENCEMORE...
ATISHOO GALLERY 71 Charlestown Road, Charlestown, St. Austell PL25 3NL 01726 Findwww.atishoogallery.co.uk65900morelikethis:www.cornwall-living.co.uk
Atishoo Gallery is open Tuesday to Saturday 11am to 4pm, although it’s always best to check the website for up-to-date hours. www.atishoogallery.co.uk
EMPORIUM
CONTACT US TODAY ON enquiries@theoceanagency.co.ukforyourfreeonlinebusinesssnapshotreport,coveringSEO,Hygiene,OptimisationandPresence.01326574842www.theoceanagency.co.uk COMPLETE END-TO-END MARKETING FOR YOUR BUSINESS WEB DESIGN Your website is your business window to the world, your first chance to make a good impression. SEO Knowing your audience’s intent and delivering it in a way search engines can find and understand. REPUTATION MANAGEMENT Monitoring how your consumers perceive your business and taking strategic action when necessary. CONTENT CREATION Through great content you can build genuine relationships with your audience, to drive engagement. PUBLISHING A well-developed magazine is a substantial marketing tool that helps you grow your brand. DIGITAL Building customer relationships means consistent, relevant communication with your customers. VIDEO PRODUCTION Video is one of the most consumed forms of content and if you aren’t creating it you are missing out.
I n short, Business Relief is not available. The relief applies to reduce the chargeable value of a qualifying asset by either 100% (total relief) or 50%, saving inheritance tax that is generally chargeable at 40%, and therefore hugely valuable. Broadly, the relief applies to trading business assets – interests in trading businesses themselves, assets used in a trading business and shares in unquoted trading companies.
An overwhelming number of holiday-let landlords believe that their property won’t be subject to inheritance tax. Think again. the BELOW Steve MaggsCTA Tax
Furnished holiday lets (FHLs) are a property investment activity (not a trade) that is deemed to be a trading activity for many tax purposes, and are, at least theoretically, capable of qualifying for inheritance tax Business Relief. This the starting point of the great myth!
LIFESTYLE 106 | CORNWALL LIVING
Busting
For Business Relief to apply, the business asset being considered must not consist of “wholly or mainly…making or holding investments”. Property businesses are notoriously difficult for placing on the scale of investment activity on one end of the scale and training activity on the other. The extremes of a landlord letting a property on an AST or commercial lease on the one hand of extreme property investment, with a hotel operation or property development/
MYTH
Partner
RRL01736 Findwww.rrlcornwall.co.ukpost@rrlcornwall.co.uk339322morelikethis:www.cornwall-living.co.uk MartenHarli
In recent years, only one judgement by the First Tier Tribunal has resulted in a win for the taxpayer, and even this reaffirms the position that the bar is incredibly high for any FHL landlord to meet to be considered to qualify for Business Relief.
This case was the case of Personal Representatives of Graham versus HMRC – a ‘home case’ given that it concerned an FHL business on the Isles of Scilly. HMRC enquired into the claim for Business Relief in relation to the four self-catering flats, and farmhouse occasionally used as bed and breakfast accommodation. As ever, the question was whether Mrs Graham and her daughter (who ran the business) were providing enough additional services to mean that the business was not one of property investment.
This opinion has been consistently ratified by the tax tribunals and courts –as is evidenced by the significant number of judgements that have gone in HMRC’s favour when challenging Business Relief claims made by executors of deceased estates owning interests in FHLs.
construction operation on the other extreme of the scale at the trading end. FHL activity falls somewhere in between these extremes, falling somewhere mid-way along the scale – how far along the scale the particular FHL activity sits determines the qualification for Business Relief. Where an FHL fits on this property activity scale is largely determined by the provision of services, and the facilities provided. The myth can be whittled down to FHL landlords assuming that their FHL property interests automatically qualify for Business Relief, whereas placement on this scale actually determines qualification – and the bar is an extremely high one!
FHL landlords need to be aware that they are highly unlikely to qualify for inheritance tax Business Relief, meaning that their interests in the properties will be chargeable to inheritance tax. This means that it makes sense to seek experienced and professional advice on how best to plan for this.
The tribunal heard that the services and facilities included refreshments and a welcome pack on arrival; the owners being on hand to take in shopping, organise celebrations and organise activities, as well as arrange the purchase of fresh fish for their customers; an outdoor pool; well-maintained gardens; a sauna, games room, laundry, separate guest lounge and barbeque area; the supply of fresh flowers, homemade goods, toiletries, books and more; as well as a golf buggy and bicycle hire. In short, the services and facilities were extensive, and the operation was demanding. The tribunal decided that it was “an exceptional case which does, just, fall on the non-mainly investment side of the line”. It is difficult to see what more an FHL landlord could do to push the operation firmly over the line. It evidences the difficulty FHL landlords face, as opposed to being held out as a victory and signal for change.
The view of HM Revenue & Customs (HMRC) is stated (in their Inheritance Tax Manual to their officers) as: “HMRC’s view is that furnished holiday lets will in general not qualify for business property relief. The income derived from such businesses will largely consist of rent in return for the occupation of property. There may however be cases where the level of additional services provided is so high that the activity can be considered as non-investment, and each case needs to be treated on its own facts.”
CORNWALLLIFESTYLELIVING | 107 ElliottBenjamin MartenHarli
Experience a dreamy night’s sleep with a bespoke, king-size, cast-iron bed base from The Cornish Bed Company; one of the last foundries to hand cast traditional iron, brass and nickel beds that are indistinguishable from their original Victorian antique counterparts. Worth£60
108 | CORNWALL LIVING Win! Enter our competitions for the chance to win these fantastic prizes!
The Cornish Fishmonger is a family run business of more than 40 years, with an enviable reputation for supplying top quality, sustainable fish and shellfish to many of the nation’s top chefs. The same quality seafood ordered by Michelin starred professionals can be yours to cook at home.
TERMS AND CONDITIONS No purchase necessary. Prize draw open to anyone in the UK age 18 years or over excluding employees of The Cornish Bed Company, The Cornish Holiday Company, Cornish Rock Gin, Cornwall Coastal Retreat, The Cornish Fishmonger, WOW, Leven Media Group, and their families, agents and anyone else connected with this promotion. One entry per Thehousehold.prizeis non-transferrable and nonexchangeable. No cash alternative available. Winners must be willing to provide their name and country of residence for publicity if required. The promoter’s decision is final and no correspondence will be entered into. The winners will be drawn at random after 3rd October. The winners will be notified by email within 14 days after the draw closes. Subject to availability. See online for full terms and conditions. www.cornwall- living.co.uk
Win a hamper full of flavour from Cornish Rock Gin With a taste of eight of their incredible gins inside, including samples of Cornish Gold, Orange Sunset, Cherry Kiss and Blue Angel, not to mention the Espresso and Spiced rums, you won’t want to miss out on this.
Win a cast-ironking-size,bed!
Win a Worth £450
£2,700Worth Visit
A stunning property which sleeps four just minutes away from the main town, brought to you by The Cornish Holiday Company. Included in the prize is a welcome basket with a bottle of bubbly and a welcome folder with useful information to help you create everlasting memories of your trip.
Win a voucher for Cornish seafood from The FishmongerCornishWorth£150
inpre-Christmasthree-nightbreakPortIsaac
Win a
CORNWALL LIVING | 109To enter visit: www.cornwall- living.co.uk
With summer behind us, this stunning, laser-cut artwork – ideal for hanging indoors or out – is just what any household needs to get them through the dreary months ahead!
Win a 12-month subscription to DRIFT
Worth up to £495
COMPETITIONS
Win a three-day yoga and fitness retreat
Cornwall Coastal Retreat are delighted to offer a three-day retreat at one of their upcoming yoga and fitness weeks, including accommodation, yoga, beach walks, meals, foraging experiences, and a whole host of fun activities including surfing and film nights.
Worth£139
Enter our competitions!amazing
WowClareartworklaser-cutbyJohncourtesyofCornwall
Our competitions give just a small glimpse of the very best of what some of our favourite businesses have to offer, but you have to be in it to win it! After entering a Cornwall Living competition, Richard Fudge and his family recently won an amazing stay at Polzeath Beach House: “I would like to say a big thank you to Cornwall Living magazine for running this competition, but more importantly to John and the team at Polzeath Beach House. We couldn’t have asked for a more relaxing stay in luxurious surroundings! Once again thank you – a fantastic prize.”
With eight volumes per year, a subscription to DRIFT delivers to your door the pinnacle of luxury lifestyle in Cornwall, taking you on an editorial odyssey through a combination of sophisticated and relevant features. From the most luxurious of places to spend an eveningsampling local delicacies to the most unique local artisans, there is much to be discovered through the lens of DRIFT If you want to experience the Duchy at its very best, become a member of DRIFT’s exclusive readership and make it your personal advisor for experiencing Cornwall’s finest.
Worth£80
DISCOVEREXPERIENCEMORE... If you have varicose veins or a related condition and would like to know more about your options, or to book a consultation with Mr Rob Windhaber, call Duchy Hospital on 01872 438091
TAKE A stand ABOVE Living life to the fullest
Mr Windhaber stresses the importance of maintaining a healthy weight, not smoking, eating a balanced diet (avoiding processed foods) and carrying out regular gentle exercise, as they have all been shown to help improve and maintain a healthy circulation. However, for those struggling with the appearance of their veins, there are options to cover up and camouflage unsightly veins with concealer or fake tan product, whilst aching can be relieved by the use of compression stockings or the application of topical anti-inflammatory gels such ibuprofen or Voltarol gel, both of which can be purchased over the counter.
DUCHY HOSPITAL 01872 Findwww.duchyhospital.co.uk438091morelikethis:www.cornwall-living.co.uk Struggling with varicose veins? Duchy Hospital has some advice on symptoms and treatment, from Consultant Vascular Surgeon and Vein Expert, Mr Windhaber.
LIFESTYLE 110 | CORNWALL LIVING C ornwall in summertime truly is one of the most beautiful places in the world. Spending time outside getting fresh air and exercise is key to maintaining our mental and physical health.
Unfortunately, varicose veins could be affecting this and preventing some from wanting to, or being able to, go outside this summer.
Mr Windhaber tells us: “For those patients who want to get rid of their varicose veins there are a number of treatments available, all performed as a ‘walk in, walk out’ procedure under local anaesthetic at Duchy Hospital. These treatments are recommended by the National Institute of Health and Care Excellence NICE CG168 (www.nice.org. uk/guidance/cg168) as being safe and the most effective available for this condition. Treatments include endovenous laser therapy, radiofrequency ablation, microphlebectomy, sclerotherapy (foam) and short-wave diathermy.” Mr Windhaber tailors treatment to each individual based on a full clinical history and detailed venous duplex scan.
Mr Rob Windhaber is a Consultant Vascular Surgeon and Vein Expert specialising in the minimally invasive treatment of varicose veins under local anaesthetic, working at Duchy Hospital. We have been talking to Mr Windhaber about symptoms and treatment: “Many patients tell me that they cover up and avoid wearing summer clothes because they are uncomfortable about the appearance of veins on their legs. Others find they are limited in their activities by discomfort or swelling in the legs when they walk. The good news is that it does not have to be like this. Vein treatments have improved massively since the days of painful stripping operations under general anaesthesia and there are many things that you can do yourself to ease the condition.”
Sale and purchase of freehold and leasehold properties Equity Co-ownershipRe-mortgagesReleasetransfers Maria Richards Consultant Chartered Legal Executive 01637 800804 MRichards@setfords.co.uk Inheritance PowersWillsofAttorneyTaxplanning Trusts Probate Hannah Durston Consultant Private Client Solicitor 01841 550239 HDurston@setfords.co.uk Cornwall based for local appointments Instructions taken via virtual appointments OPEN EVENTS 11+ Senior School Open Morning Saturday, 1 October 2022 CL126--PCV29--AD--Truro School--0.25.indd 1 09/08/2022 14:45 It costs only £150 to become a DIVE BUDDY SPONSOR, and helps deliver a vital part of DIVE PROJECT CORNWALL’s mission to make a difference to the lives of 400 lucky teenagers. To find out more about becoming a DIVE BUDDY SPONSOR email andy@diveprojectcornwall.co.uk or call Andy on 07711 160590 PROUDLY SUPPORTED BY www. dive projectcornwall .co.uk A NOT-FOR-PROFIT, COMMUNITY INTEREST COMPANYDIVEPROJECTCORNWALL Education I Environment I Experience GET INVOLVED AND MAKE A DIFFERENCE You don’t even have to get wet! 1 Chi Myghtern Arthur, Nansleden, TR8 4SE moore_movement_fitness Moore Movement Fitness Wewww.mooremovefit.comareNewquay’spremierpersonal training facility, specialising in small group training, the ideal balance between personalised, focused training and group motivation. This is the secret to achieving the great lasting results you’ve always wanted. Contact us today to find out about our 30 day trial: Email: mooremovefit@gmail.com
Building for Humanity CIC Unit 7, Cornwall Business Park, West Scorrier, Redruth, Cornwall, TR16 5EZ T: 01209 311722 M: www.buildingforenquiries@buildingforhumanity.org.uk07842327374humanity.org.ukYourFuture in Our Hands Faced with the rising cost of home energy bills? You may be eligible for Help Improving Your Homes Energy Efficiency. Building for Humanity is a not-for-profit organisation operating nationwide. The organisation’s people-focused approach addresses a number of social issues – such as fuel poverty, a shortage of social housing, rising welfare bills and a lack of energy-efficient sustainable homes for the future. Call us to find out more on 01209 311722
On day four, the spectacular UNESCO World Heritage Site, Mont-Saint-Michel, will grow on the horizon before welcoming the team across the finish line. “The pride, comradery and sense of achievement will make all the days in the saddle worth it as we let our magnificent achievement soak in,”
MAKE A DIFFERENCE
ABOVE An CORNWALLgreatexperienceunforgettableforacauseCHARITYLIVING | 113
A re you up for an extraordinary adventure in 2023? Join Cornwall Hospice Care on their fully supported and bespoke cycle from Cornwall to Mont-Saint-Michel, France in an entirely unique opportunity to fund your local adult hospice nurses across Cornwall. The Mont-Saint-Michel Cycle is an incredible cycling challenge and will be the third bespoke overseas cycle for the charity since 2017, as Oli Hoare, Head of Fundraising explains: “We’re so excited to be sharing this extraordinary ride with our community and the response has already been superb. It’ll be a privilege to take 30 cyclists overseas all in the name of a good cause that will achieve so much for our patients and their families. This challenge is for all abilities and anyone who hasn’t been on a bike for a long while, don’t despair, we’ll help you train and be well prepared. You’ll be amazed at how many participants in the past hadn’t been on their bike for years!”
Participants will spend four days in the saddle, cycling 278 miles from Cornwall. The journey will begin on the gorgeous Roseland Heritage Coast and once underway will take the riders via Mount Edgcumbe Hospice in St Austell to Plymouth to catch the overnight ferry. The next morning the journey across France begins with three days of cycling through quiet French country lanes and traditional market towns, all whilst hugging the coastline and enjoying the views of stunning sandy beaches.
CORNWALL HOSPICE CARE 01726 66868 option Findwww.cornwallhospicecare.co.uk3morelikethis:www.cornwall-living.co.uk Push the boundaries of what you thought you could do while making life-long friends and unforgettable memories along the way.
OliSigncontinues.upoptions include both a fundraising target option and another to pay the cost of the cycle and choose your own sponsorship target. Make sure to visit co.uk/montsaintmichelcyclewww.cornwallhospicecare.tofindoutmore!
Padstow | £345,000 01841 532555 | www.jackie-stanley.co.uksales@jackie-stanley.co.uk Port Isaac | £550,000 This two double bedroom terraced property is situated within the Sarahs View development, a quiet residential area of Padstow just a short walk from the harbour and extensive range of cafés, public houses and restaurants. This handsome double-fronted three-storey cottage is full of original and endearing character, with three double bedrooms, master en-suite, and a pretty, elevated garden located just above the picturesque harbour and water's edge below.
Wadebridge | sales@jackie-stanley.co.uk£375,000 | 01841 532555 Watergatewww.jackie-stanley.co.ukBay|£300,000 33 Town Quay is a beautifully presented and generously proportioned two double bedroom top floor apartment situated in a hugely convenient position within the thriving market town of Wadebridge. Sited in an elevated position within the Waves development with a pleasant outlook over the communal gardens, 29 Waves is a contemporary one bedroom, one bathroom apartment located in Watergate Bay just 150 meters from the spectacular sandy beach.
GWEL MARTEN, CARBIS BAY Guide £550,000 Commanding mesmerising and uninterrupted panoramic sea views over Carbis Bay and towards St Ives, this well-presented two bedroomed apartment enjoys one of the most sought-after locations in Cornwall, set within a position that is perfectly placed for the beach, branchline rail and coast path to St Ives. 1,020 sq ft (EPC = C) contact@shorepartnership.com01872 484484shorepartnership.com
NOWSOLD OCEAN WALK, PERRANPORTH Guide £700,000 A very high quality and contemporary townhouse, completed in 2020, enjoying a quiet position within an exclusive gated development of only five houses within a short level walk of Perranporth beach and village amenities. This impeccably arranged and energy efficient home features four en suite bedrooms, two balconies, a private garden and two allocated parking spaces. 1,780 sq ft. EPC = contact@shorepartnership.comC01872 484484shorepartnership.com
rohrsandrowe.co.uk info@rohrsandrowe.co.uk01872 306 360 PORTHLEVEN | SOUTH CORNWALL | OFFERS OVER £1,000,000 | EPC D COASTAL | COUNTRY | TOWN | MODERN | PERIOD
rohrsandrowe.co.uk info@rohrsandrowe.co.uk01872 306 360 TRURO | SOUTH CORNWALL | GUIDE PRICE £1,950,000 COASTAL | COUNTRY | TOWN | MODERN | PERIOD
CLOSE TO THE HELFORD RIVER, LIZARD PENINSULA Watch the full video tour for this stunning four bedroom country house with detached outbuildings and part walled gardens. Search YouTube for ‘An Kilenn’ Guide Price - £925,000 www.thematherpartnership.co.uk01326 565016 NEAR KENNACK SANDS, LIZARD PENINSULA This two bedroom luxury apartment with parking is simply beautiful. Watch the full video tour by searching YouTube for ‘7 The Beach, Kuggar’ Guide Price - £425,000
Estate Agents Truro 01872 242244 www.philip-martin.co.uk Roseland 01326 270008 LAMBOURNE FARM, TOLCARNE LARGE DETACHED CHARACTER HOUSE SET IN 0.8 OF AN ACRE A beautifully presented property with over 2,500 square feet of accommodation offering tremendous versatility as either a spacious family home or with the option of an integral annexe for relatives or for letting to provide an income. Parking for several cars and stunning gardens with many secret nooks and crannies as well as a large area of lawn, an orchard, small woodland, patios and a rockery. The grounds really are magical with a host of established plants and shrubs creating the most beautiful outdoor spaces which must be viewed. EPC - D Guide Price £795,000
Travel from the open plains of the African savannah to the tranquil gardens of Japan and South America’s tropical forests in just one day! Meet free-flying birds in the Gems of the Jungle aviary, encounter endangered and unusual creatures on the Wildlife at Night exhibition, and investigate reptiles and amphibians in the Tropical House. And don’t forget to visit the Village Farm and give the pygmy goats a scratch!
Meet your favourite animals, discover new and unusual species and get up close to some of the wonders of the natural world. ABOVE Explore a world of animals and adventure at Newquay Zoo.
CHARITY 122 | CORNWALL LIVING
Throughout the day, you’ll also be able to learn more about Newquay’s animals, and even see them in action, with a range of talks, activities and feeding times. There are also a variety of outdoor play areas where little ones can let off steam, as well as the Tarzan Trail assault course where even grownups can join in the fun! Plus, check out the beautiful grounds, from the elegant Oriental Garden to the Secret Garden, hidden in the heart of the zoo. To refuel during your adventure, Newquay Zoo offers a wide selection of fresh, local and ethically sourced food. Enjoy a spot of lunch at Café Lemur, which serves a delicious range of food from pizzas and burgers to salads and mezze boxes. Or grab food on the go from one of the takeaway kiosks located at convenient locations around the zoo. Newquay Zoo is part of Wild Planet Trust, an education, research and conservation charity which supports a number of conservation projects around the world and plays a key role in breeding programmes for endangered species. Located just a short walk away from Newquay town centre, it is one of Cornwall’s most loved visitor attractions, and come rain or shine, offers fun for all the family. The best part is that by visiting, you are also directly helping to conserve life in the wild. NEWQUAY ZOO Trenance Gardens, Newquay TR7 2LZ 01637 Findwww.newquayzoo.org.uknewquayzoo@wildplanettrust.org.uk873342morelikethis:www.cornwall-living.co.uk
W
ith hundreds of animals – from red pandas to penguins, lemurs to lynx – as well as 13 acres of lush sub-tropical gardens and multiple play areas, an adventure at Newquay Zoo promises to be a real wild time.
DISCOVEREXPERIENCEMORE Newquay Zoo is open from 10am every day (except Christmas Day). Closing times and last entry vary throughout the year, so please see the website to find out more. For more information and to book tickets visit newquayzoo.org.uk
ADVENTUREA wild
and snow days and Sundays and hot chocolates Brownies and birthdaysand picnics andpancakes crumbles CREAM TEASand and thank yous and Everything’s better WITH
discovermichaelspiers.co.ukourworld